CHARACTERISATION OF Phaseolus coccineus INTERSPECIFIC ...
African Journals Online (AJOL)
ACSS
2018-02-20
Feb 20, 2018 ... genetic base of this crop, especially for adaptation to extreme environments. The runner bean (Phaseolus coccineus) in particular, has been shown to contribute to disease ...... Emerging disease problems: The case of.
Flatulence-causing galactooligosaccharides of Phaseolus coccineus L. and Phaseolus vulgaris L.
Directory of Open Access Journals (Sweden)
Ryszard Kosson
2014-01-01
Full Text Available Phaseolus coccineus beans were assayed for the presence of raffinose and stachyose in whole seeds and in the morphological parts of the seed: cotyledon, hypocotyl and hull. The quantitative composition of the galactooligosaccharides of Ph. coccineus was compared with Ph. vulgaris seeds. The major galactooligosaccharide of Ph. coccineus seeds is stachyose. Another galactooligosaccharide, verbascose, was present in Ph. coccineus seeds in very low amounts (0.04%. The highest concentrations of raffinose and stachyose were found in the hypocotyl, 1.11% and 7.48%, respectively. The hull contained the lowest quantities of stachyose and only traces of raffinose.
Directory of Open Access Journals (Sweden)
Ryszard Kosson
2013-12-01
Full Text Available The quantitative changes of raffinose and stachyose in seeds of Phaseolus coccineus L. and Phaseolus vulgaris L. during their growth and maturation in a two year experiment were investigated. Trace amounts of raffinose were found in Ph. vulgaris seeds during their vegeta tive growth in 1990. Time of raffinose accumulation in seeds in 1991 began not earlier than on 33rd day since inflorescence. Stachyose started to accumulate in seeds between 33rd and 47th day after inflorescence of all tested cultivars. It was noticed that stachyose and raffinose contents in seeds of most tested cultivars after ten years of storage did not differ significantly when compared to not stored ones.
Domestication Genomics of the Open-Pollinated Scarlet Runner Bean (Phaseolus coccineus L.
Directory of Open Access Journals (Sweden)
Azalea Guerra-García
2017-11-01
Full Text Available The runner bean is a legume species from Mesoamerica closely related to common bean (Phaseolus vulgaris. It is a perennial species, but it is usually cultivated in small-scale agriculture as an annual crop for its dry seeds and edible immature pods. Unlike the common bean, P. coccineus has received little attention from a genetic standpoint. In this work we aim to (1 provide information about the domestication history and domestication events of P. coccineus; (2 examine the distribution and level of genetic diversity in wild and cultivated Mexican populations of this species; and, (3 identify candidate loci to natural and artificial selection. For this, we generated genotyping by sequencing data (42,548 SNPs from 242 individuals of P. coccineus and the domesticated forms of the closely related species P. vulgaris (20 and P. dumosus (35. Eight genetic clusters were detected, of which half corresponds to wild populations and the rest to domesticated plants. The cultivated populations conform a monophyletic clade, suggesting that only one domestication event occurred in Mexico, and that it took place around populations of the Trans-Mexican Volcanic Belt. No difference between wild and domesticated levels of genetic diversity was detected and effective population sizes are relatively high, supporting a weak genetic bottleneck during domestication. Most populations presented an excess of heterozygotes, probably due to inbreeding depression. One population of P. coccineus subsp. striatus had the greatest excess and seems to be genetically isolated despite being geographically close to other wild populations. Contrasting with previous studies, we did not find evidence of recent gene flow between wild and cultivated populations. Based on outlier detection methods, we identified 24 domestication-related SNPs, 13 related to cultivar diversification and eight under natural selection. Few of these SNPs fell within annotated loci, but the annotated
Domestication Genomics of the Open-Pollinated Scarlet Runner Bean (Phaseolus coccineus L.)
Guerra-García, Azalea; Suárez-Atilano, Marco; Mastretta-Yanes, Alicia; Delgado-Salinas, Alfonso; Piñero, Daniel
2017-01-01
The runner bean is a legume species from Mesoamerica closely related to common bean (Phaseolus vulgaris). It is a perennial species, but it is usually cultivated in small-scale agriculture as an annual crop for its dry seeds and edible immature pods. Unlike the common bean, P. coccineus has received little attention from a genetic standpoint. In this work we aim to (1) provide information about the domestication history and domestication events of P. coccineus; (2) examine the distribution and level of genetic diversity in wild and cultivated Mexican populations of this species; and, (3) identify candidate loci to natural and artificial selection. For this, we generated genotyping by sequencing data (42,548 SNPs) from 242 individuals of P. coccineus and the domesticated forms of the closely related species P. vulgaris (20) and P. dumosus (35). Eight genetic clusters were detected, of which half corresponds to wild populations and the rest to domesticated plants. The cultivated populations conform a monophyletic clade, suggesting that only one domestication event occurred in Mexico, and that it took place around populations of the Trans-Mexican Volcanic Belt. No difference between wild and domesticated levels of genetic diversity was detected and effective population sizes are relatively high, supporting a weak genetic bottleneck during domestication. Most populations presented an excess of heterozygotes, probably due to inbreeding depression. One population of P. coccineus subsp. striatus had the greatest excess and seems to be genetically isolated despite being geographically close to other wild populations. Contrasting with previous studies, we did not find evidence of recent gene flow between wild and cultivated populations. Based on outlier detection methods, we identified 24 domestication-related SNPs, 13 related to cultivar diversification and eight under natural selection. Few of these SNPs fell within annotated loci, but the annotated domestication
Novel vitamin E forms in leaves of Kalanchoe daigremontiana and Phaseolus coccineus.
Kruk, Jerzy; Pisarski, Adam; Szymańska, Renata
2011-11-15
In the present study, we isolated novel tocochromanols from green leaves of Kalanchoe daigremontiana and primary leaves of etiolated seedlings of Phaseolus coccineus that were identified as β-, γ-, and δ-tocomonoenols with unsaturation at the terminal isoprene unit of the side chain. The content of γ-tocomonoenol in leaves of etiolated bean increased gradually with the age of seedlings, reaching 50% of the γ-tocopherol level in 40-day-old plants. The content of this compound in leaves was increased by short illumination of etiolated plants and by addition of homogentisic acid, a biosynthetic precursor of tocopherols. These data indicated that γ-tocomonoenol is synthesized de novo from homogentisic acid and tetrahydro-geranylgeraniol diphosphate, a phytol precursor. Based on these results, a biosynthetic pathway of tocomonoenols is proposed. Copyright © 2011 Elsevier GmbH. All rights reserved.
Mercati, F; Catarcione, G; Paolacci, A R; Abenavoli, M R; Sunseri, F; Ciaffi, M
2015-08-01
The landraces are considered important sources of valuable germplasm for breeding activities to face climatic changes as well as to satisfy the requirement of new varieties for marginal areas. Runner bean (Phaseolus coccineus L.) is one of the most cultivated Phaseolus species worldwide, but few studies have been addressed to assess the genetic diversity and structure within and among landrace populations. In the present study, 20 different populations of a runner bean landrace from Central Italy named "Fagiolone," together with 41 accessions from Italy and Mesoamerica, were evaluated by using 14 nuclear SSRs to establish its genetic structure and distinctiveness. Results indicated that "Fagiolone" landrace can be considered as a dynamic evolving open-pollinated population that shows a significant level of genetic variation, mostly detected within populations, and the presence of two main genetic groups, of which one distinguished from other Italian runner bean landraces. Results highlighted also a relevant importance of farmers' management practices able to influence the genetic structure of this landrace, in particular the seed exchanges and selection, and the past introduction in cultivation of landraces/cultivars similar to seed morphology, but genetically rather far from "Fagiolone." The most suitable on-farm strategies for seed collection, conservation and multiplication will be defined based on our results, as a model for threatened populations of other allogamous crop species. STRUCTURE and phylogenetic analyses indicated that Mesoamerican accessions and Italian landraces belong to two distinct gene pools confirming the hypothesis that Europe could be considered a secondary diversification center for P. coccineus.
CHARACTERISATION OF Phaseolus coccineus INTERSPECIFIC ...
African Journals Online (AJOL)
ACSS
2018-02-20
Feb 20, 2018 ... habit) and agronomic attributes (plant vigour, days to physiological maturity; DPM and days to 50% flowering; ... Days to flowering and to DPM ranged from 31-39 and 81-86, ...... evolution, and classification in Phaseolus. pp.
Directory of Open Access Journals (Sweden)
Baudoin JP.
1998-01-01
Full Text Available Phylogenetic relationships among 74 accessions belonging to six species of Phaseolus are investigated using variation in chloroplast DNA assessed according to a PCR-RFLP protocol. Three fragments of chloroplast DNA are amplified using universal primers, and then digested with 10 restriction enzymes. Thirty-six haplotypes are identified on the basis of the polymorphism in fragment number and size. Three main phylogenetic groups, strongly supported through bootstrap analysis, are identified: (1 accessions from Phaseolus lunatus and Phaseolus xolocotzii; (2 accessions from Phaseolus glabellus; (3 accessions from Phaseolus vulgaris, Phaseolus polyanthus and Phaseolus coccineus. Within the third group, accessions of Phaseolus coccineus are scattered along the phylogenetic tree, which provides some evidence that coccineus accessions are paraphyletic with respect to Phaseolus vulgaris and Phaseolus polyanthus. An analysis of molecular variance applied on four species show that they are significantly differentiated with 79% of molecular variance among species and 21% within species. The results agree with previous investigations on chloroplast DNA variation in the genus Phaseolus, and suggest that PCRRFLP methods, which are technically less labour-intensive than previous methods, are of great value for phylogenetic investigations at the generic level.
Kowalczyk, S
1987-01-01
Three different molecular forms of pyrophosphate-dependent phosphofructokinase have been isolated: one from Sansevieria trifasciata leaves and two from Phaseolus coccineus stems. The form isolated from S. trifasciata has the molecular weight of about 115,000. The apparent molecular weights for the two forms from mung bean were approximately 220,000 and 450,000. All three forms have the same pH optima, an absolute requirement for Mg2+ ions both in the forward and reverse reaction, but differ in their sensitivity toward fructose 2,6-bisphosphate. Kinetic properties of the partially purified enzymes have been investigated in the presence and absence of fructose 2,6-bisphosphate. Pyrophosphate-dependent phosphofructokinase from S. trifasciata exhibited hyperbolic kinetics with all substrates tested. The saturation curves of the enzyme (form A) from mung bean for pyrophosphate, fructose 6-phosphate and fructose 1,6-bisphosphate were sigmoidal in the absence of fructose 2,6-bisphosphate. In the presence of fructose 2,6-bisphosphate these kinetics became hyperbolic.
Les hybridations interspecifiques dans le genre Phaseolus ...
African Journals Online (AJOL)
La réussite de l'introgression de caractères utiles chez le haricot commun P. vulgaris à partir des deux espèces P. coccineus et P. polyanthus dépend en partie des génotypes utilisés. Ce travail vise à identifier des génotypes de Phaseolus compatibles lors des hybridations interspécifiques et à identifier les hybrides issus ...
Iron and ferritin accumulate in separate cellular locations in Phaseolus seeds
DEFF Research Database (Denmark)
Cvitanich, Cristina; Przybylowicz, Wojciech J; Urbanski, Dorian Fabian
2010-01-01
and will assist in the production of staples with increased bioavailable iron. Results Here we reveal the distribution of iron in seeds of three Phaseolus species including thirteen genotypes of P. vulgaris, P. coccineus, and P. lunatus. We showed that high concentrations of iron accumulate in cells surrounding...... the provascular tissue of P. vulgaris and P. coccineus seeds. Using the Perls' Prussian blue method, we were able to detect iron in the cytoplasm of epidermal cells, cells near the epidermis, and cells surrounding the provascular tissue. In contrast, the protein ferritin that has been suggested as the major iron...... to P. vulgaris and P. coccineus, we did not observe iron accumulation in the cells surrounding the provascular tissues of P. lunatus cotyledons. A novel iron-rich genotype, NUA35, with a high concentration of iron both in the seed coat and cotyledons was bred from a cross between an Andean...
Does methyl jasmonate modify the oxidative stress response in Phaseolus coccineus treated with Cu?
Hanaka, Agnieszka; Wójcik, Małgorzata; Dresler, Sławomir; Mroczek-Zdyrska, Magdalena; Maksymiec, Waldemar
2016-02-01
The contribution of methyl jasmonate (MJ) as a signal molecule able to take part in the defense mechanism against copper (Cu)-imposed oxidative stress was studied in the leaves and roots of runner bean (Phaseolus coccineus) plants. Roots of plants cultivated hydroponically were preincubated in MJ (10µM) for 1h or 24h and subsequently exposed to Cu (50µM) for 5h (short-term experiment) or 5 days (long-term experiment). Enzymatic (activity of superoxide dismutase, SOD; catalase, CAT; ascorbate peroxidase, APX; guaiacol peroxidase, POX) and non-enzymatic (accumulation of malondialdehyde, MDA; homoglutathione, hGSH; proline; anthocyanins; low molecular weight organic acids, LMWOAs) responses were determined in the leaves and roots. The antioxidative defense mechanism was significantly activated after Cu supplementation. In most cases, activities of ROS (reactive oxygen species) scavenging enzymes like SOD, CAT, APX, POX, as well as MDA, hGSH and proline concentrations increased following Cu exposure. MJ showed a time-dependent effect on antioxidative enzymes activity. In the short-term experiment, MJ elevated CAT, APX and POX activities in the roots, and POX activity in the leaves of non-Cu-treated plants. In the long-term experiment, MJ not only decreased POX and partially CAT activity in the roots, but also increased the MDA level and partially CAT activity in the leaves of the control plants. In Cu-treated plants, MJ reduced APX, but elevated POX activity in the leaves after 5-h exposure. After 5-day-Cu treatment, MJ inhibited POX activity in the leaves and mainly reduced SOD and CAT activities in the roots. Moreover, in the long-term experiment, MJ reduced tartrate and pyruvate in the leaves of Cu-stressed plants, but mostly elevated tartrate and malate in the roots comparing with Cu alone treatment. MJ alone and under Cu excess did not alter accumulation of MDA, hGSH and proline comparing with Cu alone, but partially elevated anthocyanin concentration. The
Directory of Open Access Journals (Sweden)
Barikissou, E.
2012-01-01
Full Text Available A review of embryos rescue in food legumes in general and in the genus Phaseolus in particular. Genetic improvement of Phaseolus vulgaris L. by interspecific hybridization with Phaseolus coccineus L. and Phaseolus polyanthus Greenm., used as female parents, often gives rise to embryo abortion at globular developmental stage. In vitro culture of embryos at cotyledonary and torpedo shaped stages, leads to hybrid plants, but with very low percentages of success. Several investigations of in vitro culture in selfed genotypes of Phaseolus and from embryos at globular or young heart shaped stages have allowed to regenerate some young plantlets. However, problems of rooting and stopping of growth restrict the number of developing plantlets. Analysis of the results achieved from interspecific embryo rescue in others food legumes of the genus Lupinus, Cajanus, Cicer, Lens and Trifolium, helped to identify some solutions to resolve incompatibility problems in Phaseolus.
Energy Technology Data Exchange (ETDEWEB)
Cavallini, A.; Cionini, P.G.; D' Amato, F. (Pisa Univ. (Italy). Inst. di Genetica)
1981-01-01
DNA microdensitometry and autoradiography after treatment with /sup 3/H-thymidine were used to study the phase of dispersion of chromocenters (Z phase) in parallel with chromocentric nuclei in Phaseolus coccineus. In all materials studied, two types of chromocentric nuclei were present. In radicle apices of dry seeds, two classes of nuclear DNA contents were measured, 2 C (G/sub 1/) and 4 C (G/sub 2/). The 2 C DNA class comprised all chromocentric type I nuclei, the 4 C class included Z phases and chromocentric type II nuclei. The 4 C (G/sub 2/) condition of Z phases implies that Z phases maintain their nuclear structure for some time after the end of DNA replication. Shoot apices also contain 2 C (G/sub 1/) and 4 C (G/sub 2/) nuclei but 4 C nuclei (Z phases and chromocentric type II nuclei) are rare. In seedling root apices, Z phases are from 1.02 to 4.08 times as frequent as prophases. This excludes that Z phase as a very early prophase. DNA microdensitometry shows that the chromocentric type I includes 2 C (G/sub 1/) nuclei in the first part of the S phase, Z phases include 4 C (G/sub 2/) nuclei and nuclei in the last stage of the S phase and chromocentric type II includes mainly 4 C (G/sub 2/) nuclei and nuclei in the second part of S. After 90 minutes of treatment with /sup 3/H-thymidine all Z phase nuclei are labeled. This result and the microdensitometric data demonstrate unequivocally that Z phase is located at the end of S. The present results and those of previous authors on Z phase are discussed in relation to Geitler's concept of Angiosperm endomitosis. It is concluded that the term 'Angiosperm endomitosis' must be abandoned and substituted by the term 'chromosome endoreduplication'.
Beans (Phaseolus ssp.) as a Model for Understanding Crop Evolution
Bitocchi, Elena; Rau, Domenico; Bellucci, Elisa; Rodriguez, Monica; Murgia, Maria L.; Gioia, Tania; Santo, Debora; Nanni, Laura; Attene, Giovanna; Papa, Roberto
2017-01-01
Here, we aim to provide a comprehensive and up-to-date overview of the most significant outcomes in the literature regarding the origin of Phaseolus genus, the geographical distribution of the wild species, the domestication process, and the wide spread out of the centers of origin. Phaseolus can be considered as a unique model for the study of crop evolution, and in particular, for an understanding of the convergent phenotypic evolution that occurred under domestication. The almost unique situation that characterizes the Phaseolus genus is that five of its ∼70 species have been domesticated (i.e., Phaseolus vulgaris, P. coccineus, P. dumosus, P. acutifolius, and P. lunatus), and in addition, for P. vulgaris and P. lunatus, the wild forms are distributed in both Mesoamerica and South America, where at least two independent and isolated episodes of domestication occurred. Thus, at least seven independent domestication events occurred, which provides the possibility to unravel the genetic basis of the domestication process not only among species of the same genus, but also between gene pools within the same species. Along with this, other interesting features makes Phaseolus crops very useful in the study of evolution, including: (i) their recent divergence, and the high level of collinearity and synteny among their genomes; (ii) their different breeding systems and life history traits, from annual and autogamous, to perennial and allogamous; and (iii) their adaptation to different environments, not only in their centers of origin, but also out of the Americas, following their introduction and wide spread through different countries. In particular for P. vulgaris this resulted in the breaking of the spatial isolation of the Mesoamerican and Andean gene pools, which allowed spontaneous hybridization, thus increasing of the possibility of novel genotypes and phenotypes. This knowledge that is associated to the genetic resources that have been conserved ex situ and in
Directory of Open Access Journals (Sweden)
Abidemi J. Akindele
2014-07-01
Full Text Available Hypertension remains a major health problem worldwide considering the prevalence of morbidity and mortality. Plants remain a reliable source of efficacious and better tolerated drugs and botanicals. This study was designed to investigate the effect of the chemo-profiled hydroethanolic leaf extract of Byrsocarpus coccineus in ethanol- and sucrose-induced hypertension. Groups of rats were treated orally (p.o. with distilled water (10 ml/kg, ethanol (35%; 3 g/kg, sucrose (5-7%, and B. coccineus (100, 200, and 400 mg/kg, and nifedipine together with ethanol and sucrose separately for 8 weeks. At the end of the treatment period, blood pressure and heart rate of rats were determined. Blood was collected for serum biochemical parameters and lipid profile assessment, and the liver, aorta, kidney, and heart were harvested for estimation of in vivo antioxidants and malondialdehyde (MDA. Results obtained in this study showed that B. coccineus at the various doses administered reduced the systolic, diastolic, and arterial blood pressure elevated by ethanol and sucrose. Also, the extract reversed the reduction in catalase (CAT, reduced glutathione (GSH, glutathione peroxidase (GPx, and superoxide dismutase (SOD induced by ethanol and sucrose. The level of MDA was reduced compared to the ethanol- and sucrose-induced hypertensive group. With respect to lipid profile, administration of B. coccineus at the various doses reduced the levels of triglycerides, low-density lipoprotein (LDL, cholesterol, and atherogenic indices, compared to the ethanol and sucrose groups. In conclusion the hydroethanolic leaf extract of B. coccineus exerted significant antihypertensive effect and this is probably related to the antioxidant property and improvement of lipid profile observed in this study.
Ejeh, Sunday A; Onyeyili, Patrick; Abalaka, Samson E
2017-07-01
The use of traditional medicine as an alternative source of cure for many ailments has played an important role in health care delivery in both developing and developed countries. Byrsocarpus coccineus Schum and Thonn ( Connaraceae ) is used in traditional medicine for treatment of various disease conditions, including diarrhea. The anti-diarrhea activity of the root bark aqueous extract of B. coccineus was investigated in this study. Acute toxicity evaluation of the aqueous extract of B. coccineus root bark was performed in exposed rats. Diarrhea was induced in exposed rats with castor oil, and the effect of the extract on castor oil-induced gastrointestinal motility and enteropooling was consequently investigated. In the acute toxicity study, the extract caused no death in treated rats nor produced signs of delayed toxicity, even at 5000 mg/kg. The aqueous root bark extract of B. coccineus also decreased the distance travelled by activated charcoal in the gastrointestinal tract of treated rats when compared to control rats. Results of castor oil-induced enteropooling revealed slight reduction in the weight of intestinal contents of treated rats compared to control rats. There was significant (pcastor oil-induced diarrhea at 100 mg/kg dose with 74.96% inhibition of defecation. The study demonstrated the anti-diarrheic property of the aqueous extract of B. coccineus root bark as currently exploited in our traditional herbal therapy.
Mise au point d'une technique de culture in vitro d'embryons immatures de Phaseolus
Directory of Open Access Journals (Sweden)
Véronique Schmit
1997-01-01
Full Text Available Development of an in vitro culture technique for immature Phaseolus embryos. In the interspecific crosses Phaseolus polyanthus (or P. coccineus (i? x P. vulgaris, the hybrid embryos abort very early. Therefore, it is essentiel to develop an in vitro culture technique that allows the rescue of beau embryos at globular or early heart-shaped stages. After several trials conceming the salts composition, the sugar rate and the amino acid concentration of différent in vitro culture media, a technique has been developed for heart-shaped Phaseolus embryos. This technique consists of two stages. In a first step, embryos are cultivated under darkness until their germination on a medium containing the salts of Gamborg et al. (1968, 400 mg . 1` (5mM - 1 -' NHNO,, 1 mg . 1-' thiamine HCI, 5 mg . l` nicotinic acid, 0.5 mg - l` pyridoxine, 1,000 mg . l` -glutamine, 1,000 mg . l` casein hydrolysate, 100 mg . l` myo-inositol, 0.028 mg . P N6-benzyladenine, 30 g . l` sucrase, and 8 g -1-' DIFCO agar. After germination, the embryos are cultivated under light on a second medium that does not contain any NHNO, complément and is poorer in amino acids (100 mg 1-' L-glutamine. Developed with six deys old heart-shaped embryos of the P. vulgaris Bico de Ouro (NI 637 variety, this technique has proved its efficiency with other P. vulgaris and P. polyanthus génotypes. It allows an average régénération rate of 30% from the total number of cultivated embryos.
Directory of Open Access Journals (Sweden)
Silué, S.
2011-01-01
Full Text Available Use of induced mutations in embryogenesis study in bean Phaseolus vulgaris L. and two model plants, Arabidopsis thaliana (L. Heynh. and Zea mays L.. Breeding of common bean, Phaseolus vulgaris L., through interspecific hybridizations with the species Phaseolus coccineus L. and Phaseolus polyanthus Greenm. as female parents leads to the abortion of immature embryos. Identification of genes required for embryo development could partly explain the abortion of hybrid embryos; induced mutations could thus be an alternative to identify key genes involved in Phaseolus embryogenesis. This paper is a review which shows a few examples of the use of induced mutations in the identification of essential genes for embryogenesis in two model plants, Arabidopsis thaliana (L. Heyhn. for dicots and Zea mays L. for monocots. In these two species, embryo development mutants have been isolated using insertional mutagenesis and chemical mutagenesis with Ethyl Methane Sulfonate (EMS. Arabidopsis embryo mutants are affected in apical-basal axis polarity, radial pattern and in post-embryonic stages. Some Arabidopsis embryo mutants are defected in auxin signalisation. In maize, defective kernel (dek mutants are affected in the embryo and the endosperm, while in embryo specific (emb mutants, only the embryo is affected. In common bean, plants deficient in seed development were isolated using EMS mutagenesis. Embryos inside the seeds fail to growth at different stages of development and show abnormalities mainly in the suspensor and the cotyledons.
Directory of Open Access Journals (Sweden)
Hugh DeForest Safford
1999-08-01
Full Text Available O presente trabalho apresenta dados básicos sobre a ecologia e a distribuição de N. coccineus Radlk., a única espécie do gênero, endêmica nos campos de altitude do Maciço do Caparaó, sudeste do Brasil, no Parque Nacional do Caparaó. A estrutura espacial da população e os elementos relevantes da paisagem foram tratados no contexto das suas influências na dinâmica de população desta espécie rara e ameaçada. Observou-se que N. coccineus encontra-se restrita a populações disjuntas acima de 2.450m, nos picos mais altos do maçico. Nesses picos cresce N. coccineus somente nas encostas íngremes das faces sul e oeste, e em sítios com solos profundos e húmicos. A presença de bambus do gênero Chusquea pode ser necessária para a ocorrência de N. coccineus, pois as raízes de Chusquea foram muitas vezes encontradas parasitadas. Baseando-se em comparações estatísticas entre características de solo, altura de plantas, e crescimento desde 1994, pode-se concluir que as encostas de face sul parecem fornecer o habitat ótimo para N. coccineus. As distâncias entre as populações e o alcance um tanto limitado da dispersão de sementes podem favorecer o isolamento genético de algumas das populações mais remotas, contudo o pastejo do gado e a alta freqüência de incêndios antropogênicos nos campos de altitude do Caparaó constituem-se claramente nas maiores ameaças à sobrevivência da espécie e do gênero a curto prazo.Basic data are presented regarding the ecology and distribution of Nothochilus coccineus Radlk., the only species of the genus, endemic to the "campos de altitude" of the Caparaó Massif, Southeastern Brazil, in the National Park of Caparaó. The spatial population structure and pertinent landscape elements are dealt with in the context of their probable influences on the population dynamics of this rare and threatened plant. N. coccineus was found to be restricted to disjunct populations occurring above 2,450m
1444-IJBCS-Article-Pamphile Nguema+
African Journals Online (AJOL)
hp
L'hybridation interspécifique est souvent utilisée pour faciliter l'échange génétique chez de nombreux végétaux. Ainsi, le croisement entre Phaseolus coccineus L. et. Phaseolus vulgaris L. est utile pour l'amélioration génétique du haricot commun. L'utilisation du cytoplasme de P. vulgaris lors de ces hybridations aboutit ...
African Journals Online (AJOL)
Items 101 - 150 of 1010 ... Vol 26, No 1 (2018), Characterisation of Phaseolus coccineus interspecific germplasm accessions for disease resistance, grain market class and ... Vol 20, No 2 (2012), Comparative activities of phenylalanine ammonia-lyase and tyrosine ammonia-lyase and phenolic compounds accumulated in ...
Buried Alive! An Investigation of Plant Dormancy
Allen, Ashley J.; Balschweid, Mark; Hammond, Paul; Henderson, Brian; Johnson, Peggy A.; Kite, Abigayle; Martin, Stephanie
2004-01-01
In this investigation, pairs of upper elementary students test germination percentage using seeds of Indian corn ("Zea mays"), scarlet runner beans ("Phaseolus coccineus"), and the prairie cup-plant ("Silphium perfoliatum") grown on rolled, damp paper towels. The pairs compare seeds that have been stratified, a simulation of overwintering and…
Summer Scobell; Stewart Schultz
2005-01-01
We tested hypotheses of how pollinators and water resource gradients influence the evolution of dioecy using Echinocereus coccineus, a cactus with both hermaphroditic and dioecious populations growing over wide climatic and biotic gradients in the Madrean Archipelago. A GIS database was compiled from herbarium specimens, rainfall data, and...
PHOSPHATE-SOLUBILISING RHIZOBACTERIA ASSOCIATED WITH PHASEOLUS COCCINEUS L. RHIZOSPHERE
Directory of Open Access Journals (Sweden)
Marius Stefan
2012-10-01
Full Text Available Native phosphate solubilizing bacteria were isolated from runner bean rhizosphere in order to study their effect on releases of soluble phosphorus from inorganic P sources. 34.37% of the rhizobacteria isolates solubilized CaHPO4 in the qualitative P-solubilization plate method after seven days of incubation. The best PSB isolates were selected for further study concerning P-solubilization in liquid culture. All these isolates showed higher potential for solubilization of inorganic P as indicated by the increase of P amount in the RPAM medium. Our results showed that PSB strains play a significant role in the acidification of the medium facilitating the P solubilization probably due to organic acid production.
Geerts, Sipke Johannes
1949-01-01
A cross is studied between the selffertilising bush bean (Phaseolus vulgaris L.) "Zeeuwse Bruine Boon" and crossfertilising runner bean (Phaseolus multiflorus Lam.) "stam" (a scarlet flowering stockrunner-bean) or some other (climbing) runners. With the bushbean as mother this cross easily results
International Nuclear Information System (INIS)
Anon.
Research carried out through the Phaseolus Project of the 'Centro de Energia Nuclear na Agricultura' (CENA) Piracicaba, Sao Paulo State, Brazil, is described. It comprises the following subject s: plant breeding; nitrogen fixation; tissue cultures; proteins; photosynthetic efficiency; soil-plant interactions; electron microscopy of the golden mosaic virus; pest control; production of 15 N-enriched ammonium sulfate, and determination of elements in the beans plant. (M.A.) [pt
Onderzoekingen over virusziekten van de boon (Phaseolus vulgaris L.)
Want, van der J.P.H.
1954-01-01
Three viruses were studied which produce diseases in French beans, Phaseolus virus I (PV1), Phaseolus virus 2 (PV2) and a virus isolated from white clover (WKV). Included are symptoms, host plants, properties in vitro, occurrence and spread in the field. Special attention was given to the
Directory of Open Access Journals (Sweden)
Dalia eDuran
2014-10-01
Full Text Available Plants require reliable mechanisms to detect injury. Danger signals or 'damage-associated molecular patterns' (DAMPs are released from stressed host cells and allow injury detection independently of enemy-derived molecules. We studied the response of common bean (Phaseolus vulgaris to the application of leaf homogenate as a source of DAMPs and measured the production of reactive oxygen species (ROS as an early response and the secretion of extrafloral nectar (EFN as a jasmonic acid (JA–dependent late response. We observed a strong taxonomic signal in the response to different leaf homogenates. ROS formation and EFN secretion were highly correlated and responded most strongly to leaf homogenates produced using the same cultivar or closely related accessions, less to a distantly related cultivar of common bean or each of the two congeneric species, P. lunatus and P. coccineus, and not at all to homogenates prepared from species in different genera, not even when using other Fabaceae. Interestingly, leaf homogenates also reduced the infection by the bacterial pathogen, Pseudomonas syringae, when they were applied directly before challenging, although the same homogenates exhibited no direct in vitro inhibitory effect in the bacterium. We conclude that ROS signaling is associated to the induction of EFN secretion and that the specific blend of DAMPs that are released from damaged cells allows the plant to distinguish the 'damaged self' from the damaged 'non-self'. The very early responses of plants to DAMPs can trigger resistance to both, herbivores and pathogens, which should be adaptive because injury facilitates infection, independently of its causal reason.
Two endornaviruses show differential infection patterns between gene pools of Phaseolus vulgaris.
Khankhum, Surasak; Valverde, Rodrigo A; Pastor-Corrales, Marcial A; Osorno, Juan M; Sabanadzovic, Sead
2015-04-01
We investigated the occurrence of two plant endornaviruses, Phaseolus vulgaris endornavirus 1 and Phaseolus vulgaris endornavirus 2, in breeding lines, cultivars, landraces, and wild genotypes of common bean (Phaseolus vulgaris) collected from the two centers of common bean domestication: Mesoamerica and the Andes. The two endornaviruses were detected in many genotypes of Mesoamerican origin but rarely in genotypes of Andean origin. The results suggest that these two endornaviruses were introduced into the Mesoamerican modern genotypes during common bean domestication and provide more evidence for the existence of two divergent gene pools of common bean.
Micro-PIXE investigation of bean seeds to assist micronutrient biofortification
International Nuclear Information System (INIS)
Cvitanich, Cristina; Przybylowicz, Wojciech J.; Mesjasz-Przybylowicz, Jolanta; Blair, Matthew W.; Astudillo, Carolina; Orlowska, Elzbieta; Jurkiewicz, Anna M.; Jensen, Erik O.; Stougaard, Jens
2011-01-01
This study compares the distribution and concentrations of micro- and macronutrients in different bean cultivars with the aim of optimizing the biofortification, a sustainable approach towards improving dietary quality. Micro-PIXE was used to reveal the distribution of Fe, Zn, Mn, Ca, P, S in seeds of common beans (Phaseolus vulgaris) and runner beans (Phaseolus coccineus). Average concentrations of elements in different tissues were obtained using ICP-AES. The highest concentrations of Zn in the studied beans were found in the embryonic axis, but an increased concentration of this element was also detected in the provascular bundles of the cotyledons. The first layer of cells surrounding provascular bundles accumulated high concentrations of Fe, while the next cell layer had an increased concentration of Mn. The analysis showed that the provascular bundles and the first cell layers surrounding them could have a significant role in the storage of important seed micronutrients - Zn, Fe, and Mn. This information has important implications for molecular biology studies aimed at seed biofortification.
Micro-PIXE investigation of bean seeds to assist micronutrient biofortification
Energy Technology Data Exchange (ETDEWEB)
Cvitanich, Cristina, E-mail: crc@mb.au.dk [Centre for Carbohydrate Recognition and Signalling, Department of Molecular Biology Aarhus University, Aarhus (Denmark); Przybylowicz, Wojciech J.; Mesjasz-Przybylowicz, Jolanta [Materials Research Department, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Blair, Matthew W.; Astudillo, Carolina [CIAT - Centro International de Agricultura Tropical, Cali (Colombia); Orlowska, Elzbieta; Jurkiewicz, Anna M.; Jensen, Erik O.; Stougaard, Jens [Centre for Carbohydrate Recognition and Signalling, Department of Molecular Biology Aarhus University, Aarhus (Denmark)
2011-10-15
This study compares the distribution and concentrations of micro- and macronutrients in different bean cultivars with the aim of optimizing the biofortification, a sustainable approach towards improving dietary quality. Micro-PIXE was used to reveal the distribution of Fe, Zn, Mn, Ca, P, S in seeds of common beans (Phaseolus vulgaris) and runner beans (Phaseolus coccineus). Average concentrations of elements in different tissues were obtained using ICP-AES. The highest concentrations of Zn in the studied beans were found in the embryonic axis, but an increased concentration of this element was also detected in the provascular bundles of the cotyledons. The first layer of cells surrounding provascular bundles accumulated high concentrations of Fe, while the next cell layer had an increased concentration of Mn. The analysis showed that the provascular bundles and the first cell layers surrounding them could have a significant role in the storage of important seed micronutrients - Zn, Fe, and Mn. This information has important implications for molecular biology studies aimed at seed biofortification.
DETERMINATION OF DEFENSE MECHANISM IN Phaseolus ...
African Journals Online (AJOL)
Administrator
Field studies were conducted to determine the role of defense mechanism in various parameters associated with plant protection subjected to UV-B radiation in Phaseolus trilobus Ait. commonly used as green manure and fodder. Spectrophotometric analysis showed that UV-B radiation decreases the chlorophyll content ...
Wild beans (Phaseolus L.) of North America
The wild relatives of the five domesticated species of bean (Phaseolus L.) are widely distributed across the tropics and subtropics of the New World, with taxa extending to the Canadian border, the Caribbean islands and Bermuda, the Galapagos Islands, and south to Argentina. Mesoamerica holds the la...
Directory of Open Access Journals (Sweden)
Sergio Echeverrigaray
1996-12-01
Full Text Available The chloroplast DNA of Phaseolus vulgaris L. vr. Rio Negro was isola ted from chloroplasts obtained by descontiuous sucrose gradient centrifugation. The restriction analysis with the enzymes HindIII, EcoRI and BamHI and their combination, allowed to identified more than 20 fragments of 18 to 0.65kb. The size of Phaseolus vulgaris L. cp DNA was estimated in 140kb with the presence of a repeat sequence of about 22kb.O DNA cloroplástico do cultivar Rio Negro (Phaseolus vulgaris L. foi isolado a partir de cloroplastos obtidos por gradiente descontínuo de sacarose. A análise de restrição com as enzimas HindIII, EcoRI e BamHI e a combinação destas, permitiu a identificação de mais de 20 fragmentos na faixa de 18 a 0.65kb. O tamanho do cp DNA de Phaseolus vulgaris L. foi estimado em 140kb com a existência de sequências repetidas de aproximadamente 22kb.
Genetic diversity study of common bean (Phaseolus vulgaris L ...
African Journals Online (AJOL)
SAM
2014-09-03
Sep 3, 2014 ... Key words: Genetic diversity, ISSR, Phaseolus vulgaris. INTRODUCTION ..... effective germplasm conservation and for setting germ- plasm collection ... conservation and research programs of the species. Furthermore, the ...
AKTIVITAS ENZIM FITASE PADA PERKEMBANGAN KACANG HIJAU (Phaseolus radiatus L
Directory of Open Access Journals (Sweden)
Woro Riyadina
2012-09-01
Full Text Available This is a study on the phytase enzyme activities on germination of Mung Beans (Phaseolus radiatus L. The activities and stability of phytase enzyme were observed under influence of various incubation temperature (27°C, 37°C and 55"C, and incubation time (1 hour, 2 hours and 3 hours of the Mung Beans (Phaseolus radiatus L in germinating for 1 to 5 days. The results showed that activities of phytase enzyme at the same temperature and incubation time are the same in Mung Beans seed germinating for 1 to 5 days. Phytase enzyme is one of the termostabile enzymes with optimal activities at high temperature.
allelopathic effects of eucalyptus tereticornis on phaseolus vulgaris
African Journals Online (AJOL)
user
1. ALLELOPATHIC EFFECTS OF EUCALYPTUS TERETICORNIS ON PHASEOLUS. VULGARIS SEEDLINGS. Sale, F.A.. Department of Forestry and Wildlife, Faculty of ..... Sale, F.A. (2009). Allelopathic influence of Acacia auriculiformis. Eucalyptus citriodora and Gliricidia sepium on germination, growth and yield of millet.
Composite Phaseolus vulgaris plants with transgenic roots as ...
African Journals Online (AJOL)
SERVER
2008-02-19
Feb 19, 2008 ... ... important processes in the root system will be discussed. Key words: Genetic transformation, Phaseolus vulgaris, Agrobacterium rhizogenes. INTRODUCTION. Grain legumes are important agricultural crops, especially for developing countries, where they provide proteins in vegetarian or meat-poor diets.
Some engineering properties of white kidney beans (Phaseolus ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... ... (physical and mechanical) properties, white kidney beans, moisture content, thousand grain mass, static coefficient of friction. INTRODUCTION. White kidney beans (Phaseolus vulgaris L.) are a culti- vated plant grown for fresh and dry consumption and a common raw material in the canned food industry.
Composite Phaseolus vulgaris plants with transgenic roots as ...
African Journals Online (AJOL)
Large seeded grain legumes such as the common bean (Phaseolus vulgaris) and cowpea (Vigna unguiculata) are very important crops with seeds that are major protein source for people in developing countries, but their yields and improvement lag behind the economically more important cereals. For research purposes ...
Fursule, R A; Patil, S D
2010-06-16
Phaseolus trilobus Ait (Fabaceae) is extensively used by tribal people of Nandurbar district (Maharashtra, India) in the treatment of Jaundice and other liver disorders. of the present study was to assess the medicinal claim of Phaseolus trilobus as hepatoprotective and antioxidant. The hepatoprotective activity of methanol and aqueous extract of Phaseolus trilobus was evaluated by bile duct ligation induced liver fibrosis and antioxidant activity was evaluated using in vitro and in vivo antioxidant models viz anti-lipid peroxidation assay, super oxide radical scavenging assay and glutathione estimation in liver. Liver function tests were carried out to detect hepatoprotective activity, which was further supported by histopathological examination. Methanol and aqueous extracts of Phaseolus trilobus reduced elevated level of alanine aminotransferase (ALT), aspartate aminotransferase (AST), alkaline phosphatase (ALP), lactate dehydrogenase (LDH), bilirubin and hydroxyproline significantly (pWistar rats, proving hepatoprotective activity comparable with Silymarin. Both the extracts were found to reduce the elevated levels of serum thiobarbituric acid reactive substance (TBARS) and elevate superoxide scavenging radical activity proving antioxidant activity comparable with ascorbic acid. The reduced level of glutathione was found to be elevated in liver proving antioxidant activity comparable with Silymarin. Phaseolus trilobus posses hepatoprotective property and is effective in oxidative stress induced cholestatic hepatic injury. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.
International Nuclear Information System (INIS)
Tagliasacchi, A.M.; Forino, L.M.C.; Cionini, P.G.; Cavallini, A.; Durante, M.; Cremonini, R.; Avanzi, S.
1984-01-01
Different regions of polytene chromosomes pair VI have been characterized by: 1. morphological observations, 2. incorporation of 3 H-thymidine and 3 H-uridine, 3. cytophotometry of DNA and associated proteins, 4. hybridization with satellite DNA and highly repeated DNA sequences. The collected data indicate that DNA and RNA puffs are organized by heterochromatic segments. DNA puffs show often a clustered pattern of labeling by 3 H-thymidine and RNA puffs are always labeled by 3 H-urindine. Each heterochromatic segment is characterized by a definite ratio between DNA and associated fastgreen stainable proteins. Satellite DNA binds mostly to heterochromatic blocks at centromers, highly repeated DNA sequences bind, with approximately the same frequency, to centromeric heterochromatin and to the main intercalary heterochromatic band. The telomeric portions of euchromatin seem to be also enriched in highly repeated DNA sequences. The results indicate that heterochromatic chromosome segments might be sites of intense localized DNA replication. The same chromosome regions are also engaged in an active transcription process. The response to hybridization suggests that heterochromatic blocks of chromosome pair VI are heterogeneous in nucleotide sequences. The present studies also indicate that DNA and RNA puffs organized by different chromosome sites are specific of particular steps of embryo differentiation. The observed metabolic aspects of the suspensior's polytene chromosomes are discussed in relation to the synthesis of growth regulators which is known to occur in the suspensor. (Author)
Growth Performance of Five Bean (Phaseolus spp) Varieties as ...
African Journals Online (AJOL)
PROF HORSFALL
had significant (P≤ 0.05) effect on bean plant girth, number of leaves, number of branches, mean number of flowers, total fresh ... Beans (Phaseolus spp) belong to one of several genera .... Meng (2016), that found that applying coffee pulp.
Nodulation and nitrogen fixation in common bean (Phaseolus vulgaris)
African Journals Online (AJOL)
Mamadou Gueye
Nodulation and nitrogen fixation of field grown common bean (Phaseolus vulgaris) as influenced by fungicide seed treatment. Ndeye Fatou Diaw GUENE, Adama DIOUF and Mamadou GUEYE*. MIRCEN/ Laboratoire commun de microbiologie IRD-ISRA-UCAD, BP 1386, DAKAR, Senegal. Accepted 23 June 2003.
Khankhum, S; Valverde, R A
2018-04-01
This study evaluated the physiological traits of eight lines of common bean (Phaseolus vulgaris) cv. Black Turtle Soup, four of which were double-infected with Phaseolus vulgaris endornavirus 1 and Phaseolus vulgaris endornavirus 2, and four of which were endornavirus-free. Plants from all eight lines were morphologically similar and did not show statistically significant differences in plant height, wet weight, number of days to flowering and pod formation, pods per plant, pod thickness, seed size, number of seeds per pod, and anthocyanin content. However, the endornavirus-infected lines had faster seed germination, longer radicle, lower chlorophyll content, higher carotene content, longer pods, and higher weight of 100 seeds, all of which were statistically significant. The endornaviruses were not associated with visible pathogenic effects.
Directory of Open Access Journals (Sweden)
Marcia Ometto de Mello
2001-09-01
Full Text Available The objective of this work was to study the activity of sucrose metabolizing enzymes in extracts of cell suspension cultures of Bauhinia forficata Link, Curcuma zedoaria Roscoe and Phaseolus vulgaris L. Invertase pathway was identified in the three studied species. Sucrose synthase pathway was also responsible for sucrose metabolism in Curcuma zedoaria and Phaseolus vulgaris cells. Activity values higher than 300 nmol min-1 mg-1 of protein were found for acid and neutral invertases, UDPglucose pyrophosphorylase and phosphoglucomutase in the cell extract of the three plant species. Sucrose synthase showed low activity in Bauhinia forficata cells. As sucrose concentration in the culture medium decreased, sucrose synthase activity increased in C. zedoaria and P. vulgaris cells. The glycolytic enzymes activity gradually reduced at the end of the culture period, when carbohydrate was limited.O objetivo deste trabalho foi estudar as enzimas do metabolismo da sacarose em culturas de célula em suspensão de Bauhinia forficata Link, Curcuma zedoaria Roscoe e Phaseolus vulgaris L. A via da invertase foi identificada nas três espécies estudadas. A via da sacarose sintase também foi responsável pelo metabolismo da sacarose em células de Curcuma zedoaria e Phaseolus vulgaris. Foram encontradas atividades maiores que 300 nmol min-1 mg-1 de proteína das enzimas invertase ácida e alcalina, UDPglicose pirofosforilase e fosfoglicomutase no extrato celular das três espécies de plantas. A sacarose sintase mostrou atividade baixa nas células de Bauhinia forficata. À medida que a concentração de sacarose no meio de cultura diminuiu, a atividade da sacarose sintase aumentou em células de Curcuma zedoaria e Phaseolus vulgaris. Ao final do período de cultura, quando os carboidratos se tornaram limitantes, as atividades das enzimas glicolíticas reduziram-se gradualmente.
Effects of Kidney Bean, Phaseolus vulgaris Meal on the Growth ...
African Journals Online (AJOL)
, Oreochromis niloticus (mean weight 1.36 + 0.05 g) fed diets containing varying levels of the kidney bean, Phaseolus vulgaris were investigated under laboratory conditions. The kidney bean was incorporated at separate levels of 60, 40, ...
Phosphorus use efficiency in common bean ( Phaseolus vulgaris L ...
African Journals Online (AJOL)
The tripartite symbiosis of common bean (Phaseolus vulgaris L.) recombinant inbred line (RIL) 147 with rhizobia and arbuscular mycorrhizal fungi (AMF) was assessed in sand culture by comparing the effects of three AMF species on the mycorrhizal root colonization, rhizobial nodulation, plant growth and phosphorus use ...
Zambrano, Rosaura; Granito, Marisela; Valero, Yolmar
2013-06-01
The objective of this work was to formulate a cereals and legume (Phaseolus vulgaris) bar and assess its impact on the glycemic response of healthy individuals, in order to contribute to the healthy food supply beneficial to consumers. A mixture of cereals (corn and oats) and different percentages (20 and 30%) of Phaseolus vulgaris was used to formulate the bar. Additionally, a legume cereal bar without legumes (bar control) was prepared. The bar with 30% of Phaseolus vulgaris was selected through sensory evaluation, being scored with better flavor and texture. This combination of cereals and legumes aminoacid improves complementation and reaches the formulation criteria previously established. Chemical characterization indicated a higher protein content in the bar with 30% of Phaseolus vulgaris (13.55%) relative to the bar control (8.5%). The contents of fat, ash and dietary fiber did not differ between the two bars evaluated. However, the soluble fiber and resistant starch of the selected bar was a 32.05% and 18.67%, respectively, than in the control bar; this may contribute to decreasing the rate of glucose uptake. The selected bar presented a low glycemic index (49) and intermediate glycemic load (12.0) in healthy volunteers, which could lead to a possible reduction in the rate of absorption of glucose into the bloodstream, associated with a carbohydrate content of slow absorption. This bar represents a proposal of a healthy snack for the consumer.
Response of common bean ( Phaseolus vulgaris L.) cultivars to ...
African Journals Online (AJOL)
Yield losses in common bean (Phaseolus vulgaris L.) may occur due to boron (B) deficiency when the susceptible cultivars are grown in calcareous boron deficient soils. The study was therefore aimed at investigating the effects of three B doses: control (0.0 kg ha-1), soil application (3.0 kg ha-1) and foliar fertilization (0.3 kg ...
[Microstructural changes in hardened beans (Phaseolus vulgaris)].
Mujica, Maria Virginia; Granito, Marisela; Soto, Naudy
2015-06-01
(Phaseolus vulgaris). The hardening of Phaseolus vulgaris beans stored at high temperature and high relative humidity is one of the main constraints for consumption. The objective of this research was to evaluate by scanning electron microscopy, structural changes in cotyledons and testa of the hardened beans. The freshly harvested grains were stored for twelve months under two conditions: 5 ° C-34% RH and 37 ° C-75% RH, in order to promote hardening. The stored raw and cooked grains were lyophilized and fractured. The sections of testa and cotyledons were observed in an electron microscope JSM-6390. After twelve months, grains stored at 37 ° C-75% RH increased their hardness by 503%, whereas there were no significant changes in grains stored at 5 ° C-34% RH. At the microstructural level, the cotyledons of the raw grains show clear differences in appearance of the cell wall, into the intercellular space size and texture matrix protein. There were also differences in compaction of palisade and sub-epidermal layer in the testa of raw grains. After cooking, cotyledon cells of the soft grains were well separated while these ofhard grains were seldom separated. In conclusion, the found differences in hard and soft grains showed a significant participation of both structures, cotyledons and testa, in the grains hardening.
Nutritional analyses for proteins and amino acids in beans (Phaseolus sp.
Directory of Open Access Journals (Sweden)
Wathelet B.
1999-01-01
Full Text Available The chemical index is a good estimator of seed protein quality of Phaseolus beans. In order to estimate this value, a protein hydrolysis and amino acid quantification are realised. The problems inherent to these techniques are presented.
Culinary and nutritional quality of Phaseolus vulgaris seeds as affected by environmental factors
Directory of Open Access Journals (Sweden)
Kigel J.
1999-01-01
Full Text Available Efficient selection for specific culinary and nutritional quality traits needs a better understanding of the genetic and environmental control of quality traits at the structural, physiological and biochemical levels. Field experiments indicate great variability in the Phaseolus gene pool regarding the content of antinutritional compounds, as well as in cooking characteristics of the seeds. These seed attributes are strongly affected by geographic location, edaphic and climatic conditions at site of cultivation. However, information on the influence of specific environmental factors (such as temperature, water availability, edaphic conditions, etc. on seed quality traits, as well as on their stability is very scarce. This lack of knowledge impairs a faster progress in the improvement of Phaseolus seed quality.
Acanthoscelides obtectus (Say) (Coleoptera: Chrysomelidae), is an economically important pest of common bean Phaseolus vulgaris L. (Fabaceae) in the tropics and subtropics. It is difficult to detect the presence of A. obtectus because the larvae are cryptic and spend most of their developmental time...
Crop physiological analysis of seed quality variation in common bean (Phaseolus vulgaris L.)
Muasya, R.M.
2001-01-01
Keywords
Directory of Open Access Journals (Sweden)
Aiko Iwata-Otsubo
2016-04-01
Full Text Available Fluorescence in situ hybridization (FISH-based karyotyping is a powerful cytogenetics tool to study chromosome organization, behavior, and chromosome evolution. Here, we developed a FISH-based karyotyping system using a probe mixture comprised of centromeric and subtelomeric satellite repeats, 5S rDNA, and chromosome-specific BAC clones in common bean, which enables one to unambiguously distinguish all 11 chromosome pairs. Furthermore, we applied the karyotyping system to several wild relatives and landraces of common bean from two distinct gene pools, as well as other related Phaseolus species, to investigate repeat evolution in the genus Phaseolus. Comparison of karyotype maps within common bean indicates that chromosomal distribution of the centromeric and subtelomeric satellite repeats is stable, whereas the copy number of the repeats was variable, indicating rapid amplification/reduction of the repeats in specific genomic regions. In Phaseolus species that diverged approximately 2–4 million yr ago, copy numbers of centromeric repeats were largely reduced or diverged, and chromosomal distributions have changed, suggesting rapid evolution of centromeric repeats. We also detected variation in the distribution pattern of subtelomeric repeats in Phaseolus species. The FISH-based karyotyping system revealed that satellite repeats are actively and rapidly evolving, forming genomic features unique to individual common bean accessions and Phaseolus species.
International Nuclear Information System (INIS)
Moraes Rego, A.F. de; Rodrigues, Z.A.; Oliveira, M.L. de; Santana, M.D.
1986-01-01
Influence of gamma radiation on Zabrotes subfasciatus (Boh, 1833) (Coleoptera Bruchidae) and the beans Phaseolus vulgaris (L.). The effects of 60 CO gamma radiation, 50 Gy, on both Phaseolus vulgaris (L.) seedbeans and adults of Zabrotes subfasciatus were studied using the no free choise method. Radiation decreased insect fertility hence insect population and it damage loss of weight and germination of seedbeans. However, radiation resulted in abnamal seedlings, showing various degrees of morphological malformation, although there was no effect on germination rates or seedling vigor. (Author) [pt
Muniafu, M.M.; Macharia, J.N.M.; Stigter, C.J.; Coulson, G.L.
1999-01-01
Leaf area development, dry weight accumulation and solar energy conversion efficiencies of Phaseolus vulgaris L. cv GLP-2 under two soil moisture levels in two contrasting seasons near Nairobi, Kenya were investigated. The experiment confirms that dry weights and yields of Phaseolus vulgaris are
Huisman, J.; Poel, A.F.B. van der; Mouwen, J.M.V.M.; Weerden, E.J. van
1990-01-01
A comparison was made of the effects of antinutritional factors present in Phaseolus vulgaris on piglets, rats and chickens. Also the hypothesis of whether the negative effect on weight gain due to the inclusion of raw Phaseolus vulgaris in the diet can be attributed to an insufficient supply of
Formation of adventitious roots on green leaf cuttings of Phaseolus vulgaris L.
Oppenoorth, Johanna Margriet
1980-01-01
n this thesis the development of adventitious roots on green leaf cuttings of Phaseolus vulgaris L. is studies. The use of green leaf cuttings has the advantage that the leaf blade provides the developing roots inthe petiole with all the nutrients required, a disadvantage is that the composition of
Directory of Open Access Journals (Sweden)
Maiene de F. C. de Queiroga
2012-07-01
Full Text Available Propôs-se, com este trabalho, estudar a qualidade de sementes de feijão carioca (Phaseolus vulgaris L. tratadas com óleos vegetais de mamona, soja e oiticica, durante cinco meses de armazenamento. Mediante os resultados obtidos concluiu-se que os óleos vegetais utilizados no tratamento das sementes de feijão Phaseolus foram eficientes na manutenção da viabilidade e no controle da infestação pelo inseto-praga de armazenamento Zabrotes subfasciatus, nos cinco meses de armazenamento, sendo o óleo de oiticica o que apresentou melhor média de germinação, frente às tratadas com óleo de mamona e soja. O óleo de oiticica também foi o mais eficiente no controle de Z. subfasciatus. Verificou-se, ainda, redução da eficiência dos óleos nas suas menores doses, sendo a dose de 4,5 mL para 500 g de sementes, a mais eficaz para todas as variáveis estudadas.The purpose of this work was to study the quality of bean seeds (Phaseolus vulgaris L. treated with vegetable oils of castor, soybean and 'oiticica' during five months of storage. From the obtained results it was concluded that vegetable oils used in the treatment of seeds of Phaseolus beans were effective in maintaining the viability and control of storage insect pest infestation Zabrotes subfasciatus during the five months of storage, and the 'oiticica' oil presented the best mean germination, compared to those treated with castor oil and soybeans. 'Oiticica' oil was also the most efficient in controlling Z. subfasciatus. Reduced efficiency of the oils was observed in the small doses and the dose of 4.5 mL for 500 g of seeds was the most effective for all variables.
Santidrián, Santiago; de Moya, Carmen Cavallé; Grant, George; Frühbeck, Gema; Urdaneta, Elena; García, María; Marzo, Florencio
2003-03-01
The composition of the raw legume Phaseolus vulgaris L. var. athropurpurea (PhVa) and its effects on the metabolism of young growing rats have been evaluated. The levels of protein, unsaturated fatty acids, carbohydrate, fibre and bioactive factors present in PhVa were comparable with those in other Phaseolus vulgaris varieties. However, the lectins of PhVa were predominantly of the leucoagglutinating type, and concentrated in the albumin protein fraction. Rats fed a diet (110 g total protein, 16.0 MJ/kg) in which PhVa meal provided about half of the protein excreted high levels of N in faeces and urine, and grew more slowly, than rats fed a high-quality control diet (ad libitum or pair-fed). Small intestine, large intestine and pancreas weights were increased (by almost 100 %, PPhVa, which were concentrated in the albumin protein fraction, whereas in many other Phaseolus vulgaris lines they are distributed across the globulin and albumin fractions.
Fierstra, Jorn; Machina, Matthew; Battisti-Charbonney, Anne; Duffin, James; Fisher, Joseph Arnold; Minkovich, Leonid
Noninvasive monitoring of the arterial partial pressures of CO2 (PaCO2) of critically ill patients by measuring their end-tidal partial pressures of CO2 (PetCO(2)) would be of great clinical value. However, the gradient between PetCO(2) and PaCO2 (Pet-aCO(2)) in such patients typically varies over a
Directory of Open Access Journals (Sweden)
Patricia Hernández Díaz
1999-12-01
Full Text Available Se obtuvieron preparaciones crudas de fitohemaglutinina (PHA a partir de frijol colorado (Phaseolus vulgaris por 2 métodos: extracción acuosa y extracción ácida. Por el método ácido se obtuvieron mejores resultados en cuanto a concentración de proteínas y pureza de la misma. Se empleó la cromatografía en hidroxiapatita para separar las isoformas que forman la PHA y se obtuvieron 5 fraccciones proteicas que se evaluaron funcionalmente junto con las preparaciones crudas, a través de sus propiedades eritroaglutinantes y leucoaglutinantes. A medida que se aumentó la fuerza iónica del medio se observó que las fracciones obtenidas presentaban una disminución relativa de la actividad leucoaglutinante, así como un incremento relativo de la actividad eritroaglutinante. Las preparaciones crudas y las fracciones se evaluaron electroforéticamente y se obtuvieron bandas muy similares a la de la PHA patrón utilizadaRaw preparations of phytohemagglutinin (PHA were obtained from red bean (Phaseolus vulgaris by 2 methods: aqueous extraction and acid extraction. Better results were obtained with the acid methods as regards the protein concentration and its purity. Hydroxyapatite chromatography was used to separate the isoforms forming the phytohemagglutinin. 5 protein fractions were obtained and functionally evaluated together with the raw preparations through their erythroagglutinating and leukoagglutinating properties. As the ionic force of the medium increased it was observed that the fractions obtained presented a relative decrease of the leukoagglutinating activity as well as a relative rise of the crythroagglutinating activity. The raw preparations and the fractions were electrophoretically evaluated and bands very similar to that of the PHA used as a pattern were obtained
International Nuclear Information System (INIS)
Haider, S.; Azmat, R.
2012-01-01
Lead (Pb)-treated Lens culinaris and Phaseolus mungo seedlings leaves showed considerable reduction in the size with enhance proline and phenol contents while peroxidase and lignin activity was Pb/sup 2+/ dose dependent. The reduced leaves sizes of both seedlings were correlated with an increase in Pb/sup 2+/levels, and activities of peroxidase and lignin deposition in it. The intensification of activities of peroxidase and phenol in the Pb/sup 2+/ treated plants were accompanied by an increase in the biosynthesis of the lignin contents as their function is of scavenging ROS radical. A strong correlation (r/sup 2/=0.8570) was observed between Pb/sup 2+/ and lignin deposition in the Lens culinaris whereas it was non-significant in Phaseolus mungo (r/sup 2/=0.466). Increased in the lignin contents in the Lens culinaris as a chemical adaptation of the cell walls of various leaves tissues for endurance while decrease in the lignin contents in Phaseolus mungo at high dose of Pb/sup 2+/ may be attributed with the decline in the peroxidase activity. Investigations revealed that although plants adopt several biochemical strategies for their survival but toxicity of Pb/sup 2+/was significant due to which plant fails to continue in stay alive. (author)
Growth and Physiological Responses of Phaseolus Species to Salinity Stress
Directory of Open Access Journals (Sweden)
J. S. Bayuelo-Jiménez
2012-01-01
Full Text Available This paper reports the changes on growth, photosynthesis, water relations, soluble carbohydrate, and ion accumulation, for two salt-tolerant and two salt-sensitive Phaseolus species grown under increasing salinity (0, 60 and 90 mM NaCl. After 20 days exposure to salt, biomass was reduced in all species to a similar extent (about 56%, with the effect of salinity on relative growth rate (RGR confined largely to the first week. RGR of salt-tolerant species was reduced by salinity due to leaf area ratio (LAR reduction rather than a decline in photosynthetic capacity, whereas unit leaf rate and LAR were the key factors in determining RGR on salt-sensitive species. Photosynthetic rate and stomatal conductance decreased gradually with salinity, showing significant reductions only in salt-sensitive species at the highest salt level. There was little difference between species in the effect of salinity on water relations, as indicated by their positive turgor. Osmotic adjustment occurred in all species and depended on higher K+, Na+, and Cl− accumulation. Despite some changes in soluble carbohydrate accumulation induced by salt stress, no consistent contributions in osmotic adjustment could be found in this study. Therefore, we suggest that tolerance to salt stress is largely unrelated to carbohydrate accumulation in Phaseolus species.
Directory of Open Access Journals (Sweden)
Silué, S.
2013-01-01
Full Text Available The aim of this study was to describe the embryos abortion process and the inheritance of the embryos abortion trait in Phaseolus vulgaris plants deficient in seed development. These plants were isolated within the second generation of an ethyl methanesulfonate (EMS TILLING population of P. vulgaris cv. 'BAT93'. Mutant embryos show abnormalities mainly in suspensors, shoot apical meristem (SAM and cotyledons from the globular to the cotyledon stages and abort before maturity compared to those observed in wild-type samples. Mutant embryos show also hyperhydricity and contain low amount of chlorophyll. Genetic analyses of F1, F2 and F3 populations from the crosses carried out between the mutagenized plants with aborting embryos and the wild-type plants indicated that the embryo abortion phenotype is maternally inherited and controlled by a single recessive gene. These Phaseolus mutant plants with aborting embryos constitute a valuable material for plant embryogenesis studies.
[Use of Phaseolus vulgaris and Vigna sinensis in a fermented dairy drink].
Granito, Marisela; Trujillo, Lesma; Guerra, Marisa
2004-06-01
The objective of this work was to develop a new kind fermented dairy drink, partially substituted with clear varieties of Phaseolus vulgaris (caraota) and Vigna sinensis (frijol). The formulation of fermented dairy drinks included sterile extracts of caraota and frijol, as partial substitutes which replaced milk: 10, 20 and 30%. The mixtures were inoculated with 2% of a mixture of Lactobacillus acidophillus, Streptococcus thermophilus and Bifidobacterium sp. and were incubated at 42 degrees C for 7 hours. Mango and guava jams were used as flavorings at 20%. On the basis of the sensorial evaluation the mixtures 10% frijol-mango, 10% frijol-guava, 30% caraota-mango and 20% caraota-guava were selected. In the selected fermented dairy drinks, the levels of protein, soluble and insoluble fiber, available and resistant starches were increased and the protein digestibility was 81%. The technical feasibility of partial substitution of milk with extracts of Phaseolus vulgaris or Vigna sinensis. For the elaboration of a fermented dairy drink similar to the liquid yogurt kind was demonstrated.
Effects of radiation quality on the opening of stomata in intact Phaseolus vulgaris leaves
International Nuclear Information System (INIS)
Sikorska, K.; Kozłowska, B.; Ciereszko, I.; Maleszewski, S.
1997-01-01
In intact French bean (Phaseolus vulgaris L.) leaves blue radiation enhanced opening of stomata both when it was used individually and when it was used as preirradiation before ''white light'' irradiation. Effects of red radiation were just the contrary
Parreira, J R; Bouraada, J; Fitzpatrick, M A; Silvestre, S; Bernardes da Silva, A; Marques da Silva, J; Almeida, A M; Fevereiro, P; Altelaar, A F M; Araújo, S S
2016-01-01
Common bean (Phaseolus vulgaris L.) is one of the most consumed staple foods worldwide. Little is known about the molecular mechanisms controlling seed development. This study aims to comprehensively describe proteome dynamics during seed development of common bean. A high-throughput gel-free
Chemical and biological studies on sweet biscuits produced from irradiated phaseolus beans flour
International Nuclear Information System (INIS)
Nassef, A.E.
2005-01-01
This study was carried out to evaluate the chemical composition of beans such as minerals, amino acids, total carbohydrates and fiber to produce high quality sweet biscuits for treating some special diseases. In this study, the Phaseolus beans flour was used as a new source of very important composition. Beans flour was irradiated at two doses (0.5 and 1.0 KGy) for preservation. Sweet biscuits were made with supplementation of 5, 10, 15% beans flour. All samples of sweet biscuits were examined for chemical composition and organoleptic characteristics. Biological assay was carried out in rats maintained on 15% either irradiated or non-irradiated beans flour sweet biscuits through determining the weight gain, serum cholesterol and triglycerides and investigating the internal organs. The results obtained showed that sweet biscuits containing 15% Phaseolus beans flour had highest content of protein, minerals and fiber and scored a good grade. Weight gain, cholesterol and triglycerides levels were reduced comparable to control and there was no effect of irradiated beans flour on the internal organs
Horst, G.J. ter; Karst, H.; Luiten, P.G.M.
1984-01-01
The autoradiographic pattern of anterograde labeling as a result from injections with tritiated amino acids is compared to the labeling of efferents with Phaseolus vulgaris leuco-agglutinin after lectin injections in the same nucleus visualized by immunohistochemical methods. This comparison is made
Strategies for improving the nutritional quality of Phaseolus beans through gene engineering
Directory of Open Access Journals (Sweden)
Kapila J.
1999-01-01
Full Text Available Although Phaseolus species are still difficult to transform, progress in this field now opens the way to engineering beans with a higher nutritional value. The opportunities for gene engineering in nutritional quality improvement, the strategies which canbe adopted and the constraints we are still facing are briefly outlined, using the enhancement of the seed methionine content and the reduction in antinutritional factors as examples.
Phenotypic variation in a core collection of common bean (Phaseolus vulgaris L.) in the Netherlands
Zeven, A.C.; Waninge, J.; Hintum, van Th.J.L.; Singh, S.P.
1999-01-01
Forty accessions, forming a core collection of mainly bush type of the common bean (Phaseolus vulgaris L.) germplasm in the Netherlands, were evaluated for 14 qualitative and quantitative traits at the Agricultural University, Wageningen (WAU), the Netherlands in 1992. These and an additional 117
Savelkoul, F.
1994-01-01
Legumes, e.g. beans and peas, can contain antinutritional factors. Some varieties of faba beans (Vicia faba), soya beans (Glycine max ) and white kidney beans (Phaseolus vulgaris) can contain in their raw state antinutritional
Field experiments were conducted to evaluate the effects of soil solarization or cover cropping on bell pepper (Capsicum annuum) and lima bean (Phaseolus lunatus, L.) rhizosphere microorganisms. In Experiment I, flat surface solarization (FSS), raised bed solarization (RBS), cowpea (Vigna unguiculat...
The modern cultivated common bean (Phaseolus vulgaris) has evolved from wild common beans distributed in Central America, Mexico and the Andean region of South America. It has been reported that wild common bean accessions have higher levels of protein content than the domesticated dry bean cultiva...
DEFF Research Database (Denmark)
Jensen, Henning Høgh; Kamalongo, Donwell; Ngwira, Amos
2014-01-01
Common bean (Phaseolus vulgaris L.) is a dominant grain legume in eastern and southern Africa, where it constitutes a major source of protein and microminerals in peoples’ diet. The current studies aimed at determining how initially promising genotypes of bean responded in terms of yield and grain...
Directory of Open Access Journals (Sweden)
Shingo Miyauchi
Full Text Available Innovative green technologies are of importance for converting plant wastes into renewable sources for materials, chemicals and energy. However, recycling agricultural and forestry wastes is a challenge. A solution may be found in the forest. Saprotrophic white-rot fungi are able to convert dead plants into consumable carbon sources. Specialized fungal enzymes can be utilized for breaking down hard plant biopolymers. Thus, understanding the enzymatic machineries of such fungi gives us hints for the efficient decomposition of plant materials. Using the saprotrophic white-rot fungus Pycnoporus coccineus as a fungal model, we examined the dynamics of transcriptomic and secretomic responses to different types of lignocellulosic substrates at two time points. Our integrative omics pipeline (SHIN+GO enabled us to compress layers of biological information into simple heatmaps, allowing for visual inspection of the data. We identified co-regulated genes with corresponding co-secreted enzymes, and the biological roles were extrapolated with the enriched Carbohydrate-Active Enzyme (CAZymes and functional annotations. We observed the fungal early responses for the degradation of lignocellulosic substrates including; 1 simultaneous expression of CAZy genes and secretion of the enzymes acting on diverse glycosidic bonds in cellulose, hemicelluloses and their side chains or lignin (i.e. hydrolases, esterases and oxido-reductases; 2 the key role of lytic polysaccharide monooxygenases (LPMO; 3 the early transcriptional regulation of lignin active peroxidases; 4 the induction of detoxification processes dealing with biomass-derived compounds; and 5 the frequent attachments of the carbohydrate binding module 1 (CBM1 to enzymes from the lignocellulose-responsive genes. Our omics combining methods and related biological findings may contribute to the knowledge of fungal systems biology and facilitate the optimization of fungal enzyme cocktails for various
The objective is to gain knowledge regarding variation in sugar and flavor content among a sample of dry bean and green pod-type accessions from the USDA Phaseolus Germplasm Core Collection, Pullman, WA. The results could be used to market product quality and offer unique opportunities to expand ma...
DEFF Research Database (Denmark)
Naderpour, Masoud; Johansen, Ida Elisabeth
2011-01-01
Reporter tagged virus clones can provide detailed information on virus–host interactions. In Phaseolus vulgaris (bean), four recessive and one dominant gene are known to control infection by strains of the potyvirus species Bean common mosaic virus (BCMV). To study the interactions between BCMV...
Luiten, P.G.M.; Gaykema, R.P.A.; Traber, J.; Spencer Jr., D.G.
1987-01-01
The present paper deals with a detailed analysis of cortical projections from the magnocellular basal nucleus (MBN) and horizontal limb of the diagonal band of Broca (HDB) in the rat. The MBN and HDB were injected iontophoretically with the anterograde tracer Phaseolus vulgaris leucoagglutinin
Drijfhout, E.; Oeveren, J.C. van; Jansen, R.C.
1991-01-01
A non-destructive method has been developed to select common bean (Phaseolus vulgaris L.) plants whose growth is less effected at a suboptimal temperature. Shoot weight was determined at a suboptimal (14°C) and optimal temperature (20°C), 38 days after sowing and accessions identified with a
Dynamics of a Novel Highly Repetitive CACTA Family in Common Bean (Phaseolus vulgaris
Directory of Open Access Journals (Sweden)
Dongying Gao
2016-07-01
Full Text Available Transposons are ubiquitous genomic components that play pivotal roles in plant gene and genome evolution. We analyzed two genome sequences of common bean (Phaseolus vulgaris and identified a new CACTA transposon family named pvCACTA1. The family is extremely abundant, as more than 12,000 pvCACTA1 elements were found. To our knowledge, this is the most abundant CACTA family reported thus far. The computational and fluorescence in situ hybridization (FISH analyses indicated that the pvCACTA1 elements were concentrated in terminal regions of chromosomes and frequently generated AT-rich 3 bp target site duplications (TSD, WWW, W is A or T. Comparative analysis of the common bean genomes from two domesticated genetic pools revealed that new insertions or excisions of pvCACTA1 elements occurred after the divergence of the two common beans, and some of the polymorphic elements likely resulted in variation in gene sequences. pvCACTA1 elements were detected in related species but not outside the Phaseolus genus. We calculated the molecular evolutionary rate of pvCACTA1 transposons using orthologous elements that indicated that most transposition events likely occurred before the divergence of the two gene pools. These results reveal unique features and evolution of this new transposon family in the common bean genome.
Plant growth and laboratory atmosphere. [Phaseolus multiflorus Willd
Energy Technology Data Exchange (ETDEWEB)
Richter, O
1903-01-01
The author observed that Phaseolus seedlings grown under glass bell jars which were closed off by water were two or three times as long as those seedlings which were grown under jars without the water closure. It was suspected that coal gas or other impurities were causing these results. Thus, experiments were performed to determine if indeed coal gas was affecting plant growth. Results indicated that coal gas has an inhibiting effect on the growth and length of the seedlings, but it also promotes the growth in thickness. Shortening and thickening was proportional to the concentration of the coal gas and the time of exposure. Mercury vapors were found to produce similar differences in height and thickness of seedlings as coal gas, but they are at the same time lethal to the plants.
THE ACTION OF UV RADIATION ON MITOTIC INDEX AND MITOTIC DIVISION PHASES AT PHASEOLUS VULGARIS L
Directory of Open Access Journals (Sweden)
Csilla Iuliana Bara
2005-08-01
Full Text Available In this work, damaging effects of UV radiations on bean Phaseolus vulgaris L. plantule root tips were investigated. Our study proves that by bean plants, the decrease of cell division frequency appears to be part of protection mechanism against especially the short waved UV radiation, with variations depending on cultivar.
Directory of Open Access Journals (Sweden)
Thierry Vanderborght
1998-01-01
Full Text Available The base collection of wild species of Phaseolus and Vigna: history, management and conservation.The National Botanic Garden of Belgium ensures the management of a base collection of botanical and wild forms in the tribe Phaseoleae and the sub-tribe Phaseolinae. The main objective is to conserve on a long terni basic the largest possible genetic diversity through seed semples stored at - 20°C. The collection provided the basic material for the investigations conducted at the University Faculty of Agricultural Sciences of Gembloux in fields as diverse as taxonomy, genome analysis, definition of genetic réservoirs, agronomie and chemical evaluations, interspecific hybridization and plant breeding. The results have allowed to becter understand the organization of genetic diversity in the studied plant material and to highlight the wealthy genetic potentiel of the collection. The latter should be preserved and valorized for the genetic improvement of food legumes, in particular within the two genera Phaseolus and Vigna.
Horst, G.J. ter; Luiten, P.G.M.
Intrahypothalamic connections of the lateral (LHA), ventromedial (VMH), dorsomedial (DMH) and paraventricular (PVN) hypothalamic nuclei were studied with anterograde transport of iontophoretically injected Phaseolus vulgaris leuco-agglutinin and the immunocytochemical detection of labeled
Evaluation of gamma radiation (60-Co) induced mutation in two Phaseolus vulgaris varieties
International Nuclear Information System (INIS)
Silva, R.M.
1984-01-01
Two varieties of Phaseolus vulgaris (Jutiapan and San Martin) were irradiated at 0, 8, 15, 20 and 30 kR doses in a 60-cobalt gamma source, to identify mutants and 20% lethality. M 2 plants showing morphogical mutations were selected. Differences in sensitivity to irradiation of the two varieties were noted, using data and physiological effects of M 1 . Selection and analysis for protein content were in M 3 as well as hereditary changes. (M.A.C.) [pt
Enzymatic changes in intact leaves of Phaseolus vulgaris following ozone fumigation
Energy Technology Data Exchange (ETDEWEB)
Dass, H C; Weaver, G M
1972-01-01
Enzymatic changes in the intact leaves of Phaseolus vulgaris cv. Seaway 65 were studied following ozone fumigation. It was found that peroxidase enzyme increased significantly with the ozone treatment in the first 48 h. Similarly, cellulase enzyme showed significant increase 48 h. following ozone treatment. Lactic dehydrogenase activity was not markedly affected by ozone treatment. Disc electrophoretic studies of peroxidase isoenzymes showed that ozone treatment induced a new band of peroxidase. The role of peroxidase, cellulase and lactic dehydrogenase enzymes is discussed in relation to ozone damage and the bronzing disorder in white beans. 22 references, 1 figure, 1 table.
DEFF Research Database (Denmark)
Normander, Bo; Christensen, Bjarke Bak; Molin, Søren
1998-01-01
Conjugal plasmid transfer was examined on the phylloplane of bean (Phaseolus vulgaris) and related to the spatial distribution pattern and metabolic activity of the bacteria. The donor (Pseudomonas putida KT2442) harbored a derivative of the TOL plasmid, which conferred kanamycin resistance and had...
Directory of Open Access Journals (Sweden)
Iulia Bara
2006-08-01
Full Text Available Our study is focused on the influence of the UV-B irradiation, at the level of hidric balance, methabolic activity, and in the content of minerals, polyphenols, pigments, nucleic acids, proteins, of five romanian cultivars: Diva, Star, Vera, Ami, Avans of Phaseolus vulgaris, sawn after germination in enreached UV-B environment in natural field condition.
Effects of Fertilization on Uptake of 85Sr, 60Co and 54Mn by Tomato and Phaseolus Plants
International Nuclear Information System (INIS)
Ramadan, A.B.; Ezz El-Din, M.R.
2001-01-01
The effects of N-, P-, and K- fertilizers on availability of 85 Sr, 60 Co and 54 Mn added to the soil were measured in an open field experiment. The uptake of 85 Sr, 60 Co and 54 Mn by tomato and phaseolus was lower in fertilized treatments than in unfertilized ones. The radionuclide availability under fertilized condition depends on soil and element properties. Solubilization of Ca-ions following nitrification of nitrogen in ammonium salts and the presence of stable Strontium, Cobalt and Manganese in the acidifying fertilizers are the main factors giving rise to the reduced radioisotopes uptake by plants. The relative order of uptake of the investigated radionuclides by plants appeared to be as follow 54 Mn> 60 Co> 85 Sr. The distribution pattern of the total absorbed radionuclides in the two plants shows that the shoots contained the highest percent of these radionuclides. Transfer factors for phaseolus plants were higher than those of tomato plants
Directory of Open Access Journals (Sweden)
Borba Tereza CO
2011-05-01
Full Text Available Abstract Background Over recent years, a growing effort has been made to develop microsatellite markers for the genomic analysis of the common bean (Phaseolus vulgaris to broaden the knowledge of the molecular genetic basis of this species. The availability of large sets of expressed sequence tags (ESTs in public databases has given rise to an expedient approach for the identification of SSRs (Simple Sequence Repeats, specifically EST-derived SSRs. In the present work, a battery of new microsatellite markers was obtained from a search of the Phaseolus vulgaris EST database. The diversity, degree of transferability and polymorphism of these markers were tested. Results From 9,583 valid ESTs, 4,764 had microsatellite motifs, from which 377 were used to design primers, and 302 (80.11% showed good amplification quality. To analyze transferability, a group of 167 SSRs were tested, and the results showed that they were 82% transferable across at least one species. The highest amplification rates were observed between the species from the Phaseolus (63.7%, Vigna (25.9%, Glycine (19.8%, Medicago (10.2%, Dipterix (6% and Arachis (1.8% genera. The average PIC (Polymorphism Information Content varied from 0.53 for genomic SSRs to 0.47 for EST-SSRs, and the average number of alleles per locus was 4 and 3, respectively. Among the 315 newly tested SSRs in the BJ (BAT93 X Jalo EEP558 population, 24% (76 were polymorphic. The integration of these segregant loci into a framework map composed of 123 previously obtained SSR markers yielded a total of 199 segregant loci, of which 182 (91.5% were mapped to 14 linkage groups, resulting in a map length of 1,157 cM. Conclusions A total of 302 newly developed EST-SSR markers, showing good amplification quality, are available for the genetic analysis of Phaseolus vulgaris. These markers showed satisfactory rates of transferability, especially between species that have great economic and genomic values. Their diversity
Udani, Jay; Tan, Ollie; Molina, Jhanna
2018-04-20
The aim of this meta-analysis was to examine the evidence for the effectiveness of a proprietary alpha-amylase inhibitor from white bean ( Phaseolus vulgaris L.) supplementation interventions in humans on modification of body weight and fat mass. A systematic literature search was performed using three databases: PubMed, the Cochrane collaboration, and Google Scholar. In addition, the manufacturer was contacted for internal unpublished data, and finally, the reference section of relevant original research and review papers were mined for additional studies. Eleven studies were selected for the meta-analysis of weight loss (a total of 573 subjects), and three studies for the meta-analysis of body fat reduction (a total of 110 subjects), as they fulfilled the inclusion criteria. Phaseolus vulgaris supplementation showed an average effect on weight loss difference of −1.08 kg (95% CI (confidence interval), −0.42 kg to −1.16 kg, p < 0.00001), and the average effect on body fat reduction was 3.26 kg (95% CI, −2.35 kg to −4.163 kg, p = 0.02). This meta-analysis found statistically significant effects of Phaseolus vulgaris supplementation on body weight and body fat.
Directory of Open Access Journals (Sweden)
Jay Udani
2018-04-01
Full Text Available The aim of this meta-analysis was to examine the evidence for the effectiveness of a proprietary alpha-amylase inhibitor from white bean (Phaseolus vulgaris L. supplementation interventions in humans on modification of body weight and fat mass. A systematic literature search was performed using three databases: PubMed, the Cochrane collaboration, and Google Scholar. In addition, the manufacturer was contacted for internal unpublished data, and finally, the reference section of relevant original research and review papers were mined for additional studies. Eleven studies were selected for the meta-analysis of weight loss (a total of 573 subjects, and three studies for the meta-analysis of body fat reduction (a total of 110 subjects, as they fulfilled the inclusion criteria. Phaseolus vulgaris supplementation showed an average effect on weight loss difference of −1.08 kg (95% CI (confidence interval, −0.42 kg to −1.16 kg, p < 0.00001, and the average effect on body fat reduction was 3.26 kg (95% CI, −2.35 kg to −4.163 kg, p = 0.02. This meta-analysis found statistically significant effects of Phaseolus vulgaris supplementation on body weight and body fat.
Directory of Open Access Journals (Sweden)
Silva Luciana B.
2004-01-01
Full Text Available We have confirmed here that the seeds of the common bean (Phaseolus vulgaris, L. do not support development of the bruchid Callosobruchus maculatus (F., a pest of cowpea [Vigna unguiculata (L. Walp] seeds. Analysis of the testa (seed coat of the bean suggested that neither thickness nor the levels of compounds such as tannic acid, tannins, or HCN are important for the resistance. On the other hand, we have found that phaseolin (vicilin-like 7S storage globulin, detected in the testa by Western blotting and N-terminal amino acid sequencing, is detrimental to the development of C. maculatus. As for the case of other previously studied legume seeds (Canavalia ensiformis and Phaseolus lunatus we suggest that the presence of vicilin-like proteins in the testa of P. vulgaris may have had a significant role in the evolutionary adaptation of bruchids to the seeds of leguminous plants.
Fraccionamiento de nitrógeno en frijol ( phaseolus vulgaris l. en el valle de san juan
Directory of Open Access Journals (Sweden)
Juan Cedano
2000-01-01
Full Text Available Fraccionamiento de nitrógeno en frijol (Phaseolus vulgaris L. en el valle de San Juan. Se realizó un estudio para determinar el efecto del fraccionamiento de la fertilización nitrogenada y el momento adecuado para la aplicación de nitrógeno en el cultivo de frijol (Phaseolus vulgaris L. en cinco localidades del Valle de San Juan, R. D. Los experimentos fueron establecidos del 5 al 14 de noviembre (1997 , se utilizó un diseño de bloques completamente al azar y nueve tratamientos en cada localidad, encontrándose que en los terrenos con altos niveles de nitrógeno no hubo respuesta a la aplicación de nitrógeno ni al fraccionamiento de este nutrimento; mientras que en los suelos con deficiencia en nitrógeno si hubo respuesta a la fertilización nitrogenada encontrándose diferencia estadística significativa a la aplicación y al momento de aplicación del fertilizante. Entre las localidades hubo diferencia estadística significativa (P>0.05, mientras que no se encontró interacción entre los tratamientos y las localidades
Radiation induced mutations in Phaseolus vulgaris L
International Nuclear Information System (INIS)
Al-Rubeai, M.A.F.
1982-01-01
A selection of various macro- and micro-mutations was undertaken in the M2 generation of Phaseolus vulgaris cultivars after seed exposure to acute gamma radiation doses of 2.5, 5, 7, 10 and 15 Kr. The chlorophyll mutation was positively correlated with dose. Nevertheless, the highest frequency was at 7 Kr. Several interesting morphological mutants were observed. There were dwarf, stiff stem, shiny small leaf, narrow leaf and green giant mutants. Two selected micromutants were superior in seed yield capacity to their parents. The high yields were related to the high number of pods per plant. In 'The Prince' (seed color: red with beige marbling) several mutants with seeds of black color marbled with beige were selected. These seeds gave M3 segregants exhibiting a range of seed colors including white. Many of these M3 plants were short, early flowering and highly sterile. The work demonstrated that the pigmentation character can readily be changed, and confirmed that the variability induced by radiation can be exploited to obtain desirable mutations. (Author) [pt
Bascur B., Gabriel; Tay U., Juan
2005-01-01
Recently performed studies on the type of seed protein present from several origins and their morphological traits have shown that the common bean (Phaseolus vulgaris L.) is native to America, being a species without a specific center of origin and with two areas of domestication: Central America and South America. In this last center, three strains were determined, one of them is called "the Chilean strain", which as noted is a sub-center of genetic diversity for this species. With the purpo...
Dry bean (Phaseolus vulgaris L.) seeds are a major protein, carbohydrate, and mineral source for human diets in multiple regions of the world. Seed mineral biofortification is an going objective to improve this important food source. The objective of this research was to assess the seed mineral co...
Directory of Open Access Journals (Sweden)
Samira Rahmani-Nezhad
Full Text Available Seed germination and plant cell cultures provide an alternative mean for producing secondary metabolites. The present study is an attempt to evaluate the effect of seed dark germination and some elicitors and precursors on the production of L-DOPA in Phaseolus vulgaris L. Callus cultured on Murashige and Skoog medium supplemented with various concentrations of different plant growth regulators. L-DOPA produced was quantified by UV-spectrophotometric method. In this study, a user-friendly, quick, and economical UV-spectrophotometric method was described to determine L-DOPA content in extracts from 33 biotypes of Phaseolus vulgaris L. The method is based on the nitrosation of L-DOPA to form a yellow solution and then formation of a red solution by adding base which is measurable at 470 nm. According to our statistical studies, this method showed high efficiency and selectivity for quantitative determination of L-DOPA in herbal extracts from dried plant seeds, dark-germinated seeds and callus cultures. L-DOPA content in dark-germinated seeds and suspension cultures increased significantly to approximately several-fold compared to the control. The implication from this study is that elicitor treatment and precursor feeding of Phaseolus vulgaris L. can significantly improve the parkinson’s relevant L-DOPA content.
Huisman, J.; Poel, A.F.B. van der; Leeuwen, P. van; Verstegen, M.W.A.
1990-01-01
The effects of lectins in the diet have been mainly studied in rats. An important question is whether results obtained in rats can be extrapolated to larger animals like the pig. Phaseolus vulgaris beans are rich in toxic lectins. Therefore a study was carried out to compare the effects of diets
Directory of Open Access Journals (Sweden)
Robby Zulkarnain
2009-03-01
Full Text Available Aim This study was aimed to measure the effects of combination Phaseolus vulgaris extract and acarbose compared to acarbose alone on postprandial glucose concentration in healthy volunteers after cooked rice intake.Methods Blood sample were obtained at several time points up to three hours after cooked rice intake. The parameter for postprandial glucose concentration is the area under the curve (AUC of glucose concentration vs.time for three hours after cooked rice intake.Results After taking this combination, postprandial glucose concentration was reduced by 21.6%, while the reduction by acarbose alone was 22.9%.Conclusions The reduction of postprandial glucose concentration after administration of this combination was not significantly different compared to that after administration of acarbose alone. (Med J Indones 2009; 18: 25-30Keywords: Phaseolus vulgaris extract, acarbose, postprandial glucose concentration
DEFF Research Database (Denmark)
Mattei, B; Cervone, F; Roepstorff, Peter
2001-01-01
Phaseolus vulgaris. PG hydrolyses the homogalacturonan of the plant cell wall and is considered an important pathogenicity factor of many fungi. PGIP is a specific inhibitor of fungal PGs and is thought to be involved in plant defence against phytopathogenic fungi. SPR was used either to study the effect...
Directory of Open Access Journals (Sweden)
Noora Nordenstedt
Full Text Available Common bean (Phaseolus vulgaris is an annual grain legume that was domesticated in Mesoamerica (Central America and the Andes. It is currently grown widely also on other continents including Africa. We surveyed seedborne viruses in new common bean varieties introduced to Nicaragua (Central America and in landraces and improved varieties grown in Tanzania (eastern Africa. Bean seeds, harvested from Nicaragua and Tanzania, were grown in insect-controlled greenhouse or screenhouse, respectively, to obtain leaf material for virus testing. Equal amounts of total RNA from different samples were pooled (30-36 samples per pool, and small RNAs were deep-sequenced (Illumina. Assembly of the reads (21-24 nt to contiguous sequences and searches for homologous viral sequences in databases revealed Phaseolus vulgaris endornavirus 1 (PvEV-1 and PvEV-2 in the bean varieties in Nicaragua and Tanzania. These viruses are not known to cause symptoms in common bean and are considered non-pathogenic. The small-RNA reads from each pool of samples were mapped to the previously characterized complete PvEV-1 and PvEV-2 sequences (genome lengths ca. 14 kb and 15 kb, respectively. Coverage of the viral genomes was 87.9-99.9%, depending on the pool. Coverage per nucleotide ranged from 5 to 471, confirming virus identification. PvEV-1 and PvEV-2 are known to occur in Phaseolus spp. in Central America, but there is little previous information about their occurrence in Nicaragua, and no information about occurrence in Africa. Aside from Cowpea mild mosaic virus detected in bean plants grown from been seeds harvested from one region in Tanzania, no other pathogenic seedborne viruses were detected. The low incidence of infections caused by pathogenic viruses transmitted via bean seeds may be attributable to new, virus-resistant CB varieties released by breeding programs in Nicaragua and Tanzania.
Directory of Open Access Journals (Sweden)
Ernesto Ormeño-Orrillo
2017-09-01
Full Text Available Bradyrhizobium sp. LMTR 3 is a representative strain of one of the geno(species of diazotrophic symbionts associated with Lima bean (Phaseolus lunatus in Peru. Its 7.83 Mb genome was sequenced using the Illumina technology and found to encode a complete set of genes required for nodulation and nitrogen fixation, and additional genes putatively involved in root colonization. Its draft genome sequence and annotation have been deposited at GenBank under the accession number MAXC00000000.
Gamma radiation effects on bean plants (Phaseolus vulgaris L.) in flowering
International Nuclear Information System (INIS)
Tulmann Neto, A.; Matsumoto, K.; Marchezoni, S.A.; Ando, A.; Menten, J.O.M.
1980-01-01
The possibility of utilizing the 60 Co source in the Center of Nuclear Energy for Agriculture (CENA), Sao Paulo University, for gamma-irradiation of plants in flower was shown by an experiment with beans (Phaseolus vulgaris L.). Pots with two bean plants in flower, variety Carioca, line 6E 1 , were put individually in the center of the source. Doses used were 1, 2, 3, 4 and 5 kR. The development of these plants after irradiation till harvest and seedling emergence of their progeny were observed. The effects of gamma-rays and the advantages of irradiation of plants in flower were discussed, and recommendable procedures for research workers who need to use the 60 Co source of the CENA are suggested. (Author) [pt
Use of Wild Relatives and Closely Related Species to Adapt Common Bean to Climate Change
Directory of Open Access Journals (Sweden)
James D. Kelly
2013-05-01
Full Text Available Common bean (Phaseolus vulgaris L. is an important legume crop worldwide. However, abiotic and biotic stress limits bean yields to <600 kg ha−1 in low-income countries. Current low yields result in food insecurity, while demands for increased yields to match the rate of population growth combined with the threat of climate change are significant. Novel and significant advances in genetic improvement using untapped genetic diversity available in crop wild relatives and closely related species must be further explored. A meeting was organized by the Global Crop Diversity Trust to consider strategies for common bean improvement. This review resulted from that meeting and considers our current understanding of the genetic resources available for common bean improvement and the progress that has been achieved thus far through introgression of genetic diversity from wild relatives of common bean, and from closely related species, including: P. acutifolius, P. coccineus, P. costaricensis and P. dumosus. Newly developed genomic tools and their potential applications are presented. A broad outline of research for use of these genetic resources for common bean improvement in a ten-year multi-disciplinary effort is presented.
Inulin, a prebiotic, may enhance intestinal Fe absorption. Our objective was to assess the effects of supplemental inulin and two probiotic bacteria (B. infantis and L.acidophillus) on Fe availability to Caco-2 cells from common white and red beans (Phaseolus vulgaris L.). Cooked beans were mixed o...
Polania Perdomo, José A.,
2016-01-01
Bibliografia El frijol común (Phaseolus vulgaris L.) es la leguminosa alimenticia más importante en los trópicos. Es cultivada por pequeños agricultores y por lo general expuesta a condiciones desfavorables con mínimo uso de insumos. La sequía y la baja fertilidad del suelo, especialmente deficiencias de nitrógeno (N) y fósforo (P), son principales limitaciones para el rendimiento del frijol en los sistemas de pequeños productores. El frijol puede derivar parte de su requerimiento de N de ...
Directory of Open Access Journals (Sweden)
Jácomo Divino Borges
2007-09-01
Full Text Available
The Orgasol, an organic compound of animal origin, was tested on seeds and on snap crop (Phaseolus vulgaris L. cv. Bush Blue Lake, with and without chemical fertilizer (NPK in two planting dates. The orgasol-s with three applied doses (0, 1 and 2 ml/l of water on a first date and 0, 3 and 6 ml/l, on a second date had no influence on seed germination and pods production on this crop.
O Orgasol, um composto orgânico de origem animal, foi testado em sementes e na cultura do feijão-de-vagem (Phaseolus vulgaris L. cv. Bush Blue Lake, em duas épocas de plantio, na presença e na ausência de adubação química. O Orgasol-S foi empregado nas doses de 0, 1 e 2 ml/litro de água na primeira época de plantio e 0, 3 e 6 ml/litro de água na segunda época. Este composto não influenciou a germinação nem a produção de vagens na cultura estudada.
Papel del frijol negro Phaseolus vulgaris en el estado nutricional de la población guatemalteca
Serrano, José; Goñi, Isabel
2004-01-01
RESUMEN. En Guatemala existe un fenómeno de superposición epidemiológica, en el que coexisten problemas de salud propios de países desarrollados con otros característicos de poblaciones en vías de desarrollo. Se observan deficiencias marcadas en algunos macronutrientes tales como hierro y vitamina A. en simultaneidad con enfermedades crónicas como diabetes tipo II o enfermedades cardiovasculares. Se conoce muy bien la importancia del frijol negro (Phaseolus vulgaris) en la dieta habitual de G...
Seedborne Pathogenic Fungi in Common Bean (Phaseolus vulgaris cv. INTA Rojo) in Nicaragua.
Marcenaro, Delfia; Valkonen, Jari P T
2016-01-01
Common bean (Phaseolus vulgaris L.) is an important legume with high nutritional value. In Nicaragua, certified healthy seeds of local bean varieties are not available, and seedborne fungi have gained little attention. Here, were surveyed seedborne pathogenic fungi in an important local bean cultivar, 'INTA Rojo'. Beans grown in the four main production areas in Nicaragua (Boaco, Carazo, Estelí, Matagalpa) for future use as seed stock were sampled from four seed storehouses and six seed lots. A total of 133 fungal strains were isolated from surface-sterilized beans and inoculated to healthy lima beans (Phaseolus lunatus) under controlled conditions. Eighty-seven isolates caused symptoms of varying severity in the seedlings, including discoloration, necrotic lesions, cankers, rot, and lethal necrosis. Pathogenic isolates were divided into eight phenotypically distinguishable groups based on morphology and growth characteristics on artificial growth medium, and further identified by analysis of the internal transcribed spacer sequences (ITS1 and ITS2) of the ribosomal RNA genes. The pathogenic isolates belonged to eight genera. Fusarium spp. (F. chlamydosporum, F. equiseti, F. incarnatum), Lasiodiplodia theobromae, Macrophomina phaseolina, and Penicillium citrinum were the most damaging and common fungi found in the seed lots. Furthermore, Corynespora cassiicola, Colletotrichum capsisi, Colletotrichum gloeosporioides, Aspergillus flavus, and Diaporthe sp. (Phomopsis) were seedborne in cultivar 'INTA Rojo' and found to be pathogenic to bean seedlings. This study reveals, for the first time, many seedborne pathogenic fungi in beans in Nicaragua; furthermore, prior to this study, little information was available concerning F. equiseti, F. incarnatum, L. theobromae, C. cassiicola, and Diaporthe spp. as seedborne pathogens of common bean. Our results lay the basis for developing diagnostic tools for seed health inspection and for further study of the epidemiology
Energy Technology Data Exchange (ETDEWEB)
Liao, Luciano Morais; Choze, Rafael; Cavalcante, Pedro Paulo Araujo; Santos, Suzana da Costa; Ferri, Pedro Henrique, E-mail: luciano@quimica.ufg.b [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Inst. de Quimica; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFScar), SP (Brazil). Dept. de Quimica
2010-07-01
The application of one-dimensional proton high-resolution magic angle spinning ({sup 1}H HR-MAS) NMR combined with a typical advantages of solid and liquid-state NMR techniques was used as input variables for the multivariate statistical analysis. In this paper, different cultivars of beans (Phaseolus vulgaris) developed and in development by EMBRAPA - Arroz e Feijao were analyzed by {sup 1}H HR-MAS, which have been demonstrated to be a valuable tool in its differentiation according chemical composition and avoid the manipulation of the samples as used in other techniques. (author)
Phylogenetic relationships and host range of Rhizobium spp. that nodulate Phaseolus vulgaris L.
Hernandez-Lucas, I; Segovia, L; Martinez-Romero, E; Pueppke, S G
1995-07-01
We determined the nucleotide sequences of 16S rRNA gene segments from five Rhizobium strains that have been isolated from tropical legume species. All share the capacity to nodulate Phaseolus vulgaris L., the common bean. Phylogenetic analysis confirmed that these strains are of two different chromosomal lineages. We defined the host ranges of two strains of Rhizobium etli and three strains of R. tropici, comparing them with those of the two most divergently related new strains. Twenty-two of the 43 tested legume species were nodulated by three or more of these strains. All seven strains have broad host ranges that include woody species such as Albizia lebbeck, Gliricidia maculata, and Leucaena leucocephala.
International Nuclear Information System (INIS)
Ferraz, E.S.B.; Nascimento Filho, V.F.
1975-04-01
The use of two radiation peaks from the same gamma-emitting source in the calculation of the corresponding liquid counting rate in multi-element gamma spectrometry is discussed. It is shown that, in the determination of chlorine in Phaseolus vulgaris L. using neutronic activation analysis will result in an increase in accuracy of measurement of approximately 40%
Common bean (Phaseolus vulgaris L.) is the most important food legume crop in Africa and Latin America where rainfall pattern is unpredictable. The objectives were to identify better yielding common bean lines with good canning quality under drought, and to identify traits that could be used as sele...
Tepary bean (Phaseolus acutifolius A. Gray), a truly Native American crop, is a short life-cycle annual desert legume indigenous to northwestern Mexico and the southwestern USA and is considered drought and heat tolerant. The Western Regional Plant Introduction Station currently maintains 211 acce...
Gaykema, R.P.A.; Kuil, J. van der; Hersh, L.B.; Luiten, P.G.M.
1991-01-01
The projections from the Ammon's horn to the cholinergic cell groups in the medial septal and diagonal band nuclei were investigated with anterograde tracing of Phaseolus vulgaris leucoagglutinin combined with immunocytochemical detection of choline acetyltransferase, in the rat. Tracer injections
Judge, Seth W.; Camp, Richard J.; Hart, Patrick J.; Kichman, Scott T.
2018-01-01
Endangered Hawai‘i ʻĀkepas (Loxops coccineus) are endemic to Hawai‘i island, where they occur in five spatially distinct populations. Data concerning the status and population trends of these unique Hawaiian honeycreepers are crucial for assessing the effectiveness of recovery and management actions. In 2016, we used point‐transect distance sampling to estimate the abundance of Hawai‘i ʻĀkepas in portions of Hawai‘i Volcanoes National Park (HAVO) and the Kaʻū Forest Reserve (KFR) on Mauna Loa volcano. We then compiled the survey data from four other populations to provide a global population estimate. In our HAVO and KFR study area, we mapped habitat classes to determine the population densities in each habitat. Densities were highest (1.03 birds/ha) in open‐canopy montane ʻōhiʻa (Metrosideros polymorpha) woodland. In contrast, densities of the largest ʻĀkepa population on Mauna Kea volcano were highest in closed‐canopy ʻōhiʻa and koa (Acacia koa) forest where the species is dependent on nest cavities in tall (> 15 m), large (> 50‐cm diameter at breast height) trees. We surveyed potential nesting habitat in HAVO and KFR and found only one cavity in the short‐stature montane ʻōhiʻa woodland and five cavities in the tall‐stature forest. Differences in densities between the Mauna Kea and Mauna Loa populations suggest that Hawai‘i ʻĀkepas may exhibit different foraging and nesting behaviors in the two habitats. The estimated overall population density in the HAVO and KFR study area was 0.52 birds/ha, which equates to 3663 (95% CI 1725–6961) birds in their 11,377‐ha population range. We calculated a global population of 16,428 (95% CI 10,065–25,198) birds, which is similar to an estimate of 13,892 (95% CI 10,315–17,469) birds made in 1986. Our results suggest that populations are stable to increasing in the two largest populations, but the three other populations are smaller (range = 77–1443 birds) and trends
International Nuclear Information System (INIS)
Nyarko, B.J.B.; Fletcher, J.J.; Zwicker, B.; Chatt, A.
2006-01-01
An instrumental neutron activation analysis (INAA) method was developed for the simultaneous determination of 19 elements in 10 individual food items from Ghana. The samples were irradiated for 1 minutes in a neutron flux of 2.5 x 10 11 n x cm -2 x s -1 at the Dalhousie University Slowpoke-2 reactor (DUSR) facility. After a 2-minute decay the samples were counted using a Compton suppression gamma-ray spectrometry system for 10 minutes to quantify Ba, Br, Ca, Cl, Co, Cu, Dy, K, Mg, Mn, Na, Rb, S, Sr, Th, Ti, U, V and Zn. The analytical procedure namely, irradiation, decay and counting times were optimized for quick turn-around time for simultaneous determination of the nineteen elements. White-seeded beans (Phaseolus coccineus), one of the most commonly consumed foodstuff in Ghana, were found to contain the highest level of the 19 elements determined, viz. K (1.4%) and Sorghum spp. the lowest level viz. Dy (2.2 ng x g -1 ). Two NIST SRMs were used for internal quality control. The concentrations of most of the elements were found to be within ±6% of the certified or information values. The precisions were calculated from six replicate measurements and were found to be within 10%. (author)
International Nuclear Information System (INIS)
Martinez y Huaman, C.A.; Cerri, C.C.
1984-01-01
The relationship between photosynthesis and distribution of 14 C-photosinthate as affected by water stress was evaluated. Corn (Zea mays L.) during the grain filling period and bean (Phaseolus vulgaris L.) during flowering, representing a C-4 and a C-3 photosynthetic type, respectively, were studied. (M.A.C.) [pt
Directory of Open Access Journals (Sweden)
Solange Maria de França
2012-09-01
Full Text Available The effects of tangerine (Phaseolus vulgaris Blanco, lemon (Citrus medica limonum Lush, pear orange (Citrus sinensis L. Osbeck, red copaiba (Copaifera langsdorffii Desf., rosemary (Baccharis dracunculifolia De Candole, Eucalyptus (Eucalyptus globulus Labillardière and E. citriodora Hook, lemongrass (Cymbopogon citratus Stapf. and citronella (Cimbopogon nardus Linnaeus oils at several concentrations on Zabrotes subfasciatus (Boheman were studied. In toxicity tests, grains of Phaseolus vulgaris L. cv. Rajadinho were impregnated with oils and infested with adults of Z. subfasciatus up to 24 hours old. All tested oils were effective in reducing the viable egg-laying and adult emergence of this pest, in function of the concentrations used, highlighting E. citriodora and E. globulus oils which caused 100% effectiveness from 0.5 mL Kg-1 concentration. In repellency tests, two arenas consisting of plastic containers, connected symmetrically to a central box by two plastic tubes were used. In one of the boxes, untreated beans were placed and on the other ones beans treated with each oil concentration were used. In the central box, five couples of Z. subfasciatus were released. Grains of P. vulgaris treated with oils of E. citriodora, C. citratus and C. oleifera reduced the attraction percentage of Z. subfasciatus adults, while the E. globulus increased this percentage. The percentages of reduced viable eggs ranged from 17.9% (C. medica limonum to 93.3% (C. nardus, while the reduction on the number of emerged insects was 23.9% and 95.9%, respectively for these same oils.Estudaram-se os efeitos dos óleos de tangerina 'Cravo' (Phaseolus vulgaris Blanco, limão-siciliano (Citrus medica limonum Lush, laranja 'Pêra' (Citrus sinensis L. Osbeek, copaíba-vermelha (Copaifera langsdorffii Desf., alecrim-do-campo (Baccharis dracunculifolia De Candole, eucalipto (Eucalyptus globulus Labillardière e Eucalyptus citriodora Hook, capim-santo (Cymbopogon citratus
Directory of Open Access Journals (Sweden)
Idalmis Bermúdez-Caraballoso
2014-01-01
Full Text Available Genetic breeding in Phaseolus by genetic transformation requires an efficient selection system. The present investigation was aimed to determine the minimum lethal concentration of glufosinate-ammonium (Finale ® in beans plants cv. `CIAP 7247F' grown in greenhouse. Different concentrations of the herbicide were applied to the foliage of plants in acclimatization phase (20, 30 y 40 mg l-1 and the control. Results showed that the minimum lethal concentration in plants in acclimatization phase was 30 mg l-1. Results also demonstrated that is possible the use of the herbicide as a selective agent of beans transformants cv. `CIAP 7247F' carrying the bar gene. Keywords: genetic transformation, herbicide, selective agent, tissue culture
Directory of Open Access Journals (Sweden)
Ryszard Kosson
2014-01-01
Full Text Available In order to estimate the possible correlations among constituents of Phaseolus vulgaris seeds, the contents of protein, exogenous amino acids and flatulent galactooligosaccharides (raffinose and stachyose were analyzed in 16 Polish bean cultivars for dry seeds. A negative correlation coefficient (r =-0.9490 was found between protein and methionine contents. High positive correlations among exogenous amino acids, such as lysine and isoleucine, valine and isoleucine, lysine and tyrosine, were observed indicating a chance of selecting far more than one at a time. The small-seeded bean cultivars contained higher contents of protein and galactooligosaccharides than the large-seeded ones.
Comparisons of phaseolin type and α-amylase inhibitor in common bean(Phaseolus vulgaris L.)in China
Institute of Scientific and Technical Information of China (English)
Yang Yao; Yibo Hu; Yingying Zhu; Yue Gao; Guixing Ren
2016-01-01
The objective of this study was to characterize the phaseolin type and a-amylase(αAI) level in common bean(Phaseolus vidgaris L.) accessions deposited in the Chinese National Genebank.The 40 accessions sampled were common varieties originating in Asia,North America,South America,Europe,and Africa.No Inca(I-) phaseolin was observed in the accessions.Only four accessions contained Tendergreen(T-) phaseolin and the remaining36 contained Sanilac(S-) phaseolin.aAI proteins extracted from nine accessions showed higher a-amylase inhibitory activity than the control(Phase 2,IC50 = 0.65 μg).These common bean accessions have potential use as nutraceutical ingredients.
International Nuclear Information System (INIS)
Mancini Filho, J.
1990-01-01
The radiation effects on physico-chemical and nutritional characteristics of three Brazilian varieties of beans (Phaseolus vulgaris, L.) - Catu, Rajado and Carioca -were studied. The analytical parameters were obtained by the determination of soaking and cooking times, biological value in rats, protein electrophoretic profile, reductors sugars, oligosaccharides, fiber and fatty acids content. Also, amyloglucosidase, phytohemagglutinins, α-amylase and tryptic inhibitors activities were analysed. It was observed the gamma radiation until determined doses promotes changes on those parameters subsequently reducing substantially the cooking time without modification of the biological value of the proteins. This alteration was particularly noticed in the hard-to-cook beans. (author)
Idalmis Bermúdez-Caraballoso; Raúl Collado; Lourdes R. García; Novisel Veitía; Amanda Martirena; Damaris Torres; Carlos Romero; Gert Angenon
2012-01-01
An efficient selection system is necessary for distinguishing transformed cells of the untransformed tissue. This study aimed to determine the minimum inhibitory concentration of the herbicide Ammonium glufosinate in organogenic calli of Phaseolus vulgaris cv. CIAP 7247F, to use it as a selective agent in the process of genetic transformation. Fragments (4-5 mm) of proliferated calli after second subculture were used as explant. Callus proliferation medium with different concentrations of Amm...
Diversity of Rhizobium-Phaseolus vulgaris symbiosis: Overview and perspectives
International Nuclear Information System (INIS)
Martinez-Romero, Esperanza
2001-01-01
Common bean (Phaseolus vulgaris) has become a cosmopolitan crop, but was originally domesticated in the Americas and has been grown in Latin America for several thousand years. Consequently an enormous diversity of bean nodulating bacteria have developed and in the centers of origin the predominant species in bean nodules is R. etli. In some areas of Latin America, inoculation, which normally promotes nodulation and nitrogen fixation is hampered by the prevalence of native strains. Many other species in addition to R. etli have been found in bean nodules in regions where bean has been introduced. Some of these species such as R. leguminosarum bv. phaseoli, R. gallicum bv. phaseoli and R. giardinii bv. phaseoli might have arisen by acquiring the phaseoli plasmid from R. etli. Others, like R. trap id, are well adapted to acid soils and high temperatures and are good inoculants for bean under these conditions. The large number of rhizobia species capable of nodulating bean supports that bean is a promiscuous host and a diversity of bean-rhizobia interactions exists. Large ranges of dinitrogen fixing capabilities have been documented among bean cultivars and commercial beans have the lowest values among legume crops. Knowledge on bean symbiosis is still incipient but could help to improve bean biological nitrogen fixation. (author)
International Nuclear Information System (INIS)
D'Souza, T.J.; Mistry, K.B.
1980-01-01
The gamma-emitting fission product nuclides 106 Ru, 125 Sb, 137 Cs and 144 Ce that accumulated in the edible pods of bean (Phaseolus vulgaris L.) plants grown in nutrient culture were subjected to chemical fractionation. The results indicated that the largest fraction of 106 Ru, 125 Sb and 144 Ce was associated with ionic forms including salts of organic acids, phosphates, carbonates and some protein-bound forms extracted with dilute mineral acids (acid fraction). The association of these radionuclides with lipids including lipophyllic pigments, free amino acids and amino sugars (ethanol fraction) was next in significance. The association of 137 Cs was, however, greater with the ethanol fraction than with the acid fraction. Considerably reduced amounts of the fission products were present in the pectates, proteins, polysaccharides and nucleic acids. (U.K.)
Wouterlood, F.G.; Steinbusch, H.W.M.; Luiten, P.G.M.; Bol, J.G.J.M.
1987-01-01
We investigated the projection from the infralimbic division of the prefrontal cortex (area 25) to histaminergic neurons in the posterior hypothalamic area. Phaseolus vulgaris-leucoagglutinin (PHA-L) was injected in the prefrontal cortex of rats. Frozen brain sections were subjected to combined
Interaction of cold radiofrequency plasma with seeds of beans (Phaseolus vulgaris)
Bormashenko, Edward; Shapira, Yekaterina; Grynyov, Roman; Whyman, Gene; Bormashenko, Yelena; Drori, Elyashiv
2015-01-01
The impact of cold radiofrequency air plasma on the wetting properties and water imbibition of beans (Phaseolus vulgaris) was studied. The influence of plasma on wetting of a cotyledon and seed coat (testa) was elucidated. It was established that cold plasma treatment leads to hydrophilization of the cotyledon and tissues constituting the testa when they are separately exposed to plasma. By contrast, when the entire bean is exposed to plasma treatment, only the external surface of the bean is hydrophilized by the cold plasma. Water imbibition by plasma-treated beans was studied. Plasma treatment markedly accelerates the water absorption. The crucial role of a micropyle in the process of water imbibition was established. It was established that the final percentage of germination was almost the same in the cases of plasma-treated, untreated, and vacuum-pumped samples. However, the speed of germination was markedly higher for the plasma-treated samples. The influence of the vacuum pumping involved in the cold plasma treatment on the germination was also clarified. PMID:25948708
Yañez, E; Zacarias, I; Aguayo, M; Vasquez, M; Guzman, E
1995-06-01
Five new cultivars of common beans (Phaseolus vulgaris) recently released were analyzed for their proximate chemical composition and protein biological quality. The crude protein content in these cultivars ranged from 21.9 percent in cultivar Arroz 3 to 26.9 percent in cultivar Tórtola Diana (dry matter basis). Rats fed cultivar Tórtola INIA gained more weight, had a higher protein intake and registered higher PER and NPR than Tórtola corriente. On the other hand, rats consuming cultivars Arroz 3 and Fleetwood had lower weight gain, lower protein intake and lower PER and NPR than cultivar Coscorrón corriente. However, all these cultivars have a relatively good protein value as compared to other plant protein sources.
Improvement of protein and amino acid contents in seeds of food legumes. A case study in Phaseolus
Directory of Open Access Journals (Sweden)
Baudoin J.P.
1999-01-01
Full Text Available Food legumes are considered as the major source of dietary proteins among the plant species. Protein and amino acid contents were evaluated in a wide sample of both wild and cultivated genotypes of Phaseolus species, with a view to investigate possibilities of genetic improvement in seed nutritional quality. Results indicate a variation in relation with taxa, biological status within species (such as in P. lunatus, ecological conditions, seed parts (testa, cotyledons and embryonic axis, and major protein groups. However, the sulphur containing amino acids remain a limiting factor, which could be better overcome by mixing food legumes with other plant species such as cereals.
Directory of Open Access Journals (Sweden)
Danuta Pięta
2013-12-01
Full Text Available The subject of the studies was the soil with introduced solutions containing 0,1% chitosan. These materials were obtained from the Institute of Chemical Fibres in L6d2 (in the form of a microcrystalline gel and also from the Department of Food Biochemistry and Chemistry of the University of Agriculture in Lublin (in a liquid form,i.e.dissolved in acetic acid. In order to set an experiment in a growth chamber, grey brown podzolic soil formed from loesses and taken from a mechanically treated belt of black fallow was used. The soil (1000 g was watered every 8 days with 100 ml of examined chitosan solutions per pot. Control soil was watered with sterile distilled water. Seven days after each watering, soil samples were taken for microbiological analysis. Then 25 runner bean seeds were sown into each pot. After six weeks of plants' growth the experiment was finished and the number of plants was counted, their healthiness determined and soil microbiological analysis was performed. Regardless of chitosan form introduced to the soil it stimulated the growth of bacteria and fungi, since in these experimental combinations was found a significantly higher number of microorganisms as compared with the control. A particular high increase in the number of microorganism colonies was observed with simultaneous growth of plants and the application of chitosan. A considerable increase of fungi colonies from the Trichoderma genus was found in the soil treated with chitosan in the form ofboth a microcrystalline gel and a liquid. The species of this genus are considered to be antagonists; it affects pathogenic fungi through competition, antibiosis and over-parasitism. An increase in colonies of saprophytic microorganisms, including antagonistic ones of Bacillus spp. and Pseudomonas spp. was observed in the soil treated with chitosan . On the other hand, in the soil after the growth of bean and treated watered with chitosan only few colonies of Fusarium oxysporum f.sp. phaseoli- bean pathogen were found. The healthiness of plants grown in soil treated with chitosan was significantly better as compared to the control. The populations of antagonistic microorganisms formed in the soil in these treatments probably limited the growth of pathogenic fungus.
Insects diversity in lima bean (Phaseolus lunatus
Directory of Open Access Journals (Sweden)
WIWIN SETIAWATI
2005-10-01
Full Text Available Lima bean (Phaseolus lunatus is a vegetable which usually made as a home yard plant for Indonesian people to fulfill their daily needs. This plant has not been produced in the large number by the farmer. So it is hard to find in the market. Lima bean is light by many kind of insect. Inventory, identification and the study of insect taxon to this plant is being done to collect some information about the insect who life in the plant. The research was done in Balitsa experiment garden in the district of Lembang in Bandung regency on November 2003-February 2004, the experiment start at 4 weeks age, at the height of 1260 m over the sea level. The observation was made systematically by absolute method (D-vac macine and relative method (sweeping net. The research so that there were 26 species of phytofagous insect, 9 species of predator insect, 6 species of parasitoid insect, 4 species of pollinator and 14 species of scavenger insect. According to the research the highest species number was got in the 8th week (3rd sampling, which had 27 variety of species, so the highest diversity was also got in this with 2,113 point. Aphididae and Cicadellidae was the most insect found in roay plant. The research also had high number of species insect so the diversity of insect and evenness become high. A community will have the high stability if it is a long with the high diversity. High evenness in community that has low species dominance and high species number of insect so the high of species richness.
Pinto Beans (Phaseolus vulgaris L. as a Functional Food: Implications on Human Health
Directory of Open Access Journals (Sweden)
Vicki Schlegel
2013-02-01
Full Text Available Most foods are considered functional in terms of providing nutrients and energy to sustain daily life, but dietary systems that are capable of preventing or remediating a stressed or diseased state are classified as functional foods. Dry beans (Phaseolus vulgaris L. contain high levels of chemically diverse components (phenols, resistance starch, vitamins, fructooligosaccharides that have shown to protect against such conditions as oxidative stress, cardiovascular disease, diabetes, metabolic syndrome, and many types of cancer, thereby positioning this legume as an excellent functional food. Moreover, the United States has a rich dry bean history and is currently a top producer of dry beans in the world with pinto beans accounting for the vast majority. Despite these attributes, dry bean consumption in the US remains relatively low. Therefore, the objective of this manuscript is to review dry beans as an important US agricultural crop and as functional food for the present age with an emphasis on pinto beans.
Nitrogen cycling in a 15N-fertilized bean (Phaseolus vulgaris L.) crop
International Nuclear Information System (INIS)
Victoria, R.L.; Libardi, P.L.; Reichardt, K.; Cervellini, A.
1982-01-01
To increase our understanding of the fate of applied nitrogen in Phaseolus vulgaris crops grown under tropical conditions, 15 N-labelled urea was applied to bean crops and followed for three consecutive cropping periods. Each crop received 100 kg urea-N ha - 1 and 41 kg KCl-K ha - 1 . At the end of each period we estimated each crop's recovery of the added nitrogen, the residual effects of nitrogen from the previous cropping period, the distribution of nitrogen in the soil profile, and leaching losses of nitrogen. In addition, to evaluate potential effects of added phosphorus on nitrogen cycling in this crop, beans were treated at planting with either 35 kg rock-phosphate-P, 35 kg superphosphate-P, or 0 kg P ha - 1 . Results showed that 31.2% of the nitrogen in the first crop was derived from the applied urea, which represents a nitrogen utilization efficiency of 38.5%, 6.2% of the nitrogen in the second crop was derived from fertilizer applied to the first crop, and 1.4% of the nitrogen in the third crop. (orig./AJ)
Polyphenol-Rich Dry Common Beans (Phaseolus vulgaris L.) and Their Health Benefits
Ganesan, Kumar
2017-01-01
Polyphenols are plant metabolites with potent anti-oxidant properties, which help to reduce the effects of oxidative stress-induced dreaded diseases. The evidence demonstrated that dietary polyphenols are of emerging increasing scientific interest due to their role in the prevention of degenerative diseases in humans. Possible health beneficial effects of polyphenols are based on the human consumption and their bioavailability. Common beans (Phaseolus vulgaris L.) are a greater source of polyphenolic compounds with numerous health promoting properties. Polyphenol-rich dry common beans have potential effects on human health, and possess anti-oxidant, anti-diabetic, anti-obesity, anti-inflammatory and anti-mutagenic and anti-carcinogenic properties. Based on the studies, the current comprehensive review aims to provide up-to-date information on the nutritional compositions and health-promoting effect of polyphenol-rich common beans, which help to explore their therapeutic values for future clinical studies. Investigation of common beans and their impacts on human health were obtained from various library databases and electronic searches (Science Direct PubMed, and Google Scholar). PMID:29113066
Directory of Open Access Journals (Sweden)
Thimmapuram Jyothi
2011-10-01
Full Text Available Abstract Background Common bean (Phaseolus vulgaris is the most important food legume in the world. Although this crop is very important to both the developed and developing world as a means of dietary protein supply, resources available in common bean are limited. Global transcriptome analysis is important to better understand gene expression, genetic variation, and gene structure annotation in addition to other important features. However, the number and description of common bean sequences are very limited, which greatly inhibits genome and transcriptome research. Here we used 454 pyrosequencing to obtain a substantial transcriptome dataset for common bean. Results We obtained 1,692,972 reads with an average read length of 207 nucleotides (nt. These reads were assembled into 59,295 unigenes including 39,572 contigs and 19,723 singletons, in addition to 35,328 singletons less than 100 bp. Comparing the unigenes to common bean ESTs deposited in GenBank, we found that 53.40% or 31,664 of these unigenes had no matches to this dataset and can be considered as new common bean transcripts. Functional annotation of the unigenes carried out by Gene Ontology assignments from hits to Arabidopsis and soybean indicated coverage of a broad range of GO categories. The common bean unigenes were also compared to the bean bacterial artificial chromosome (BAC end sequences, and a total of 21% of the unigenes (12,724 including 9,199 contigs and 3,256 singletons match to the 8,823 BAC-end sequences. In addition, a large number of simple sequence repeats (SSRs and transcription factors were also identified in this study. Conclusions This work provides the first large scale identification of the common bean transcriptome derived by 454 pyrosequencing. This research has resulted in a 150% increase in the number of Phaseolus vulgaris ESTs. The dataset obtained through this analysis will provide a platform for functional genomics in common bean and related legumes and
Directory of Open Access Journals (Sweden)
Kolima Peña Calzada
2015-09-01
Full Text Available El objetivo fue evaluar el efecto de la aplicación simultánea de Fitomas E y Biobras 16 en el cultivo del frijol (Phaseolus vulgaris L.. Se utilizó un diseño de bloques al azar con dos tratamientos y ocho réplicas. Los tratamientos consistieron en la aplicación combinada de Fitomas E (2,0 l.ha-1 y Biobras 16 (0,12 l.ha-1 y una variante control. Las variables evaluadas fueron: altura de las plantas a los 25 y 40 días post siembra, vaina por planta, granos por vainas, granos por plantas, masa de 100 granos y rendimiento agrícola. Se observó en la altura de las plantas diferencias estadísticas significativas entre ambos tratamientos, superando la combinación de Fitomas E y Biobras 16 al tratamiento control, en un 19,43 % y un 17,73 % respectivamente. La variable vainas por planta también mostró diferencias significativas favorables al tratamiento con los bioestimulantes, no así el número de granos por vainas y la masa de 100 granos. El mayor rendimiento agrícola se obtuvo con la variante donde se aplicó Fitomas E y Biobras 16, el cual difirió significativamente del control. Se concluye que el comportamiento agroproductivo del cultivo del frijol (Phaseolus vulgaris L. se favoreció con el tratamiento evaluado.
Beans (Phaseolus vulgaris L.) are one of the most economically and nutritionally important crops world-wide. They are the most important legume for direct human consumption with more than 23 million metric tons produced in 2013; more than twice that of the next most important legume, chickpea (Cicer...
Several isolates from nodules of Phaseolus vulgaris grown in soil of Lanzarote, an island of the Canaries, had electrophoretic LMW RNA patterns identical with a less common pattern within S. meliloti (assigned as group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northe...
DEFF Research Database (Denmark)
Tetens, Inge
2014-01-01
an opinion on the scientific substantiation of a health claim related to a standardised aqueous extract from white kidney bean (Phaseolus vulgaris L.) and reduction of body weight. The Panel considers that the food is sufficiently characterised. A reduction in body weight is a beneficial physiological effect...... for a mechanism by which the standardised aqueous extract from white kidney bean could exert the claimed effect. The Panel concludes that the evidence provided is insufficient to establish a cause and effect relationship between the consumption of the standardised aqueous extract from white kidney bean (Phaseolus...... vulgaris L.) and reduction of body weight....
Directory of Open Access Journals (Sweden)
Yanitza Meriño Hernandez
2015-01-01
Full Text Available In two moisture conditions (drought and irrigation were evaluated six varieties of common bean (Phaseolus vulgaris L., with a factorial randomized complete blocks. The objectives of the study was to evaluate the effect caused by drought conditions crop varieties, identify high performance and features that enable them to adapt to varying conditions of soil moisture. With the data in yields between the two humidity conditions intensity indices of drought (IIS, susceptibility to drought (ISS, relative efficiency (IER, geometric mean (GM and percent yield losses were calculated . The results were statistically processed using the Statistica software version 8.0 for Windows, if significant differences Tukey test was applied to p<0.05. The selection based on levels ISS, MG, IER and PPR identified high yielding varieties adapted to drought and favorable moisture conditions.
Plantas invasoras da cultura do feijoeiro (Phaseolus vulgaris L. no Estado de Minas Gerais
Directory of Open Access Journals (Sweden)
Julio Pedro Laca-Buendia
1989-01-01
Full Text Available Nas áreas de cultura do feijoeiro (Phaseolus vulgaris L., no Estado de Minas Gerais, foram coletadas e identificadas 222 espécies de plantas invasoras (= plantas daninhas, pertencentes a 35 famílias botânias, representando 118 gêneros, sendo que as famílias Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae e Solanaceae, são as mais importantes em relação à cultura. As plantas coletadas, devidamente etiquetadas e identificadas, foram anexadas no PAMG (Herbário da Empresa de Pesquisa Agropecuária de Minas Gerais, Belo Horizonte - (MG..A survey in the cultivation area of bean in the state of Minas Gerais, Brazil, resulted in the determination of 222 weeds species, of 118 genera belonging to 35 families presenting a greater number of species areas: Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae and Solanaceae, with 33, 30, 25, 21, 12, 10. 10, 10, 9. 8 species respectively.
Energy Technology Data Exchange (ETDEWEB)
Applegate, H G; Adams, D F
1960-01-01
Bean plants (Phaseolus vulgaris) were grown in an atmosphere containing 2.0 +/- 0.21 g F /mT (1.6 ppb). The effect of N, P, K, Fe, and Ca deficiencies and the effect of osmotic pressures of 0, 1.5, 3.0, 4.5, 6.0 and 7.5 pounds on fluoride uptake and fluoride-mediated respiration were studied. The data showed that P deficient plants took up more fluoride than plants deficient in any of the other elements studied. Fluoride-mediated respiration was phosphorous dependent, however. Plants low in Fe or K showed increased uptake of fluoride. Nitrogen had no effect on fluoride uptake under the conditions of this experiment. Plants low in Fe showed inhibition of oxygen uptake. This inhibition was accentuated by fluoride. The interactions of N, K and Ca with fluoride on respiration were complex. Neither fluoride uptake nor fluoride-mediated respiration appeared to be linked directly to the water economy of the plants. 14 references, 6 tables.
Directory of Open Access Journals (Sweden)
Gregory E. Perry
2013-08-01
Full Text Available Resistance to common bacterial blight, caused by Xanthomonas axonopodis pv. phaseoli, in Phaseolus vulgaris is conditioned by several loci on different chromosomes. Previous studies with OAC-Rex, a CBB-resistant, white bean variety of Mesoamerican origin, identified two resistance loci associated with the molecular markers Pv-CTT001 and SU91, on chromosome 4 and 8, respectively. Resistance to CBB is assumed to be derived from an interspecific cross with Phaseolus acutifolius in the pedigree of OAC-Rex. Our current whole genome sequencing effort with OAC-Rex provided the opportunity to compare its genome in the regions associated with CBB resistance with the v1.0 release of the P. vulgaris line G19833, which is a large seeded bean of Andean origin, and (assumed to be CBB susceptible.. In addition, the genomic regions containing SAP6, a marker associated with P. vulgaris-derived CBB-resistance on chromosome 10, were compared. These analyses indicated that gene content was highly conserved between G19833 and OAC-Rex across the regions examined (>80%. However, fifty-nine genes unique to OAC Rex were identified, with resistance gene homologues making up the largest category (10 genes identified. Two unique genes in OAC-Rex located within the SU91 resistance QTL have homology to P. acutifolius ESTs and may be potential sources of CBB resistance. As the genomic sequence assembly of OAC-Rex is completed, we expect that further comparisons between it and the G19833 genome will lead to a greater understanding of CBB resistance in bean.
Studies on the distribution of 14C-malformin A in major fractions of Phaseolus vulgaris L
International Nuclear Information System (INIS)
Ciarlante, D.; Curtis, R.W.
1976-01-01
The distribution pattern of 14 C-malformin in major fractions of Phaseolus vulgaris L, seedlings shifted during water treatment in the absence of malformin. From these shifts, and by comparison of the 14 C distribution patterns at the base and top of the seedlings, it was concluded that some 14 C-malformin enters the cell and proceeds to the cell wall via intermediate compounds. As a working hypothesis it was suggested that in roots 14 C-malformin first appears in a soluble ''small molecules'' fraction, binds to a soluble protein fraction, and proceeds via the wall lipid fraction to the wall itself. Direct binding of some 14 C-malformin to the wall fraction was not precluded. In leaves, the pathway of 14 C-malformin to the cell wall was similar in some respects to that in roots. (auth.)
Purification and partial characterization of Phaseolus vulgaris seed aminopeptidase
Directory of Open Access Journals (Sweden)
Abdala A.P.
1999-01-01
Full Text Available The aminopeptidase activity of Phaseolus vulgaris seeds was measured using L-Leu-p-nitroanilide and the L-aminoacyl-ß-naphthylamides of Leu, Ala, Arg and Met. A single peak of aminopeptidase activity on Leu-ß-naphthylamide was eluted at 750 µS after gradient elution chromatography on DEAE-cellulose of the supernatant of a crude seed extract. The effluent containing enzyme activity was applied to a Superdex 200 column and only one peak of aminopeptidase activity was obtained. SDS-polyacrylamide gel electrophoresis (10% presented only one protein band with molecular mass of 31 kDa under reducing and nonreducing conditions. The aminopeptidase has an optimum pH of 7.0 for activity on all substrates tested and the highest Vmax/KM ratio for L-Leu-ß-naphthylamide. The enzyme activity was increased 40% by 0.15 M NaCl, inhibited 94% by 2.0 mM Zn2+, inhibited 91% by sodium p-hydroxymercuribenzoate and inhibited 45% by 0.7 mM o-phenanthroline and 30 µM EDTA. Mercaptoethanol (3.3 mM, dithioerythritol (1.7 mM, Ala, Arg, Leu and Met (70 µM, p-nitroaniline (0.25 mM and ß-naphthylamine (0.53 mM had no effect on enzyme activity when assayed with 0.56 mM of substrate. Bestatin (20 µM inhibited 18% the enzyme activity. The aminopeptidase activity in the seeds decayed 50% after two months when stored at 4oC and room temperature. The enzyme is leucyl aminopeptidase metal- and thiol group-dependent.
González, Ana J.; Landeras, Elena; Mendoza, M. Carmen
2000-01-01
Ribotyping was evaluated as a method to differentiate between Pseudomonas syringae pv. phaseolicola and pv. syringae strains causing bacterial brown spot and halo blight diseases in Phaseolus vulgaris L. Ribotyping, with restriction enzymes BglI and SalI and using the Escherichia coli rrnB operon as the probe, differentiated 11 and 14 ribotypes, respectively, and a combination of data from both procedures yielded 19 combined ribotypes. Cluster analysis of the combined ribotypes differentiated the pathovars phaseolicola and syringae, as well as different clonal lineages within these pathovars. The potential of ribotyping to screen for correlations between lineages and factors such as geographical region and/or bean varieties is also reported. PMID:10653764
Del Pino,Victoria H.; Lajolo,Franco M.
2003-01-01
Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró e...
Directory of Open Access Journals (Sweden)
María Camila Quevedo Rubiano
2016-09-01
Full Text Available This article presents the results of the thesis carried out in the research group of Biotechnology Teaching in Colombia, with the aim of providing teachers of Biology of Instituto Pedagogico Nacional a booklet that can strengthen the teaching of biotechnology processes using Rhizobium sp reduction of chemical fertilizers and symbiosis with Phaseolus vulgaris. The booklet contains a proposal of practical activities that enable teachers of this institution to use spaces like the farm, enabling to teach biotechnology related to agronomy. Therefore, for this project was considered two Biological and Pedagogical approaches, the first is within the analytical empirical paradigm in the process of microbiological characterization of Rhizobium and their Biofertilizing ability in beans; and the teaching approach within the design of a booklet that includes the findings of this study as a contribution to the reduction of chemical fertilizers school farm. In order to have a complete analysis of the work it was subjected to quantitative and qualitative methods. This biotech practice is included in the booklet showing in bioassays that bacteria has biofertilizer without inhibiting potential symbiosis, and that research and teaching biological concepts from scientific expertise can be promoted in Biology class for students to understand its context in a significant way, to be used in different levels of education; also it is a teaching strategy.
Directory of Open Access Journals (Sweden)
Lei Pan
2014-03-01
Full Text Available Premise of the study: Vigna unguiculata is an economically important legume, and the complexity of its variability and evolution needs to be further understood. Based on publicly available databases, we developed chloroplast microsatellite primers to investigate genetic diversity within V. unguiculata and its related species Phaseolus vulgaris. Methods and Results: Twelve polymorphic chloroplast microsatellite markers were developed and characterized in 62 V. unguiculata individuals. The number of alleles per locus varied between two and four, the unbiased haploid diversity per locus ranged from 0.123 to 0.497, and the polymorphism information content varied from 0.114 to 0.369. In cross-species amplifications, nine of these markers showed polymorphism in 29 P. vulgaris individuals. Conclusions: The newly developed chloroplast microsatellite markers exhibit variation in V. unguiculata as well as their transferability in P. vulgaris. These markers can be used to investigate genetic diversity and evolution in V. unguiculata and P. vulgaris.
Energy Technology Data Exchange (ETDEWEB)
Huber, W.; Kreutmeier, F.; Sankhla, N.
1977-01-01
The effect of sodium chloride (NaCl) and abscisic acid (ABA) on protein synthesis, protein hydrolysis, activities of alanine and aspartate aminotransferases, glutamate dehydrogenase, glutamine synthetase, ..delta..-pyrroline-5-carboxylate-reductase and amino-acid composition was investigated in the leaves of four days old Phaseolus aconitifolius seedlings. Both NaCl and ABA inhibited protein synthesis, but promoted the activities of leucine arylamidase, alanine and aspartate aminotransferases, glutamate dehydrogenase, glutamine synthetase and ..delta..-pyrroline-5-carboxylate-reductase. The results of the amino-acid analysis indicated following treatment with NaCl the amounts of proline, arginine, serine and glutamic acid increased significantly in the leaves. An increase of the proline concentration could be observed only up to a salt concentration of 8.5 x 10/sup -3/ M. Increasing concentrations of ABA also brought a corresponding rise in proline, serine and glutamic acid content. Interestingly the decrease of proline concentration by a salt concentration of more than 8.5 x 10/sup -3/ M is correlated with a decrease in endogenous ABA-content. The possible significance of the similarites between the action of abscisic acid and salinity in influencing the amino-acid and protein metabolism in Phaseolus aconitifolius seedlings during stress is discussed. 31 references, 8 figures, 2 tables.
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2016-01-01
on the scientific substantiation of a health claim related to Fabenol® Max and ‘reduces the absorption of carbohydrates’. The Panel considers that Fabenol® Max, which is an aqueous extract from Phaseolus vulgaris L. standardised by its content of α-amylase inhibitor, is sufficiently characterised. According...
Kawashima, Tomokazu; Wang, Xingjun; Henry, Kelli F; Bi, Yuping; Weterings, Koen; Goldberg, Robert B
2009-03-03
Little is known about the molecular mechanisms by which the embryo proper and suspensor of plant embryos activate specific gene sets shortly after fertilization. We analyzed the upstream region of the scarlet runner bean (Phaseolus coccineus) G564 gene to understand how genes are activated specifically within the suspensor during early embryo development. Previously, we showed that the G564 upstream region has a block of tandem repeats, which contain a conserved 10-bp motif (GAAAAG(C)/(T)GAA), and that deletion of these repeats results in a loss of suspensor transcription. Here, we use gain-of-function (GOF) experiments with transgenic globular-stage tobacco embryos to show that only 1 of the 5 tandem repeats is required to drive suspensor-specific transcription. Fine-scale deletion and scanning mutagenesis experiments with 1 tandem repeat uncovered a 54-bp region that contains all of the sequences required to activate transcription in the suspensor, including the 10-bp motif (GAAAAGCGAA) and a similar 10-bp-like motif (GAAAAACGAA). Site-directed mutagenesis and GOF experiments indicated that both the 10-bp and 10-bp-like motifs are necessary, but not sufficient to activate transcription in the suspensor, and that a sequence (TTGGT) between the 10-bp and the 10-bp-like motifs is also necessary for suspensor transcription. Together, these data identify sequences that are required to activate transcription in the suspensor of a plant embryo after fertilization.
Martínez-Aguilar, Lourdes; Salazar-Salazar, Corelly; Méndez, Rafael Díaz; Caballero-Mellado, Jesús; Hirsch, Ann M; Vásquez-Murrieta, María Soledad; Estrada-de los Santos, Paulina
2013-12-01
During a survey of Burkholderia species with potential use in agrobiotechnology, a group of 12 strains was isolated from the rhizosphere and rhizoplane of tomato plants growing in Mexico (Nepantla, Mexico State). A phylogenetic analysis of 16S rRNA gene sequences showed that the strains are related to Burkholderia kururiensis and Burkholderia mimosarum (97.4 and 97.1 %, respectively). However, they induced effective nitrogen-fixing nodules on roots of Phaseolus vulgaris. Based on polyphasic taxonomy, the group of strains represents a novel species for which the name Burkholderia caballeronis sp. nov. is proposed. The type species is TNe-841(T) (= LMG 26416(T) = CIP 110324(T)).
Removal of some metal ions by activated carbon prepared from Phaseolus aureus hulls.
Rao, M Madhava; Ramana, D K; Seshaiah, K; Wang, M C; Chien, S W Chang
2009-07-30
Removal of lead [Pb(II)], zinc [Zn(II)], copper [Cu(II)], and cadmium [Cd(II)] from aqueous solutions using activated carbon prepared from Phaseolus aureus hulls (ACPAH), an agricultural waste was studied. The influence of various parameters such as effect of pH, contact time, adsorbent dose, and initial concentration of metal ions on the removal was evaluated by batch method. The removal of metal ions by ACPAH was pH dependent and the optimum pH values were 7.0, 8.0, 7.0 and 6.0 for Cu(II), Cd(II), Zn(II), and Pb(II), respectively. The sorption isotherms were studied using Langmuir, Freundlich, Dubinin-Radushkevich (D-R), and Temkin isotherm models. The maximum adsorption capacity values of ACPAH for metal ions were 21.8 mg g(-1) for Pb(II), 21.2 mg g(-1) for Zn(II), 19.5 mg g(-1) for Cu(II), and 15.7 mg g(-1) for Cd(II). The experiments demonstrated that the removal of metal ions followed the pseudo-second-order kinetic model. Desorption experiments were carried out using HCl solution with a view to regenerate the spent adsorbent and to recover the adsorbed metal ions.
Removal of some metal ions by activated carbon prepared from Phaseolus aureus hulls
International Nuclear Information System (INIS)
Rao, M. Madhava; Ramana, D.K.; Seshaiah, K.; Wang, M.C.; Chien, S.W. Chang
2009-01-01
Removal of lead [Pb(II)], zinc [Zn(II)], copper [Cu(II)], and cadmium [Cd(II)] from aqueous solutions using activated carbon prepared from Phaseolus aureus hulls (ACPAH), an agricultural waste was studied. The influence of various parameters such as effect of pH, contact time, adsorbent dose, and initial concentration of metal ions on the removal was evaluated by batch method. The removal of metal ions by ACPAH was pH dependent and the optimum pH values were 7.0, 8.0, 7.0 and 6.0 for Cu(II), Cd(II), Zn(II), and Pb(II), respectively. The sorption isotherms were studied using Langmuir, Freundlich, Dubinin-Radushkevich (D-R), and Temkin isotherm models. The maximum adsorption capacity values of ACPAH for metal ions were 21.8 mg g -1 for Pb(II), 21.2 mg g -1 for Zn(II), 19.5 mg g -1 for Cu(II), and 15.7 mg g -1 for Cd(II). The experiments demonstrated that the removal of metal ions followed the pseudo-second-order kinetic model. Desorption experiments were carried out using HCl solution with a view to regenerate the spent adsorbent and to recover the adsorbed metal ions.
Genetic control of common bean (Phaseolus vulgaris resistance to powdery mildew (Erysiphe polygoni
Directory of Open Access Journals (Sweden)
Rezende Viviane Ferreira
1999-01-01
Full Text Available Genetic control of common bean (Phaseolus vulgaris resistance to powdery mildew (Erysiphe polygoni was studied using segregating populations from the bean variety crosses Jalo x ESAL 686 and ESAL 550 x ESAL 686. F2 plants, together with the parents, were inoculated and evaluated using a scale of values from one (plant without symptoms to nine (completely infected plant. F2 plants were harvested individually, and F2:3 families were obtained. These families were evaluated in an 11 x 11 and 12 x 12 simple lattice statistical design for the Jalo x ESAL 686 and ESAL 550 x ESAL 686 crosses, respectively, using the same value scale as the F2 generation. The segregation observed in F2 plants and F2:3 families indicated that two genes are involved in genetic control, due to a double recessive epistasis. The high linear regression coefficient (b between F2 plants and their F2:3 family, 0.66 for ESAL 550 x ESAL 686 cross, and 0.71 for Jalo x ESAL 686 cross, showed that the trait is highly heritable.
Directory of Open Access Journals (Sweden)
Rouverson Pereira da Silva
2013-03-01
Full Text Available Dentre as etapas de produção do feijoeiro a colheita é uma das mais importantes, porque pode interferir de maneira decisiva na qualidade e no custo de produção. Assim, objetivou-se avaliar a qualidade da operação da colheita mecanizada de feijão (Phaseolus vulgaris, cultivado sob preparo convencional e plantio direto. As variáveis analisadas foram: o nível de ruído emitido, calculado através de um medidor de pressão sonora; o desempenho operacional, sendo monitorado o consumo de combustível, a patinagem dos rodados e a velocidade de deslocamento do conjunto coletados em uma central digital (datalogger; e a operação de colheita quanto à matéria seca e densidade de palhada, e as perdas na colheita. A velocidade e os consumos horário e operacional apresentaram distribuição normal dos dados, enquanto que o nível de ruído apresentou distribuição assimétrica. As perdas na colheita mecanizada de feijão e a densidade de palhada apresentaram baixa variabilidade e distribuição normal. Assim, apenas o consumo horário e a produção de matéria seca de palhada apresentaram comportamento instável em relação ao controle estatístico de processo, enquanto os demais indicadores mostraram condições de manter a qualidade da operação de colheita tanto no preparo convencional de solo quanto no plantio direto.Among the production stages of the bean plant, harvesting is one of the most important, because it can decisively affect both quality and production costs. Thus, the objective was to assess quality in the mechanized harvesting of beans (Phaseolus vulgaris, grown under conventional tillage and no-tillage systems. The variables analysed were: the noise level emitted, calculated using a sound-pressure meter; the operational performance, by monitoring fuel consumption, wheel-slippage, and displacement velocity of the machine, all collected digitally (datalogger; and the harvesting operation with regard to the dry matter and
Directory of Open Access Journals (Sweden)
José C. Mendonça
2007-10-01
Full Text Available A evapotranspiração de uma cultura é uma das principais informações exigidas para o manejo de irrigação e para fins de planejamento do uso da água. Dentre as abordagens disponíveis para a estimativa do consumo de água pelas plantas, destaca-se o uso de coeficientes de cultura (Kc associados a estimativas da evapotranspiração de referência (ETo. Buscou-se determinar, aqui, os valores de Kc para as diferentes fases fenológicas do feijoeiro comum (Phaseolus vulgaris L., cultivar em lançamento UENF-47, através da utilização de um lisímetro de pesagem e compará-los com os valores propostos pela FAO 56. Concluiu-se que as equações de ajustamento propostas por Allen et al. (1998 se mostraram eficientes para a correção e ajustamento dos coeficientes culturais obtidos neste experimento e que os coeficientes culturais das fases 3 (Kc méd e 4 (Kc fim sugeridos também por Allen et al. (1998 se ajustaram bem ��s condições de cultivo do feijoeiro cultivado no período de outono/inverno, em Campos dos Goytacazes, RJ.The evapotranspiration of a crop is one of the main information required for proper irrigation management and to develop an efficient water usage plan. Among the methods to estimate the amount of water that is consumed by plants, the use of crop coefficients (Kc, associated with estimates of the reference evapotranspiration (ETo, stands as one of the most promising. This work aimed to deterime the values of Kc for different phenological phases of common bean plants (Phaseolus vulgaris L. of the cultivar UENF-47. Determination of Kc values was performed using a weighing lisimeter and results were compared with values obtained through the FAO 56 standard. Results showed that the adjustment equations proposed by Allen et al. (1998 were adequate for fitting the values of Kc obtained in this experiment. It has been shown that the crop coefficients for phenological phases 3 and 4 proposed by Allen et al. (1998 are adequate
Pascale, Raffaella; Bianco, Giuliana; Cataldi, Tommaso R I; Kopplin, Philippe-Schmitt; Bosco, Federica; Vignola, Lisiana; Uhl, Jenny; Lucio, Marianna; Milella, Luigi
2018-03-01
The present study deals with the evaluation of antidiabetic activities of Fagioli di Sarconi beans (Phaseolus vulgaris), including 21 ecotypes protected by the European Union with the mark PGI (i.e., Protected Geographical Indication), and cultivated in Basilicata (southern Italy). For this purpose, α-glucosidase and α-amylase assays were assessed; among all bean ecotypes, the tight green seed colour of Verdolino extracts exhibited the highest α-glucosidase and α-amylase inhibitory activity with IC 50 =1.1±0.1μg/ml and IC 50 =19.3±1.1μg/ml, respectively. Phytochemical compound screening of all Fagioli di Sarconi beans performed by flow injection-electrospray ionization-ultrahigh resolution mass spectrometry (uHRMS) and based on the calculation of elemental formulas from accurate m/z values, was helpful to annotate specific compounds, such as alkaloids, saponins, flavonoids, and terpenoids, which are most likely responsible for their biological activity. Copyright © 2017. Published by Elsevier Ltd.
Starch and sucrose synthesis in Phaseolus vulgaris as affected by light, CO2, and abscisic acid
International Nuclear Information System (INIS)
Sharkey, T.D.; Berry, J.A.; Raschke, K.
1985-01-01
Phaseolus vulgaris L. leaves were subjected to various light, CO 2 , and O 2 levels and abscisic acid, then given a 10 minute pulse of 14 CO 2 followed by a 5 minute chase with unlabeled CO 2 . After the chase period, very little label remained in the ionic fractions except at low CO 2 partial pressure. Most label was found in the neutral, alcohol soluble fraction or in the insoluble fraction digestable by amyloglucosidase. Sucrose formation was linearly related to assimilation rate. Starch formation increased linearly with assimilation rate, but did not occur if the assimilation rate was below 4 micromoles per square meter per second. Neither abscisic acid, nor high CO 2 in combination with low O 2 caused significant perturbations of the sucrose/starch formation ratio. These studies indicate that the pathways for starch and sucrose synthesis both are controlled by the rate of net CO 2 assimilation, with sucrose the preferred product at very low assimilation rates
Effect of lead on imbibition, germination, and growth of Phaseolus vulgaris L. and Zea mays L.
Directory of Open Access Journals (Sweden)
Gustavo Isaza Guzmán Isaza Guzmán
2013-07-01
Full Text Available Lead is highly reactive and it can be consequently toxic to living cells to both plants and humans. This heavy metal is a source of contamination to the environment and it disrupts natural cycles. The present study was aimed to evaluate the effect of lead on the imbibition process, germination and growth in the bean (Phaseolus vulgaris L. and maize (Zea mays L.. It was developed a system consisting of receptacles to expose flooded plants at different concentrations of the metal. Results showed that at concentrations of 5 g l-1 lead imbibition process was affected, but was more evident in bean. Germination percentage was not affected in maize seeds, while viability was affected in bean seeds. We observed statistically that there is an effect on organ growth of root, stem and leaf in both species in the presence of solution whose effect is most noticeable in bean plants. Key words: heavy metals,phytoremediation, stress, toxic substances
Fernández-Luqueño, F; Reyes-Varela, V; Martínez-Suárez, C; Salomón-Hernández, G; Yáñez-Meneses, J; Ceballos-Ramírez, J M; Dendooven, L
2010-01-01
Wastewater sludge can be used to fertilize crops, especially after vermicomposting (composting with earthworms to reduce pathogens). How wastewater sludge or vermicompost affects bean (Phaseolus vulgaris L.) growth is still largely unknown. In this study the effect of different forms of N fertilizer on common bean plant characteristics and yield were investigated in a Typic Fragiudepts (sandy loam) soil under greenhouse conditions. Beans were fertilized with wastewater sludge, or wastewater sludge vermicompost, or urea, or grown in unamended soil, while plant characteristics and yield were monitored (the unamended soil had no fertilization). Yields of common bean plants cultivated in unamended soil or soil amended with urea were lower than those cultivated in wastewater sludge-amended soil. Application of vermicompost further improved plant development and increased yield compared with beans cultivated in wastewater amended soil. It was found that application of organic waste products improved growth and yield of bean plants compared to those amended with inorganic fertilizer.
Directory of Open Access Journals (Sweden)
Edgar Rivero
2009-03-01
Full Text Available Biological aspects and life table of the red spider mite, Tetranychus desertorum Banks, 1900, were studied on leaf discs of kidney bean (Phaseolus vulgaris Linnaeus cultivar "Tacarigua" under laboratory conditions (28 ± 2ºC, 70 ± 10% R.H. and 12:12h. Our results showed that total developmental time was 6.8 days for females, with partial duration of immature stages corresponding to 3.8, 1.4, 1.0 and 0.7 for egg, larva, protonymph and deutonymph, respectively. Preoviposition, oviposition and postoviposition periods were 1.1, 8.4 and 1.3 days, respectively; and the higher mean fecundity (6.93 eggs/female/day was observed on day 4. Female mean longevity was 10 days. The life table parameters recorded were: net reproduction rate (Ro = 41.10 individuals; generation time (T = 11.15 days; intrinsic natural growth (r m = 0.144 individuals/female/day, and finite natural increase rate (λ = 1.155 individuals/female. Our findings could be a basis for further studies devoted to determine damage and control strategies for T. desertorum on kidney bean crops.
Directory of Open Access Journals (Sweden)
Myrna Hilal Moraes
2008-08-01
Full Text Available The common beans (Phaseolus vulgaris L. is a fabacea sufficiently spread out in all domestic territory. However, the quality of its seeds represents one of the main causes of low productivity in the beans farmings in Brazil. The objective of this work was to evaluate physiological and sanitary seed qualities of eleven bean cultivars. The physiological seed quality was evaluated trough standard germination and vigor tests. The sanitary seed quality was evaluated through two tests: blotter test was employed to evaluate fungi incidence and “Koch & Menten” method was employed to observe Sclerotinia sclerotiorum (Lib de Bary occurrence. Xamego, BRS Valente, Bambu and Pérola had the best results of physiological tests. Jalo Precoce, Roxo 90, Corrente and Aporé had no good results of vigor and germination, besides presenting the lowest indices of died seeds. Fusarium sp., Aspergillus spp., Penicillium sp., Phoma sp., Rhizopus sp. and Botrytis sp. were the fungi detected in the sanity tests.O feijoeiro comum (Phaseolus vulgaris L. é uma fabacea bastante difundida em todo território nacional. A baixa qualidade de suas sementes representa uma das principais causas de baixa produtividade nas lavouras de feijão no Brasil. O objetivo deste trabalho foi avaliar a qualidade fisiológica e sanitária de sementes de nove cultivares de feijão provenientes do Estado de Goiás. A qualidade fisiológica das sementes foi avaliada através dos testes de germinação e vigor, e a análise sanitária, através dos métodos de papel de filtro, para verificar a ocorrência de fungos em geral, e do método de Koch e Menten, para a avaliação de Sclerotinia sclerotiorum (Lib de Bary. As cultivares que tiveram os melhores desempenhos nos testes fisiológicos foram Xamego, BRS Radiante, Bambu e Pérola. As cultivares Jalo Precoce, Roxo 90, Corrente e Aporé apresentaram baixos índices de vigor e germinação de plântulas normais, além de apresentarem os maiores
Mishra, Prashant K; Tripathi, Jyoti; Gupta, Sumit; Variyar, Prasad S
2017-01-15
Volatile aroma compounds of three varieties of red kidney beans (Phaseolus vulgaris) namely Kashmiri red, Sharmili and Chitra were extracted in raw state using solid-phase microextraction (SPME) and cooked state using simultaneous distillation extraction (SDE). During cooking a significant (palcohols and terpene hydrocarbons while an increase in content of various sulfurous compounds, terpene alcohols, ketones and pyrazines was noted. Descriptive sensory analysis showed that the maximum intensity of 'kidney bean', 'earthy' and 'smoky' odour was observed in Kashmiri red while Sharmili variety was characterised by 'sulfurous' odour. Correlation of volatile profile data with descriptive sensory analysis and odour activity values clearly established the role of compounds, such as methanethiol, diethyl sulfide, dimethyl disulfide, methional and dimethyl trisulfide, in contributing to 'cooked kidney bean' aroma, while dimethyl sulfoxide, dimethyl sulfone and ethyl methyl sulfone were responsible for 'sulfurous' aroma. Copyright © 2016 Elsevier Ltd. All rights reserved.
Sánchez, Federico; Campos, Francisco; Padilla, Jaime; Bonneville, Jean-Marc; Enríquez, Consuelo; Caput, Daniel
1987-01-01
Nodule-specific uricase (uricase II) from Phaseolus vulgaris L. was purified to homogeneity by chromatographic methods. Purification data indicated that uricase II is approximately 2% of the total soluble protein from mature nodules. Specific antiserum was raised and used to determine the developmental expression and for immunoselection of polysomes. Uricase II was antigenically detected early in nodule development, 2 to 3 days before nitrogen fixation. Uricase-encoding cDNA clones were isolated by hybridizing a nodule-specific pUC9 cDNA library with labeled mRNA from immunoselected polysomes and a 35,000 molecular weight uricase II-encoding cDNA from soybean. An homologous clone (pNF-UR07) was used to assess the expression pattern of the specific transcript during development. Northern-blot analysis indicated that uricase II mRNA is exclusively expressed in nodule tissue. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:16665575
The bio-positive effects of diagnostic doses of X-rays on growth of phaseolus-vulgaris plant
Energy Technology Data Exchange (ETDEWEB)
Mortazavi, S.M.J.; Mehdipour, L.A.; Behnejad, B.B. [Rafsanjan Univ. of Medical Sciences (Iran, Islamic Republic of)
2006-07-01
Objective: Plants absorb radioactive elements from phosphate fertilizers, and also from naturally occurring radiation in the soil, air and water. It has long been known that low doses of ionizing radiation evoke stimulatory effects in a wide variety of living organisms. However, as far as we know, there is no published report on the bio-positive effects of diagnostic doses of X-rays on plant growth. The aim of this study was to evaluate the bio-effects of low doses of diagnostic X-rays on growth rate of Phaseolus vulgaris (Pinto) plants. Materials and Methods: Before cultivation, Phaseolus vulgaris (Pinto) seeds were soaked in tap water for 2 days followed by another 2 days of covering under a wet cloth. Four hundred newly cultivated seeds were randomly divided into two groups of 200 plants each. In this experiment, two seeds were cultivated in each dish (100 dishes for irradiation group and 100 for sham-irradiation group). Fifteen days after starting cultivation, newly grown plants were irradiated with X-rays. Plants were exposed to a single dose of X-ray (80 kVp, 80 mAs) for 6 days. On day 29, plants were pulled out from the ' soil. Length of plant stem, length of root, number of leaves and plant weight were measured. Results: The stem length in irradiated and sham-irradiated plants was 296.5{+-}13.57 and 223.96{+-}15.02 mm respectively. This difference was statistically significant (P<0.001). Although the number of leaves in irradiated plants was higher than that of sham-irradiated plants (7.05{+-}0.18 and 6.74{+-}0.19 respectively), the difference was not statistically significant. The stem diameter in irradiated and sham-irradiated plants were 3.52{+-}0.12 and 3.35{+-}0.09 mm respectively, but the difference again was not statistically significant (P<0.00 1). Plant weight in irradiated samples was less than that of non-irradiated plants but it was not statistically significant. Conclusions: The overall results indicate that diagnostic doses of X-rays can
Saad, A S A; Massoud, M A; Abdel-Megeed, A A M; Hamid, N A; Mourad, A K K; Barakat, A S T
2007-01-01
Field trails were conducted to determine the performance of three different sequences as a unique solution for the control of the leaf miner Liriomyza trifolii (Burgess) (Diptera: Agromyzidae) infesting garden beans (Phaseolus vulgaris L.) during the two successive seasons of 2004 and 2005. Furthermore, during the evaluation period, the side effect against the ectoparasite Diglyphus isaea (Walker) (Hymenoptera: Eulophidae) was put into consideration. Meanwhile, the comparative evaluation of the pesticides alone showed that abamectin and azadirachtin were highly effective against Liriomyza trifolii, while carbosulfan, pymetrozine and thiamethoxam provided to be of a moderate effect. Moreover, carbosulfan showed harmful effect to the larvae of the ectoparasite Diglyphus isaea (Walker), while abamectin and azadirachtin gave a moderate effect. Thiamethoxam and the the detergent (Masrol 410) had slight effect in this respect. The highly effective sequence among the sequences was abamectin, pymetrozine and azadirachtin, against Liriomyza trifolii (Burgess), with slight harmful effect on Diglyphus isaea (Walker). However the sequence of azadirachtin, pymetrozine and abamectin had a moderate effect on Liriomyza trifolii (Burgess) and exhibited a slight toxic effect on Diglyphus isaea (Walker). In contrast, the sequence of carbosulfan, thiamethoxam and pymetrozine was the least effective and represented a slight effect on Diglyphus isaea (Walker). From this study, it was concluded that abamectin, pymetrozine and azadirachtin sequence has proved to be a unique solution for the control of the leaf miner Liriomyza trifolii (Burgess) infesting garden beans (Phaseolus vulgaris L.) in Egypt.
Directory of Open Access Journals (Sweden)
Léa Luzia Freitas Costa
2002-06-01
Full Text Available Toxigenic fungi were studied in beans (Phaseolus vulgaris L. of Classes black and color, cultivated in different regions of the State of Santa Catarina, south region of Brazil. The mean counts of filamentous fungi were 2.8 x 103 and 6.7 x 103 CFU/g for beans Classes black and color, respectively. Penicillium spp., Aspergillus spp. and Phoma spp. were the most frequent genera isolated, followed by Ryzopus spp., Alternaria spp., Helminthosporium spp., Cladosporium spp., Botrytis spp., Fusarium spp., Trichoderma spp., Curvularia spp. and Dreschelera spp. Among beans Class black, 24.6% of the Aspergillus strains produced mycotoxins: 13.1% produced aflatoxins (AFs; 11.5% produced ochratoxin A (OTA and 28.9% of Penicillium produced citrinin (CTR. On the other hand, 22.1% of Aspergillus strains isolated from beans Class color produced mycotoxins (16.7% produced AFs and 5.4% produced OTA, while Penicillium genera had 35.4% of CTR producing strains. The toxigenic species were A. flavus, A. parasiticus, A. ochraceus and P. citrinum Thom.Foram estudados fungos toxigênicos em feijão (Phaseolus vulgaris L., classes preto e cores, cultivados em diferentes regiões do Estado de Santa Catarina, região Sul do Brasil. A média total de fungos filamentosos foi de 2,8x10³ e 6,7x10³ UFC/g para feijão classe preto e cores, respectivamente. Penicillium spp., Aspergillus spp. e Phoma spp. foram os gêneros mais frequentes isolados, seguidos por Ryzopus spp., Alternaria spp., Helminthosporium spp., Cladosporium spp., Botrytis spp., Fusarium spp., Trichoderma spp., Curvularia spp. e Dreschelera spp. No feijão classe preto, 24,6% das cepas de Aspergillus isolados eram toxigenicas: 13.1% eram produtoras de aflatoxinas (AFs e 11,5% de ocratoxina A (OTA; e 28,9% de Penicillium produziram citrinina (CTR. Por outro lado, 22,1% de cepas de Aspergillus isolados do feijão classe cores, produziram micotoxinas (16,7% produziram AF e 5,4% produziram OTA, já do g
Directory of Open Access Journals (Sweden)
Baudoin JP.
2005-01-01
Full Text Available Comparative study of genetic diversity and structure of wild Phaseolus lunatus L. populations using enzymatic and microsatellite markers. Genetic diversity within and among Phaseolus lunatus L. var. silvester populations from the central valley of Costa Rica was studied using enzymes and microsatellite markers. As expected, microsatellite markers showed more genetic diversity than enzymes markers. However, the relatively moderate genetic diversity displayed can be explained by restricted origin of samples to the central valley of Costa Rica or by the source of the primer. Total genetic diversity (HT and within population genetic diversity (HS were underestimated with enzyme markers. The contribution of among population genetic diversity (DST to total genetic diversity was similar for both markers. Enzymes and microsatellite markers pointed out a high inbreeding level for whole population (FIT and within population (FIS. Within population genetic diversity represents 70% for both genetic markers. So, Lima bean wild populations at the central valley of Costa Rica may constitute valid in situ conservation unit. Wild populations natural sites are submitted to an accelerate change of land use because of demographic pressure and agriculture intensification. It is necessary to conduct an ex situ conservation associated with an in situ conservation. Seeds from the most threatened populations should be collected for an ex situ conservation.
CINÉTICA DE FEIJÃO PRETO (PHASEOLUS VULGARIS, L. EM SECADOR DE BANDEJA
Directory of Open Access Journals (Sweden)
Deyzi Santos Gouveia
2011-03-01
Full Text Available O presente trabalho propôs estudar a cinética de feijão preto (Phaseolus vulgaris, l. em secador de bandeja a diferentes temperaturas do ar e posterior ajuste dos dados experimentais, obtidos com os diferentes modelos matemáticos ( Fick, Page e Cavalcante Mata. O teor de umidade inicial das sementes foi determinado pelo método padrão da estufa, 105 ± 3 °C, durante 72 h, com três repetições, de acordo com as regras do Instituto Adolfo Lutz (1985. Os tratamentos de secagem foram realizados em cinco níveis de temperaturas (40, 50, 60 ,70 e 80 ºC. Para cada tratamento de secagem foram utilizados em torno de 60 g de feijão por repetição. Para este fim utilizou-se um desidratador de frutas, Polidryer PD-25. O ar foi aquecido por meio de gás de cozinha, enquanto a temperatura foi controlada com o auxílio de um termopar, conectado ao secador. Os resultados mostraram que as equações propostas por Cavalcanti Mata e Page foram as que melhor representaram os dados experimentais, quando comparada com a equação de Fick utilizando um termo da série.
Directory of Open Access Journals (Sweden)
Marcia Ometto Mello
2001-09-01
Full Text Available Cell suspension cultures of Bauhinia forficata Link, Curcuma zedoaria Roscoe and Phaseolus vulgaris L. were used to test plant ability to utilize an alternative to sucrose as carbon source and energy for growth. Glycerol, sorbitol and galactose were the alternative carbon sources tested. Cell suspension cultures established on liquid medium containing sucrose were transferred to culture medium supplemented with sucrose or glycerol, or sorbitol, or galactose as the sole carbon source. Fresh and dry weight increasing and protein content showed marked differences among the different carbon sources used. Sucrose was the best carbon source for all the three plant species tested. Galactose and glycerol promoted slow or no growth of the three studied species. Sucrose in liquid medium promoted initiation of meristemoid formation. Sorbitol, which was ineffective on promoting significant growth, was the only alternative carbon source tested that also promoted this effect.Culturas de células em suspensão de Bauhinia forficata Link, Curcuma zedoaria Roscoe e Phaseolus vulgaris L. foram usadas para avaliar a eficiência de fontes alternativas de carbono e energia. Glicerol, sorbitol e galactose foram as fontes alternativas estudadas. As culturas de células estabelecidas em meio líquido contendo sacarose foram transferidas para meios de cultura suplementados com sacarose ou glicerol ou sorbitol ou galactose. A fonte de carbono afetou distintamente os ganhos de matéria fresca, matéria seca e o acúmulo de proteína. A sacarose foi a melhor fonte de carbono para as três espécies estudadas. Galactose e glicerol promoveram pequeno crescimento das três espécies estudadas. A sacarose utilizada como fonte de carbono no meio líquido, promoveu o início de organização celular conhecido como a formação de meristemóides. Sorbitol, que não promoveu crescimento significativo, foi a única fonte alternativa de carbono testada que também promoveu este
Energy Technology Data Exchange (ETDEWEB)
Marteleto, Patricia B. [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Inst. de Genetica e Bioquimica. Programa de Pos-Graduacao], e-mail: patriciamarteleto@gmail.com; Lomonaco, Cecilia [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Inst. de Biologia], e-mail: lomonaco@ufu.br; Kerr, Warwick E. [Universidade Federal de Uberlandia (UFU), Umuarama, Uberlandia, MG (Brazil). Dept. de Ciencias Agronomicas], e-mail: kerr@ufu.br
2009-03-15
This study was developed aiming to verify physiological, morphological and behavioral responses of two different Zabrotes subfasciatus (Boheman) populations to different beans varieties (Phaseolus vulgaris) (Fabaceae). Female longevity, fertility and oviposition preference site, as well as size and levels of fluctuating asymmetry for males and females were described. Zabrotes subfasciatus displayed physiological plasticity in response to the diet, which was considered an important adaptive ability to maintain the insect generalist habit for food consumption and oviposition sites. The populations studied had different responses to the same treatments, indicating genetic, physiological and behavioral variation on their plastic potential. The Hopkins' principle, which determines the influence of previous female experience in the choice of oviposition sites, was not confirmed. The occurrence of fluctuating asymmetry in males and females was variable, probably as a consequence of genomic factors determining this trait. (author)
Directory of Open Access Journals (Sweden)
Aihua Wang
2012-09-01
Full Text Available In this study, 13 polymorphic microsatellite markers were isolated from the Phaseolus vulgaris L. (common bean by using the Fast Isolation by AFLP of Sequence COntaining Repeats (FIASCO protocol. These markers revealed two to seven alleles, with an average of 3.64 alleles per locus. The polymorphic information content (PIC values ranged from 0.055 to 0.721 over 13 loci, with a mean value of 0.492, and 7 loci having PIC greater than 0.5. The expected heterozygosity (HE and observed heterozygosity (HO levels ranged from 0.057 to 0.814 and from 0.026 to 0.531, respectively. Cross-species amplification of the 13 prime pairs was performed in its related specie of Vigna unguiculata L. Seven out of all these markers showed cross-species transferability. These markers will be useful for future genetic diversity and population genetics studies for this agricultural specie and its related species.
Canakçi, S
2003-01-01
The effects of 100, 250, and 500 ppm acetylsalicylic acid solutions treatments on weight alteration, pigment and protein amounts in discs from the primary leaves of one month old bean (Phaseolus vulgaris L.) seedlings produced tinder greenhouse conditions are presented. The experiments show that: 100 ppm ASA had no significant influence (P > 0.05) but 250 and 500 ppm ASA caused an increase on weight loss (P 0.05), none of the ASA treatments caused a statistically significant influence on carotenoid amount (P > 0.05); 100 and 250 ppm ASA treatments did not cause a significant influence on protein amount (P > 0.05). however 500 ppm ASA treatment caused an increase on protein injury (P < 0.05). Consequently, it is supposed that wet weight loss, pigment and protein injury have somewhat increased on leaf discs. depending on the toxic effect of high acetylsalicylic acid concentrations.
Directory of Open Access Journals (Sweden)
ümit girgel
2018-01-01
Full Text Available Özet Bu araştırma, organik şartlarda fasulye (Phaseolus vulgaris L. yerel genotiplerinin morfolojik ve agronomik özelliklerini belirlemek amacıyla, Bayburt Üniversitesi, Gıda Tarım ve Hayvancılık Uygulama ve Araştırma Merkezi deneme alanında 2016 yetiştirme döneminde yürütülmüştür. Araştırmada 13 yerel fasulye genotipi ile 3 tescilli çeşit (Önceler-98, Horoz ve Dermason kullanılmıştır. Tesadüf Bloklarında Bölünmüş Parseller deneme desenine göre üç tekerrürlü olarak yürütülen çalışmada dekara 10 ton olacak şekilde çiftlik gübresi uygulanmıştır. Araştırmada, bitki boyu 32.1-44.3 cm, ilk bakla yüksekliği 6.7-11.1 cm, gövde kalınlığı 5.6-8.4 cm, bakla boyu 85.9-120.7 mm, bakla eni 12.5-15.4 mm, bitkide bakla sayısı 10.0-24.1 adet/bitki, baklada tane sayısı 3.5-5.5 adet/bakla, 1000 tane ağırlığı 393.7-545.5 g, dekara tane verimi 128.3-194.3 kg/da arasında değişim göstermiştir. En yüksek tane verimi dermason fasulye çeşidinden elde edilmiş olup, yine Önceler-98 çeşidi ve Aydıntepe genotipinin tane verimi ve bölgeye adaptasyonu yüksek bulunuştur. Anahtar Kelimeler: Phaseolus vulgaris L., Genotip, Verim, Verim Öğeleri, Organik Tarım A Research on Determination of the Morphological and Agronomic Characteristics of Local Beans (Phaseolus vulgaris L. Genotypes Under the Organic Farming System in Bayburt Abstract This study was carried out Bayburt University Food and Agriculture and Livestock Application and Research Center in 2016 growing season to determine the morphological and agronomic characteristics of local genotypes of beans (Phaseolus vulgaris L. under organic farming conditions. In the study, 13 local bean genotypes and 3 registered varieties (Önceler-98, Horoz and Dermason were used. The experiment was carried out to the randomized complete block design with three replications. By using cow manure, the area was fertilized with 10 tons per decares. In the
Energy Technology Data Exchange (ETDEWEB)
Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel [Universidade Militar Nueva Granada, Bogota (Colombia). Facutad de Ciencias. Programa de Biologia Aplicada], e-mail: fernando.cantor@unimilitar.edu.co
2009-09-15
A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm{sup 2} of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)
Regional localization of suspensor mRNAs during early embryo development.
Weterings, K; Apuya, N R; Bi, Y; Fischer, R L; Harada, J J; Goldberg, R B
2001-11-01
We investigated gene activity within the giant embryos of the scarlet runner bean (Phaseolus coccineus) to gain understanding of the processes by which the apical and basal cells become specified to follow different developmental pathways after division of the zygote. We identified two mRNAs, designated G564 and C541, that accumulate specifically within the suspensor of globular-stage embryos. G564 mRNA accumulates uniformly throughout the suspensor, whereas C541 mRNA accumulates to a higher level within the large basal cells of the suspensor that anchor the embryo to the surrounding seed tissue. Both G564 and C541 mRNAs begin to accumulate shortly after fertilization and are present within the two basal cells of embryos at the four-cell stage. In contrast, at the same stage, these mRNAs are not detectable within the two descendants of the apical cell. Nor are they detectable within cells of the embryo sac before fertilization, including the egg cell. We used a G564/beta-glucuronidase reporter gene to show that the G564 promoter is activated specifically within the basal region and suspensor of preglobular tobacco embryos. Analysis of the G564 promoter identified a sequence domain required for transcription within the suspensor that contains several copies of a conserved motif. These results show that derivatives of the apical and basal cells transcribe different genes as early as the four-cell stage of embryo development and suggest that the apical and basal cells are specified at the molecular level after division of the zygote.
Regional Localization of Suspensor mRNAs during Early Embryo Development
Weterings, Koen; Apuya, Nestor R.; Bi, Yuping; Fischer, Robert L.; Harada, John J.; Goldberg, Robert B.
2001-01-01
We investigated gene activity within the giant embryos of the scarlet runner bean (Phaseolus coccineus) to gain understanding of the processes by which the apical and basal cells become specified to follow different developmental pathways after division of the zygote. We identified two mRNAs, designated G564 and C541, that accumulate specifically within the suspensor of globular-stage embryos. G564 mRNA accumulates uniformly throughout the suspensor, whereas C541 mRNA accumulates to a higher level within the large basal cells of the suspensor that anchor the embryo to the surrounding seed tissue. Both G564 and C541 mRNAs begin to accumulate shortly after fertilization and are present within the two basal cells of embryos at the four-cell stage. In contrast, at the same stage, these mRNAs are not detectable within the two descendants of the apical cell. Nor are they detectable within cells of the embryo sac before fertilization, including the egg cell. We used a G564/β-glucuronidase reporter gene to show that the G564 promoter is activated specifically within the basal region and suspensor of preglobular tobacco embryos. Analysis of the G564 promoter identified a sequence domain required for transcription within the suspensor that contains several copies of a conserved motif. These results show that derivatives of the apical and basal cells transcribe different genes as early as the four-cell stage of embryo development and suggest that the apical and basal cells are specified at the molecular level after division of the zygote. PMID:11701878
Directory of Open Access Journals (Sweden)
Diego Rodríguez-Ortega
2018-01-01
Full Text Available Anthracnose caused by Colletotrichum lindemuthianum is one of the most economically important diseases of bean (Phaseolus vulgaris L. cultivation in Ecuador. The best control alternative is the use of resistant varieties. C. lindemuthianum presents great pathogenic variability, which hinders the development of varieties with a lasting resistance, therefore, the knowledge of the presence and distribution of the physiological races of the pathogen and the identification of resistance genes are key to developing varieties with broad and lasting resistance. The objective of this research was to determine the pathogenic variability of C. lindemuthianum and to evaluate the resistance of Ecuadorian bean germplasm. The research was carried out between 2013 and 2014. Seventeen isolates of C. lindemuthianum from northern central Ecuador were characterized by the inoculation of a group of twelve standard differential bean varieties. Among the analyzed samples, thirteen races were identified; five of those races had not been previously reported in the country. The differential G2333 (Co-42, Co-52 and Co-7 presented resistance to every characterized races in Ecuador. In addition, twenty - one improved varieties and elite bean lines were evaluated with sixteen of the seventeen isolates, three genotypes were identified (TB2, TB3 and INIAP 485 Urcuquí with resistance to the mentioned isolates, which can be used as sources of resistance to Anthracnose. The identified sources of resistance in this study will allow to plan the development of bean varieties with broad and durable resistance to C. lindemuthianum.
Incorporation of 14CO2 by illuminated intact leaves of bean (PHASEOLUS VULGARIS) plants
International Nuclear Information System (INIS)
Andrade, A.G. de
1980-01-01
Bean plants were grown in hydroponic nutrient solution, maintained in controlled environment. Measurements of the photosynthetic activity using the method of 14 CO 2 incorporation in intact leaves with portable equipment were made on the central leaflet of the first trifoliate leaf except when the effect of leaf age was studied in which case all central leaflets of the same branch were used. The data obtained indicated differences in the photosynthetic efficiency of bean (Phaseolus vulgaris) cultivars. Relative differences in RuDP carboxylase activity in the crude extracts of leaves, leaf area and leaf chlorophyll content were also observed. Rates of 14 CO 2 incorporation at saturating light varied from 14.94 to 22.96 mg CO 2 .dm -2 .h and the 6 studied cultivars could be divided into two classes: Classe 1 (above 20 mg CO 2 .dm -2 .h): Pirata-1, Rosinha G-2, and Pintadinho Precoce; Classe 2 (below 20 mg CO 2 .dm - 2 .h): Carioca, Rosinha Precoce and Pintado. Plants of the same cultivar showed a relatively high variability and a strong dependence in relation to environmental conditions. Differences among cultivars in relation to RuDP carboxylase activity, leaf area and leaf age were correlated to photosynthetic rate. (Author) [pt
Diversification and Population Structure in Common Beans (Phaseolus vulgaris L.)
Blair, Matthew W.; Soler, Alvaro; Cortés, Andrés J.
2012-01-01
Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13) for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican), Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru). The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of cultivated beans
Diversification and population structure in common beans (Phaseolus vulgaris L..
Directory of Open Access Journals (Sweden)
Matthew W Blair
Full Text Available Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13 for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican, Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru. The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of
Dissecting Phaseolus vulgaris innate immune system against Colletotrichum lindemuthianum infection.
Directory of Open Access Journals (Sweden)
Paula Rodrigues Oblessuc
Full Text Available BACKGROUND: The genus Colletotrichum is one of the most economically important plant pathogens, causing anthracnose on a wide range of crops including common beans (Phaseolus vulgaris L.. Crop yield can be dramatically decreased depending on the plant cultivar used and the environmental conditions. This study aimed to identify potential genetic components of the bean immune system to provide environmentally friendly control measures against this fungus. METHODOLOGY AND PRINCIPAL FINDINGS: As the common bean is not amenable to reverse genetics to explore functionality and its genome is not fully curated, we used putative Arabidopsis orthologs of bean expressed sequence tag (EST to perform bioinformatic analysis and experimental validation of gene expression to identify common bean genes regulated during the incompatible interaction with C. lindemuthianum. Similar to model pathosystems, Gene Ontology (GO analysis indicated that hormone biosynthesis and signaling in common beans seem to be modulated by fungus infection. For instance, cytokinin and ethylene responses were up-regulated and jasmonic acid, gibberellin, and abscisic acid responses were down-regulated, indicating that these hormones may play a central role in this pathosystem. Importantly, we have identified putative bean gene orthologs of Arabidopsis genes involved in the plant immune system. Based on experimental validation of gene expression, we propose that hypersensitive reaction as part of effector-triggered immunity may operate, at least in part, by down-regulating genes, such as FLS2-like and MKK5-like, putative orthologs of the Arabidopsis genes involved in pathogen perception and downstream signaling. CONCLUSIONS/SIGNIFICANCE: We have identified specific bean genes and uncovered metabolic processes and pathways that may be involved in the immune response against pathogens. Our transcriptome database is a rich resource for mining novel defense-related genes, which enabled us to
Energy Technology Data Exchange (ETDEWEB)
Sharkey, T D
1985-01-01
Steady-state room temperature variable fluorescence from leaves was measured as a function of CO/sub 2/ pressure in Xanthium strumarium L. and Phaseolus vulgaris L. Measurements were made in a range of light intensities, at normal and low O/sub 2/ partial pressure and over a range of temperatures. At low CO/sub 2/ pressure fluorescence increased with increasing CO/sub 2/. At higher CO/sub 2/ pressure fluorescence usually decreased with increasing CO/sub 2/ but occasionally increased slightly. The transition CO/sub 2/ pressure between the responses could be changed by changing light, O/sub 2/ pressure, or temperature. This breakpoint in the fluorescence-CO/sub 2/ curve was a reliable indicator of the transition between ribulose 1,5-bisphosphate (RuBP) saturated assimilation and RuBP regeneration limited assimilation. The fluorescence signal was not a reliable indicator of O/sub 2/-insensitive assimilation in these C/sub 3/ species. 21 references, 8 figures.
Hassan, Mahmoud O; Saleh, Ahmed M; AbdElgawad, Hamada
2018-03-07
This study was conducted to evaluate the use of the phenolic-rich Sonchus oleraceus residue as an environmentally safe approach to induce the nutritive and health-promoting values of common bean ( Phaseolus vulgaris L. cv. Bronco). S. oleraceus shoot residue, at rates of 150 and 300 g m -2 , has improved soil fertility via accumulation of soil macronutrients, organic matter, organic carbon, and total phenolics. The growth and yield of bean were significantly increased. Moreover, chemical composition of the treated seeds was significantly altered, whereas higher levels of total antioxidant capacity, proteins, carbohydrates, and most of the individual phenolic acids, flavonoids, vitamins, essential amino acids, and unsaturated fatty acids were recorded. Interestingly, a concentration dependent effect was also observed, for instance, a lower saturated-to-unsaturated fatty acid ratio was only observed in the case of the lower residue rate. These findings recommend the use of S. oleraceus in organic farming of bean to enhance the health benefits of the produced seeds.
International Nuclear Information System (INIS)
Morales, L.; Gutierrez, N.; Maya, V.; Parra, C.; Martinez B, E.; Coello, P.
2012-01-01
Two phosphatase isoforms from roots of the common bean (Phaseolus vulgaris L.) showed an increase in activity in response to phosphate deficiency. One of them (APIII) was chosen for further purification through ionic exchange chromatography and preparative electrophoresis. The estimated molecular mass of APIII was 35 kDa by both SDS-Page and gel filtration analyses, suggesting a monomeric form of the active enzyme. The phosphatase was classified as an alkaline phosphatase based on the requirement of ph 8 for optimum catalysis. It not only exhibited broad substrate specificity, with the most activity against pyrophosphate, but also effectively catalyzed the hydrolysis of polyphosphate, glucose-1-phosphate and phospho enol-pyruvate. Activity was completely inhibited by molybdate, vanadate and phosphate but was only partially inhibited by fluoride. Although divalent cations were not essential for the pyro phosphatase activity of this enzyme, the hydrolysis of pyro phosphatase increased substantially in the presence of Mg 2+ .
International Nuclear Information System (INIS)
Tulmann Neto, A.
1979-09-01
Experiments were carried out with the objective of selecting, evaluation and using induced mutants of Phaseolus vulgaris L. resistant or tolerant to golden mosaic - a virus disease of beans. Seeds from three bean cultivars were treated with gamma-ray or the chemical mutagen ethyl methanesulphonate (EMS). After golden mosaic inoculation of 50,000 M 2 seedlings, in a insectary, screening was made and a tolerant mutant (TMD-1) was selected. Evaluation of TMD-1 was carried out by comparing it with the parent cultivar Carioca, indicating that, although showing lower productivity than the original material, (what prevented it from being used directly on a commercial basis), it maintained the same reaction to rust, bacterial blight, and common mosaic. Studies on the genetic basis of the mutation were also done. The possibility of using this mutant in a plant breeding programme aimed at obtaining resistance to golden mosaic was demonstrated in crosses between TMD-1 and two cultivars, to which transference of tolerance was possible. (Author) [pt
Energy Technology Data Exchange (ETDEWEB)
Morales, L.; Gutierrez, N.; Maya, V.; Parra, C.; Martinez B, E.; Coello, P., E-mail: pcoello@servidor.unam.mx [UNAM, Facultad de Quimica, Departamento de Bioquimica, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)
2012-07-01
Two phosphatase isoforms from roots of the common bean (Phaseolus vulgaris L.) showed an increase in activity in response to phosphate deficiency. One of them (APIII) was chosen for further purification through ionic exchange chromatography and preparative electrophoresis. The estimated molecular mass of APIII was 35 kDa by both SDS-Page and gel filtration analyses, suggesting a monomeric form of the active enzyme. The phosphatase was classified as an alkaline phosphatase based on the requirement of ph 8 for optimum catalysis. It not only exhibited broad substrate specificity, with the most activity against pyrophosphate, but also effectively catalyzed the hydrolysis of polyphosphate, glucose-1-phosphate and phospho enol-pyruvate. Activity was completely inhibited by molybdate, vanadate and phosphate but was only partially inhibited by fluoride. Although divalent cations were not essential for the pyro phosphatase activity of this enzyme, the hydrolysis of pyro phosphatase increased substantially in the presence of Mg{sup 2+}.
Bartoli, Carlos G; Tambussi, Eduardo A; Diego, Fanello; Foyer, Christine H
2009-01-05
The effects of red/far red (R/FR) ratios on leaf ascorbate (AA) and glutathione (GSH) accumulation were examined in common bean (Phaseolus vulgaris L.). Growth under low R/FR ratios resulted in a "shade" phenotype and much lower leaf AA and GSH contents than high (R/FR) ratios. Photosynthesis rates were unaffected by changes in the R/FR ratio but leaf respiration rates, pyridine nucleotide pools and antioxidant enzyme activities were decreased under the low R/FR regime. The GSH pool changed slowly in response to altered R/FR ratios but leaf ascorbate acclimated over a single photoperiod. We conclude that light quality signals, particularly R/FR ratios, are important regulators of antioxidant synthesis and accumulation. These acclimatory changes are an early response to changing light environment.
Directory of Open Access Journals (Sweden)
Aragão F.J.L.
1999-01-01
Full Text Available Bean (Phaseolus vulgaris, an important component in the diet of people in developing countries, has low levels of the essential amino acid, methionine. We have attempted to correct this deficiency by introducing a transgene coding for a methionine-rich storage albumin from the Brazil nut via biolistic methods. The transgene's coding sequence was driven by a doubled 35S CaMV promoter and AMV enhancer sequences. The transgene was stable and correctly expressed in homozygous R2 to R5 seeds. In two of the five transgenic lines the methionine content was significantly increased (14 and 23% over the values found in untransformed plants.
KARAKTERISASI ENAM VARIETAS BUNCIS (Phaseolus vulgaris L. BERDASARKAN PANDUAN PENGUJIAN INDIVIDUAL
Directory of Open Access Journals (Sweden)
Vina Eka Aristya
2016-02-01
Full Text Available Beans (Phaseolus vulgaris L. is a plant that has the potential for mainstream consumers, have a large enough market opportunity and a source of vegetable protein. “Perancis” varieties are local Central Java bean varieties are widely grown in the Bandungan area. “Perancis” varieties not currently provide enough characters clear and complete. Test objectives were (1 to characterize the “Perancis” varieties in order to have a complete character information varieties and (2 to determine distinctness, uniformity and stability of the “Perancis” varieties compared with varieties Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072 using guidelines for the conduct of test for distinctness, uniformity and stability reference beans. Implemented on the Garden Seed Testing Bandungan Horticulture, Central Java with an altitude of 560-800 meters above sea level the place. Materials testing consists of six varieties of beans are “Perancis” varieties and the varieties used for comparison Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072. This research used a randomized block design six varieties of beans are planted side by side on three experimental plots as replications. Parameters observed include 49 characters corresponding guidelines bean plants are divided into the plant character, leaves character, flower character, pods character and seed character. Test results based guidelines, “Perancis” varieties showed eight unique characters compared to varieties of Gypsie, Spectacular, Balitsa 1, Balitsa 2 and PV 072 ie. plant height, leaf color, leaf rugosity, long (including beak pods, the degree of the pods curvature, the shape of distal part (excluding beak pods, length of beak pods and curvature of beak pods and “Perancis” varieties have uniformity and stability.
Directory of Open Access Journals (Sweden)
F. Broetto
1995-04-01
Full Text Available Uma das aplicações das técnicas da cultura de tecidos no melhoramento é a identificação de linhas de células que apresentam tolerância à salinidade. Vários autores obtiveram linhas de células tolerantes ao estresse salino; e estudo de mecanismos bioquímicos da tolerância a sais em plantas tem demonstrado altas correlações entre estes e o acúmulo de macromoléculas em tecido de plantas superiores. Para verificar essas correlações em feijão (Phaseolus vulgaris cv IAC carioca, calos oriundos de eixos embrionários foram cultivados em meio sólido, suplementado com NaCl nas concentrações de 0 a 60 mM. Após 13 dias de incubação, os calos foram coletados e analisados quanto ao crescimento relativo, teor de proteínas, teor de prolina e atividade da peroxidase. Os parâmetros analisados mostraram decréscimo no crescimento relativo e no de proteínas em resposta ao NaCl. Paralelamente, observou-se aumento significativo no conteúdo de prolina e atividade da enzima peroxidase.One of the applications of the tissue culture technique in plant improvement is the identification of cell lines which show salinity tolerance. Several authors were able to obtain saline stress-tolerant cell lines and show that mechanisms of tolerance to salts have a strong correlation between this phenomenon and a high macromolecule concentration in plant tissues. Callus obtained from embrionic axis of Phaseolus vulgarís cv. IAC carioca in solid medium, supplemented with 0 to 60 mM NaCl, as the salt treatment, were used. Callus harvesting was done on the 13th day, when they were processed for relative growth, protein, proline content and peroxidase acivity. The results show both, a decrease of the relative growth and of protein content in response to the NaCl treatment, as compared to controls. However, there was a significant increase on the proline content and on the peroxidase activity.
Anatomical alterations of Phaseolus vulgaris L. mature leaves irradiated with X-rays.
De Micco, V; Arena, C; Aronne, G
2014-01-01
The cultivation of higher plants in Space involves not only the development of new agro-technologies for the design of ecologically closed Space greenhouses, but also understanding of the effects of Space factors on biological systems. Among Space factors, ionising radiation is one of the main constraints to the growth of organisms. In this paper, we analyse the effect of low-LET radiation on leaf histology and cytology in Phaseolus vulgaris L. plants subjected to increasing doses of X-rays (0.3, 10, 50, 100 Gy). Leaves irradiated at tissue maturity were compared with not-irradiated controls. Semi-thin sections of leaves were analysed through light and epi-fluorescence microscopy. Digital image analysis was applied to quantify anatomical parameters, with a specific focus on the occurrence of signs of structural damage as well as alterations at subcellular level, such as the accumulation of phenolic compounds and chloroplast size. Results showed that even at high levels of radiation, general anatomical structure was not severely perturbed. Slight changes in mesophyll density and cell enlargement were detected at the highest level of radiation. However, at 100 Gy, higher levels of phenolic compounds accumulated along chloroplast membranes: this accompanied an increase in number of chloroplasts. The reduced content of chlorophylls at high levels of radiation was associated with reduced size of the chloroplasts. All data are discussed in terms of the possible role of cellular modifications in the maintenance of high radioresistance and photosynthetic efficiency. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.
Genome-Wide Association Study of Anthracnose Resistance in Andean Beans (Phaseolus vulgaris).
Zuiderveen, Grady H; Padder, Bilal A; Kamfwa, Kelvin; Song, Qijian; Kelly, James D
2016-01-01
Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L.) caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans comprised of multiple seed types and market classes from the Americas, Africa, and Europe, and explore the genetic basis of this resistance using genome-wide association mapping analysis (GWAS). Twenty-eight of the 230 lines tested were resistant to six out of the eight races screened, but only one cultivar Uyole98 was resistant to all eight races (7, 39, 55, 65, 73, 109, 2047, and 3481) included in the study. Outputs from the GWAS indicated major quantitative trait loci (QTL) for resistance on chromosomes, Pv01, Pv02, and Pv04 and two minor QTL on Pv10 and Pv11. Candidate genes associated with the significant SNPs were detected on all five chromosomes. An independent QTL study was conducted to confirm the physical location of the Co-1 locus identified on Pv01 in an F4:6 recombinant inbred line (RIL) population. Resistance was determined to be conditioned by the single dominant gene Co-1 that mapped between 50.16 and 50.30 Mb on Pv01, and an InDel marker (NDSU_IND_1_50.2219) tightly linked to the gene was developed. The information reported will provide breeders with new and diverse sources of resistance and genomic regions to target in the development of anthracnose resistance in Andean beans.
Genome-Wide Association Study of Anthracnose Resistance in Andean Beans (Phaseolus vulgaris.
Directory of Open Access Journals (Sweden)
Grady H Zuiderveen
Full Text Available Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L. caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans comprised of multiple seed types and market classes from the Americas, Africa, and Europe, and explore the genetic basis of this resistance using genome-wide association mapping analysis (GWAS. Twenty-eight of the 230 lines tested were resistant to six out of the eight races screened, but only one cultivar Uyole98 was resistant to all eight races (7, 39, 55, 65, 73, 109, 2047, and 3481 included in the study. Outputs from the GWAS indicated major quantitative trait loci (QTL for resistance on chromosomes, Pv01, Pv02, and Pv04 and two minor QTL on Pv10 and Pv11. Candidate genes associated with the significant SNPs were detected on all five chromosomes. An independent QTL study was conducted to confirm the physical location of the Co-1 locus identified on Pv01 in an F4:6 recombinant inbred line (RIL population. Resistance was determined to be conditioned by the single dominant gene Co-1 that mapped between 50.16 and 50.30 Mb on Pv01, and an InDel marker (NDSU_IND_1_50.2219 tightly linked to the gene was developed. The information reported will provide breeders with new and diverse sources of resistance and genomic regions to target in the development of anthracnose resistance in Andean beans.
The fate of urea applied to tropical bean (Phaseolus vulgaris, L.) crops
International Nuclear Information System (INIS)
Cervellini, A.; Libardi, P.L.; Victoria, R.L.; Reichardt, K.
The fate of nitrogen is studied when it is applied to three bean (Phaseolus vulgaris, L.) crops variety 'carioca' grown on a site of 'Terra Roxa Estruturada' (Paleudalf) soil. Urea labeled with three different 15 N enrichment percentages was used in order to estimate crop recovery of N (and its utilization efficiency), residual effects of N from one crop to another, distribution of N in the soil profile after cropping and leaching losses of N. The superphosphate and the rockphosphate 'Araxa' were also used. Grain yield was not significantly different between the phosphorus treatments, indicating that both P sources behaved similarly. Differences in fertilizer 15 N enrichment did not affect calculated amounts of nitrogen derived from fertilizer and N utilization efficiency (NUE), as expected. The first crop recovered on the average 31,2% of the N from the applied urea. The second crop recovered 6,2% N from the fertilizer applied to the first crop. The third crop recovered only 1,4%. Taking in account the NUE for the three crops, they recovered 44,1% of the N applied to the first crop. The partition of nitrogen applied to the first crop in four components (crop N removal; soil mineral N (NO 3 + NH 4 ); soil organic N and leaching N) is analysed. Due to the low N utilization efficiency of the crop, much of N remains in the soil profile, being potentially available for leaching and so contributing for fertilizer pollution of ground water. (M.A.) [pt
Directory of Open Access Journals (Sweden)
Navnita Sharma
2016-01-01
Full Text Available The present investigation aimed to quantify the difference in response of two Phaseolus mungo L. cultivars (i.e., UH-1 and IPU-94-1 to Glomus mosseae (G, that is, Funneliformis mosseae, Acaulospora laevis (A, and Trichoderma viride (T, in different combinations or alone. All the treatments were inoculated with Bradyrhizobium japonicum to ensure nodulation as soil used in the experiment was sterilized. After 120 days of inoculation, plants were analyzed for chlorophyll content, nodulation, mycorrhization, leaf area, and protein content. Results indicate variation in growth response of two cultivars with different treatments. Triple inoculation of plants with G + A + T proved to be the best treatment for growth followed by G + T in both cultivars. Our work allowed the selection of P. mungo L. cultivar UH-1 as highly mycorrhizal responsive as compared to IPU-94-1 and G. mosseae to be an efficient bioinoculant as compared to A. laevis for growth enhancement of P. mungo. Further characterization of P. mungo genotypes will enhance our knowledge of physiological and genetic mechanism behind increase in plant growth and yield due to AM symbiosis.
International Nuclear Information System (INIS)
Tulmann Neto, A.; Ando, A.; Costa, A.S.
1977-01-01
The golden mosaic of dry beans (Phaseolus vulgaris L.) that is present in the tropical parts of the American continent has become a major hindrance for the cultivation of this food legume of great importance to many Latin America countries. Good control measures are not known and bean germ plasm resistant or tolerant to this virus disease is not yet available. Attempts to induce bean mutants with this desirable characteristic were made using gamma radiation and chemical mutagen. Some M 2 plants from one progeny of the cultivar Carioca treated with 0.48% ethyl methane sulphonate (EMS), 6 hours of treatment at 20 0 C, showed milder symptoms than the control progenies, and at the same time they showed a tendency to recover. This mutant is being tested under field conditions and used in crosses with other bean types that show a certain degree of tolerance, aiming at adding the favourable characters of both parents. Seeds of the hybrids, as well as those of the parent types, are also being further submitted to mutagenic treatments in order to obtain still better mutants that will be satisfactory for direct or indirect control of bean golden mosaic. (author)
Directory of Open Access Journals (Sweden)
Matthew G. Nosworthy
2018-05-01
Full Text Available In this work, the protein quality of different bean types after undergoing the preparatory methods of baking, cooking and extrusion was assayed. Protein quality was assessed using a rodent bioassay to evaluate growth and protein digestibility while amino acid composition was determined via HPLC. In vivo protein digestibility was compared to an in vitro assessment method. The average protein digestibility corrected amino acid score (PDCAAS for processed beans was higher than the digestible indispensable amino acid score (DIAAS (61% vs. 45%. Extrusion/cooking of Phaseolus varieties resulted in higher PDCAAS (66% on average and DIAAS values (61% on average than baked (52% and 48% while baked faba beans had higher PDCAAS (66% and DIAAS (61% values. A significant correlation was found between PDCAAS and in vitro PDCAAS (R2 = 0.7497. This demonstrates which bean processing method will generate the optimal protein quality, which has benefits for both industrial production and individual domestic preparation.
Directory of Open Access Journals (Sweden)
Mukthar Sandovai-Peraza
2014-12-01
Full Text Available Recent studies have shown the beneficial effect of peptides, an unexploited source could be Phaseolus lunatus being an important raw material for those functional products in order to improve their utilization. In addition to improve the beneficial effect of bioactive peptides the microencapsulation could be a way to protect the peptides against the environment to which they are exposed. P. lunatus protein fraction (<10 kDa of weight was encapsulated using a blend of carboxymethylated flamboyant gum (CFG and sodium alginate (SA at different concentrations of CaCl2 and hardening times. After in vitro digestion of microcapsules the residual activity, in the intestinal system, both inhibition of agiotensin-converting enzyme (I-ACE and antioxidant activity obtained were in a range of 0.019-0.136 mg/mL and 570.64-813.54 mM of TEAC respectively. The microencapsulation employed CFG/SA blends could be used controlled delivery of peptide fractions with potential use as a nutraceutical or therapeutic agents.
International Nuclear Information System (INIS)
Marteleto, Patricia B.; Lomonaco, Cecilia; Kerr, Warwick E.
2009-01-01
This study was developed aiming to verify physiological, morphological and behavioral responses of two different Zabrotes subfasciatus (Boheman) populations to different beans varieties (Phaseolus vulgaris) (Fabaceae). Female longevity, fertility and oviposition preference site, as well as size and levels of fluctuating asymmetry for males and females were described. Zabrotes subfasciatus displayed physiological plasticity in response to the diet, which was considered an important adaptive ability to maintain the insect generalist habit for food consumption and oviposition sites. The populations studied had different responses to the same treatments, indicating genetic, physiological and behavioral variation on their plastic potential. The Hopkins' principle, which determines the influence of previous female experience in the choice of oviposition sites, was not confirmed. The occurrence of fluctuating asymmetry in males and females was variable, probably as a consequence of genomic factors determining this trait. (author)
Carbon partitioning among leaves, fruits, and seeds during development of Phaseolus vulgaris L
International Nuclear Information System (INIS)
Geiger, D.R.; Shieh, Wenjang; Saluke, R.M.
1989-01-01
Development of vegetative and floral buds was found to be a key factor in establishing the way carbon is distributed among growing leaves and fruits in Phaseolus vulgaris L. plants. Leaves emerged principally during a period 14 to 32 days after planting while flowers were produced during a 10- to 12-day period near the end of leaf emergence. Timing of anthesis established the sigmoidal time course for dry weight accumulated by the composite of all fruits on the plant. During the first 12 days following anthesis, fruit growth mainly consisted of elongation and dry weight accumulation by the pod wall. Thereafter, seed dry weight increased for about 1 week, decreased markedly for several days, and then increased again over the next 2 weeks. Accumulation of imported carbon in individual seeds, measured by steady-state labeling, confirmed the time course for dry weight accumulation observed during seed development. Seed respiration rate initially increased rapidly along with dry weight and then remained nearly steady until seed maturation. A number of developmental events described in the literature coincided with the different phases of diauxic growth. The results demonstrated the feasibility of relating current rates of carbon import in individual seeds measured with tracer 14 C to the rates of conversion of imported sucrose and use of the products for specific developmental processes. The resulting data are useful for evaluating the roles of conversion and utilization of imported sucrose in regulating import by developing seeds
Study on mutation induced effect of gamma ray and DES on black bean phaseolus vulgaris
Energy Technology Data Exchange (ETDEWEB)
Le Thi Dinh; Pham Le Ha; Nguyen Van Toan; Le Xuan Tham [Nuclear Research Institute, Radiobiology Department, Dalat (Viet Nam)
2001-03-01
The study on mutation induced effect of gamma ray and DES on black bean Phaseolus vulgaris was carried out at Radiobiology Department, Nuclear Research Institute of Dalat. Dry seeds of variety No.1847 - Bonita - Cuba in set of 13 black bean varieties were irradiated with gamma ray from {sup 60}Co source at dose range from 150 Gy to 350 Gy and treated with DES at concentration from 0.1% to 0.3% in 2 hours for experiments in laboratory. The doses of 200, 250, 300 Gy and concentration of 0.2% DES in 2 hours were selected to treat dry seeds for experiments on the field. In populations of M{sub 1} generation, the height, number of branches and fruits per plant, number of seeds per fruit were decreased with increasing of irradiation doses. In populations of M{sub 2} generation, individual variants in leaf shape, chlorophyll, short stem, dwarf, early maturity, flowering in very short time were obtained and selected in all treatment cases. Mutation frequency at dose of 300 Gy was higher than that in other treatment cases, but ratio of sterility is also largest. The mutant lines of early maturity and short stem with flowering in very short time are promised materials for further studies. (author)
Wong, Jack H; Wan, Chung T; Ng, Tzi B
2010-01-15
A haemagglutinin was purified from Japanese Hokkaido red beans (Phaseolus vulgaris cv. Hokkaido red bean) with a procedure that included three chromatographic media. Haemagglutinating activity was adsorbed on DEAE cellulose, Affi-gel blue gel and Mono S. The pure haemagglutinin was a homodimer and each subunit was around 30 kDa in molecular mass. The haemagglutinating activity of this agglutinin could not be inhibited by a variety of simple sugars at 200 mmol L(-1) concentration including alpha-L-fucose, D(+)-galactose, D(+)-glucose, D(+)-glucosamine, D(-)galactosamine, galacturonic acid, (+)-lactose, D(+)-melibose, L(-)-mannose, D(+)-mannose, D-mannosamine, D(+)-raffinose, L-rhamnose, (+)-xylose and galacturonic acid. The haemagglutinating activity was fully retained at pH 4-11 and at 0-80 degrees C, but was completely lost at extreme pH values (0-2 and 13-14) and at very high temperatures (90 degrees C and 100 degrees C). The haemagglutinin exhibited a weak mitogenic activity toward mouse splenocytes, a stronger anti-proliferative activity than Con A toward HepG2 (human hepatoma) cells and inhibited >80% of HIV-1 reverse transcriptase inhibitory activity at 3.3 micromol L(-1). It was devoid of anti-fungal activity. Hokkaido red bean haemagglutinin possesses a potent anti-proliferative effect on HepG2 cells. Copyright (c) 2009 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Márcio José de Santana
2003-04-01
Full Text Available Conduziu-se este trabalho com o objetivo de avaliar os efeitos de diferentes concentrações de sal, da água de irrigação, na salinização de um Latossolo Roxo distrófico, onde cultivou-se o feijoeiro (Phaseolus vulgaris L. CV ESAL 686. O experimento foi conduzido em casa-de-vegetação no Departamento de Engenharia da Universidade Federal de Lavras, em Lavras, MG, com o propósito de evitar a interferência das precipitações pluviométricas. Os tratamentos consistiram de cinco níveis de salinidade da água (condutividade elétrica de 0,1; 1,0; 2,5; 4,0 e 5,5 dS m-1 com seis repetições. A condutividade elétrica do extrato saturado do solo foi medida no início do experimento, no final da fase vegetativa e após a colheita. Constatou-se uma diminuição da salinidade do solo para o tratamento 0,1 dS m-1, nas diferentes datas de análise do extrato. Para os demais tratamentos, houve um aumento significativo na salinidade: 116,98%, 195,10%, 565,84% e 955,17% para os níveis 1,0; 2,5; 4,0 e 5,5 dS m-1, respectivamente. Houve uma queda acentuada de produção com níveis crescentes de salinidade do solo. O aumento da salinidade da água promoveu um acréscimo linear na condutividade elétrica do solo e no potencial osmótico.The objective this study was to evaluate the different irrigation water salt concentrations effects in the salinization of a "Dystrophic Dusky Red Latossol", cultivated with (Phaseolus vulgaris L. CV ESAL 686. The experiment was carried out in a greenhouse in the Engineering Department at Federal University of Lavras, of Lavras - MG to avoid the interference of the precipitations. The treatments consisted of five level of water salt concentration (electric conductivity of 0.10; 1.0; 2.5; 4.0 and 5.5 dS m-1 with six replications. The electric conductivity of the soil saturation extract was measured at the beginning of the experiment, at the end of the vegetative phase and after the crop harvest. A decrease of soil
Sáez, Gabriel D; Hébert, Elvira M; Saavedra, Lucila; Zárate, Gabriela
2017-12-01
Legumes are an important protein source in developing countries and their flours represent an attractive alternative for the manufacture of gluten free products. In the present study, 4 kidney bean varieties (Alubia, Pallar, Black and Red beans) commonly cultivated in northwestern Argentina, were milled and spontaneously fermented in order to isolate and select autochthonous lactic acid bacteria (LAB) with relevant technological and functional properties for usage as starter cultures. Twelve doughs were fermented with daily back-slopping at 37°C for 6days and evolution of total mesophiles, lactic acid bacteria, and yeasts and molds populations were followed by plate counting. A combination of phenotypic and genotypic methods including (GTG) 5 -based PCR fingerprinting and 16S rRNA gene sequencing were used to differentiate and identify the isolated LAB to species level. LAB counts ranged from around 0.89±0.81 to 8.74±0.03logcfu/g with a pH decline from 6.4 to 3.9 throughout fermentation. Four genera and nine species of LAB: Enterococcus durans, E. faecium, E. mundtii, E. casseliflavus; Lactobacillus rhamnosus, Lactococcus garvieae, Weissella cibaria and W. paramesenteroides were found on kidney beans. Twenty five LAB strains were assessed for their abilities to grow on kidney bean extracts, acidifying capacities (pH and acidification rates), amylolytic, proteolytic, tannase and gallate decarboxylase activities as well as pathogens inhibition by antimicrobials. Based on these properties E. durans CRL 2178 and W. paramesenteroides CRL 2182 were inoculated singly and combined in Alubia kidney bean flour and fermented for 24h at 37°C. LAB strains were beneficial for removing trypsin inhibitors and tannins from sourdoughs and for improving amino acids and phenolics contents, increasing the antioxidant activities of kidney bean matrices. Selected strains have potential as starter cultures for obtaining fermented bean products with high nutritional and functional quality. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
R. Monroy
2010-01-01
alimentación y la comercialización de excedentes y aporta ingresos económicos. En otras localidades de la entidad, aún se cultiva en parcelas pequeñas o en el traspatio. El conocimiento tradicional del manejo y uso del frijol es fundamental como alternativa para su conservación; por tanto, se planteó describir el proceso productivo hasta su comercialización y las formas tradicionales de consumo. El proceso productivo del yepataxtle, desde la siembra hasta la cosecha, se registró durante un ciclo agrícola en una parcela cuyo dueño lo explicó. La comercialización se documentó a través de entrevistas a comerciantes y compradores en el mercado municipal durante los días de selecplaza. Las formas de consumo se obtuvieron a través de entrevistas abiertas a las amas de casa que preparan platillos con el yepataxtle. El sistema milpa, cuando incluye yepataxtle, dura 240 días; cuando es solo, 120. Se explican las técnicas campesinas desde la cosmovisión de los informantes. El yepataxtle se comercializa directamente en el mercado, de febrero a mayo como ejote fresco, y en abril, como frijol seco. La información culinaria tradicional del yepataxtle se organizó en un recetario mediante un uso ceremonial para las fiestas patronales del pueblo.
Directory of Open Access Journals (Sweden)
Emil Cristhian Vega Ponce
2017-01-01
Full Text Available In the experimental area of the UNALM (Lima - Perú was evaluated on partial root - zone drying irrigation treatments (RPR300 and RPR500, ml and full irrigation (RC300 a nd RC500, ml control, the impact of xylem potential ( x and stomatal conductance (gs in common bean plants ( Phaseolus vulgaris L. cultivated in systems (pots of hydrogravitropic response. A randomized complete block design with 12 plants/pots per trea tments was used in three replicates. To control the irrigation application and manage to maintain the x nonlethal conditions (< - 15 bars, a water - soil retention curve was generated. The values of gs before irrigation (between 217.18 and 268.67 mm m - 2 s - 1 showed that only RPR500 plants were maintained under optimal water conditions, despite low levels of x (between - 9.92 and - 7.33 bar; situation that could be attributed to the ability of the roots to balance those moments when half of these structures we re inside soil with low humidity, while the opposite half was favorable soil water level.
Praseptiangga, Danar; Tryas, Anisha Ayuning; Affandi, Dian Rachmawanti; Atmaka, Windi; Ariyantoro, Achmad Ridwan; Minardi, Slamet
2018-02-01
The diversity of Indonesian local food sources has potential to be developed for supporting food security based development of local food diversification. Canna tubers (Canna edulis) and lima beans (Phaseolus lunatus) are two local commodities in Indonesia which under is utilization and has limited assessment to its characteristics. This study aimed at determining the best formula of composite flour based on physical and chemical properties of composite flour produced. There were three formulas, F1 for 85% of canna flour and 15%of lima beans flour, F2 for 70% of canna flour and 30% of lima beans flour and F3 for 55% of canna flour and 45% of lima beans flour. Physical and chemical analyses were conducted and completely randomized design was used. De Garmo analysis was then used to determine the highest effectiveness index from the three formulas developed in this study and F3 demonstrated the highest effectiveness index (0.545) among three formulas evaluated. Thus, formula (F3) was selected as the best composite of the flour developed from canna flour and lima beans flour.
Silva, Francilene Lopes da
2014-01-01
Algumas espécies de Trichoderma quando em íntima associação com plantas hospedeiras podem desencadear sua resposta de defesa e, desta forma, induzir resistência contra subsequentes infecções fúngicas. No presente trabalho foi analisado a expressão dos genes codificadores de proteínas de defesa (Glu, Chit 1, LOX, PER e PAL) em feijoeiro comum, Phaseolus vulgaris, em resposta à asssociação com os isolados das espécies T. asperellum (468/02) e T. harzianum (475/2 e 303/2), após 24, 48 e 72 horas...
International Nuclear Information System (INIS)
Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel
2009-01-01
A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm 2 of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)
Coleto, Inmaculada; Trenas, Almudena T; Erban, Alexander; Kopka, Joachim; Pineda, Manuel; Alamillo, Josefa M
2016-08-01
Purines are essential molecules formed in a highly regulated pathway in all organisms. In tropical legumes, the nitrogen fixed in the nodules is used to generate ureides through the oxidation of de novo synthesized purines. Glutamine phosphoribosyl pyrophosphate amidotransferase (PRAT) catalyses the first committed step of de novo purine synthesis. In Phaseolus vulgaris there are three genes coding for PRAT. The three full-length sequences, which are intron-less genes, were cloned, and their expression levels were determined under conditions that affect the synthesis of purines. One of the three genes, PvPRAT3, is highly expressed in nodules and protein amount and enzymatic activity in these tissues correlate with nitrogen fixation activity. Inhibition of PvPRAT3 gene expression by RNAi-silencing and subsequent metabolomic analysis of the transformed roots shows that PvPRAT3 is essential for the synthesis of ureides in P. vulgaris nodules. © 2016 John Wiley & Sons Ltd.
Annotation and sequence diversity of transposable elements in common bean (Phaseolus vulgaris
Directory of Open Access Journals (Sweden)
Scott eJackson
2014-07-01
Full Text Available Common bean (Phaseolus vulgaris is an important legume crop grown and consumed worldwide. With the availability of the common bean genome sequence, the next challenge is to annotate the genome and characterize functional DNA elements. Transposable elements (TEs are the most abundant component of plant genomes and can dramatically affect genome evolution and genetic variation. Thus, it is pivotal to identify TEs in the common bean genome. In this study, we performed a genome-wide transposon annotation in common bean using a combination of homology and sequence structure-based methods. We developed a 2.12-Mb transposon database which includes 791 representative transposon sequences and is available upon request or from www.phytozome.org. Of note, nearly all transposons in the database are previously unrecognized TEs. More than 5,000 transposon-related expressed sequence tags (ESTs were detected which indicates that some transposons may be transcriptionally active. Two Ty1-copia retrotransposon families were found to encode the envelope-like protein which has rarely been identified in plant genomes. Also, we identified an extra open reading frame (ORF termed ORF2 from 15 Ty3-gypsy families that was located between the ORF encoding the retrotransposase and the 3’LTR. The ORF2 was in opposite transcriptional orientation to retrotransposase. Sequence homology searches and phylogenetic analysis suggested that the ORF2 may have an ancient origin, but its function is not clear. This transposon data provides a useful resource for understanding the genome organization and evolution and may be used to identify active TEs for developing transposon-tagging system in common bean and other related genomes.
Cejas, Inaudis; Rivas, Maribel; Nápoles, Lelurlys; Marrero, Pedro; Yabor, Lourdes; Aragón, Carlos; Pérez, Aurora; Engelmann, Florent; Martínez-Montero, Marcos Edel; Lorenzo, José Carlos
2015-01-01
It is well known that cryopreserving seeds with high water content is detrimental to survival, but biochemical and structural parameters of cryostored hydrated common bean seeds have not been published. The objective of this work was to study the effect of liquid nitrogen exposure on selected biochemical and structural parameters of hydrated Phaseolus vulgaris seeds. We cryopreserved seeds at various moisture contents and evaluated: germination; electrolyte leakage; fresh seed weight; levels of chlorophyll pigments, malondialdehyde, other aldehydes, phenolics and proteins; thickness of cotyledon epidermis, parenchyma, and starch storage parenchyma; and radicle and plumule lengths. Germination was totally inhibited when seeds were immersed in water for 50 min (moisture content of 38%, FW basis) before cryopreservation. The combined effects of seed water imbibition and cryostorage decreased phenolics (free, cell wall-linked, total), chlorophyll a and protein content. By contrast, electrolyte leakage and levels of chlorophyll b and other aldehydes increased as a result of the combination of these two experimental factors. These were the most significant effects observed during exposure of humid seed to liquid nitrogen. Further studies are still required to clarify the molecular events taking place in plant cells during cryostorage.
Directory of Open Access Journals (Sweden)
Cleber M. Guimarães
2006-03-01
Full Text Available Realizou-se este trabalho tendo em vista o propósito de se estudar a adaptação de genótipos de feijoeiro comum (Phaseolus vulgaris L. à seca, como suporte a programas de melhoramento que visem à criação de cultivares para regiões sujeitas a deficiência hídrica, mediante a avaliação do potencial da água nas folhas e da resistência difusiva estomática. Adicionalmente avaliou-se a técnica de medição da temperatura do dossel pela termometria de infravermelho para inferir o estado hídrico da planta. Os genótipos Carioca e RAB 96 foram submetidos, dos 20 dias após a emergência até a colheita, a dois tratamentos hídricos: irrigação adequada e com deficiência hídrica. Em geral, a cultivar Carioca manteve potenciais de água na folha mais altos e também melhor capacidade de recuperação hídrica, além de apresentar resistência difusiva estomática e temperatura do dossel mais baixas que a linhagem RAB 96 sendo, portanto, melhor adaptada à seca. A temperatura do dossel correlacionou-se significativamente com o potencial da água nas folhas e, devido a sua medição ser rápida e não-destrutiva, mostrou tratar-se de uma técnica útil no processo de seleção de genótipos para regiões sujeitas a deficiência hídrica.The objective of this study was to investigate the common bean adaptation to drought, as support to breeding programs directed to regions with water deficiency, through the evaluation of leaf water potential and stomatal diffusive resistance. Furthermore, the canopy temperature was evaluated with the infrared thermometer technique to infer the plant water content. From twenty days after emergence until harvest, the genotypes Carioca and RAB 96 were submitted to two water treatments: adequate irrigation and water deficit. The 'Carioca' showed higher leaf water potentials and better water recovery capacity compared with 'RAB 96'. This cultivar also showed lower stomatal diffusive resistance and canopy
Transcriptome analysis of salt tolerant common bean (Phaseolus vulgaris L. under saline conditions.
Directory of Open Access Journals (Sweden)
Mahmut Can Hiz
Full Text Available Salinity is one of the important abiotic stress factors that limit crop production. Common bean, Phaseolus vulgaris L., a major protein source in developing countries, is highly affected by soil salinity and the information on genes that play a role in salt tolerance is scarce. We aimed to identify differentially expressed genes (DEGs and related pathways by comprehensive analysis of transcriptomes of both root and leaf tissues of the tolerant genotype grown under saline and control conditions in hydroponic system. We have generated a total of 158 million high-quality reads which were assembled into 83,774 all-unigenes with a mean length of 813 bp and N50 of 1,449 bp. Among the all-unigenes, 58,171 were assigned with Nr annotations after homology analyses. It was revealed that 6,422 and 4,555 all-unigenes were differentially expressed upon salt stress in leaf and root tissues respectively. Validation of the RNA-seq quantifications (RPKM values was performed by qRT-PCR (Quantitative Reverse Transcription PCR analyses. Enrichment analyses of DEGs based on GO and KEGG databases have shown that both leaf and root tissues regulate energy metabolism, transmembrane transport activity, and secondary metabolites to cope with salinity. A total of 2,678 putative common bean transcription factors were identified and classified under 59 transcription factor families; among them 441 were salt responsive. The data generated in this study will help in understanding the fundamentals of salt tolerance in common bean and will provide resources for functional genomic studies.
Effects of putrescine, kinetin and IAA on protein synthesis in 'Phaseolus vulgaris' coleoptiles
Energy Technology Data Exchange (ETDEWEB)
Crocomo, O J; Lee, T S.G. [Centro de Energia Nuclear na Agricultura, Piracicaba (Brazil)
1975-01-01
Incubation of etiolated 'Phaseolus vulgaris' coleoptiles shows a converse flux between soluble protein and reducing sugar. The rate of incorporation of radioactive arginine into protein was higher than that of radioactive leucine. Radioactive arginine incorporation into protein was linear up to 120 min and then started to decline. The rate of incorporation of radioactive leucine was increased by preincubation of the tissue in the incubation medium. Roots were found to contain more soluble protein and much less reducing sugar than the coleoptile. The optimum pH value for protein synthesis in coleoptile sections was found to be 6 for control tissues and 4 for those treated with 10-/sup 3/M IAA. This high concentration of IAA was also found to inhibit soluble protein synthesis, the incorporation rate of radioactive arginine and leucine into protein fraction, the secretion of hydrogen ion into the incubation medium and elongation of the bean segment. Kinetin at 2x10/sup -4/M and putrescine at 5mM both decreased the rate of /sup 14/C-arginine incorporation into soluble protein, but for /sup 14/C-leucine, this rate of incorporation was found to be increased after 90 min incubation with a preincubation of 30 min. In general, the change pattern of the soluble protein content, the reducing sugar level and the incorporation rate of radioactive arginine and leucine into protein in the kinetin and putrescine treated tissues were about the same although tissues that incubated with kinetin always contain more soluble protein and less reducing sugar than that of incubated with putrescine.
Chigwedere, Claire Maria; Olaoye, Taye Foyeke; Kyomugasho, Clare; Jamsazzadeh Kermani, Zahra; Pallares Pallares, Andrea; Van Loey, Ann M; Grauwet, Tara; Hendrickx, Marc E
2018-04-01
The relative contributions of cotyledons and seed coats towards hardening of common beans (Phaseolus vulgaris) were investigated and the rate-limiting process which controls bean softening during cooking was determined. Fresh or aged whole beans and cotyledons were soaked and cooked in demineralised water or 0.1 M NaHCO 3 solution, and texture evolution, microstructure changes and thermal properties were studied. Fresh and aged whole beans cooked in demineralised water had significantly different softening rate constants and so did fresh and aged cotyledons. The comparable softening rate constants of aged whole beans and cotyledons indicated an insignificant role of the seed coat in hardening during storage. All samples cooked faster in 0.1 M NaHCO 3 solution. Disintegration of cooked tissues followed by microscopic examination revealed a transition from cell breakage through a phase of cell breakage and separation to complete cell separation with increased cooking time wherefore texture decayed. Therefore, progressive solubilization of pectin in the middle lamella greatly promoted texture decay. While residual birefringence even after substantial cooking time suggested some molecular order of the starch, calorimetric analyses revealed complete starch gelatinisation before complete cell separation occurred. This implies an insignificant role of starch in texture decay during cooking but its hindered uncoiling into a viscous gel after gelatinisation due to the restricting cell wall could promote its retrogradation. Therefore, we suggest that the rate-determining process in bean softening relates to cell wall/middle lamella changes influencing pectin solubilization. Copyright © 2018 Elsevier Ltd. All rights reserved.
Response of French Bean (Phaseolus vulgaris L. Cultivars to Foliar Applications of Magnesium
Directory of Open Access Journals (Sweden)
Michele Pisante
2011-02-01
Full Text Available Magnesium deficiencies have been shown to be particularly dangerous to short cycled crops, both on sandy and clay soils. Such deficiencies may be corrected by foliar fertilisations, but in French bean (Phaseolus vulgaris L. no experimental data may be found to support this hypothesis. Therefore this paper was aimed at studying the effect of foliar Mg-applications (56, 112 and 224 g ha-1 in single application at flowering or splitted half dose at 4-leaf stage and half at flowering alone and with Zn (200 g ha-1 on yield and quality of two French bean genotypes (Bronco, Cadillac. Foliar Mg-applications significantly increased pod yield and, considering the highest rate with respect to the untreated, such an increase was 78% and 32% for Bronco and Cadillac, respectively. Split applications were also more effective, with yield increases of 109% and 50% for the two genotypes. Concerning quality, foliar Mg applications showed a significant effect particularly on sugars, calcium, phosphate, sulphate and Mg contents in pods. On the other hand, a significant effect on the accumulation of nitrates was noted, especially with split applications (144% increase vs. unfertilised and, in some cases, an antagonistic effect on K content (10-20% decrease on average. Foliar Mg fertilisation of French bean seemed to be a promising practice with reference to human health and nutrition, tough some care is needed to avoid the accumulation of nitrates in pods. Split applications seemed to be more effective, while the addition of Zn to the fertiliser mix did not give any relevant effect.
Energy Technology Data Exchange (ETDEWEB)
Doebereiner, J
1966-02-01
Three greenhouse experiments were conducted to study manganese toxicity effects on the nitrogen fixing symbiosis of beans (Phaseolus vulgaris). Addition of 40 ppm of manganese to two acid soils affected nodulation and nitrogen fixation. Dependent on the Rhizobion strain either nodule numbers or efficiency in nitrogen fixation were reduced; the efficiency of one Rhizobium-host combination was more affected than another. Under less severe conditions of manganese toxicity, reduction of nodule numbers or of efficiency in nitrogen fixation could be compensated by an increase of nodule size. In the absence of manganese toxicity nodulation and nitrogen fixation of beans were abundant in a soil with pH 4.4. Naturally occurring manganese toxicity in a gray hydromorphic soil was eliminated by liming. The total nitrogen content of bean plants which were dependent on symbiotic nitrogen fixation decreased linearly with the logarithm of the manganese concentration in the plants. This did not happen when the plants were grown with mineral nitrogen. The role of manganese toxicity in the well known sensitivity to acid soil conditions of certain legumes and the importance of selection of manganese tolerant Rhizobium strains for the inoculation of beans in acid tropical soils, are discussed. 25 references, 1 figure, 6 tables.
Directory of Open Access Journals (Sweden)
Martina Lardi
2017-12-01
Full Text Available Paraburkholderia phymatum belongs to the β-subclass of proteobacteria. It has recently been shown to be able to nodulate and fix nitrogen in symbiosis with several mimosoid and papilionoid legumes. In contrast to the symbiosis of legumes with α-proteobacteria, very little is known about the molecular determinants underlying the successful establishment of this mutualistic relationship with β-proteobacteria. In this study, we performed an RNA-sequencing (RNA-seq analysis of free-living P. phymatum growing under nitrogen-replete and -limited conditions, the latter partially mimicking the situation in nitrogen-deprived soils. Among the genes upregulated under nitrogen limitation, we found genes involved in exopolysaccharides production and in motility, two traits relevant for plant root infection. Next, RNA-seq data of P. phymatum grown under free-living conditions and from symbiotic root nodules of Phaseolus vulgaris (common bean were generated and compared. Among the genes highly upregulated during symbiosis, we identified—besides the nif gene cluster—an operon encoding a potential cytochrome o ubiquinol oxidase (Bphy_3646-49. Bean root nodules induced by a cyoB mutant strain showed reduced nitrogenase and nitrogen fixation abilities, suggesting an important role of the cytochrome for respiration inside the nodule. The analysis of mutant strains for the RNA polymerase transcription factor RpoN (σ54 and its activator NifA indicated that—similar to the situation in α-rhizobia—P. phymatum RpoN and NifA are key regulators during symbiosis with P. vulgaris.
International Nuclear Information System (INIS)
Iyengar, B.R.V.; Deb, D.L.
1977-01-01
Utilization of soil and fertilizer zinc by maize (Zea mays) and moong (Phaseolus aureus Roxb.) was studied under greenhouse conditions in ten soils belonging to three important soil groups of India viz. alluvial, red and laterite using two levels of labelled zinc sulphate. The efficiency of utilization of fertilizer zinc was found to be higher at 10 ppm level of application in both the crops as compared with 20 ppm level of applied zinc. The total utilization of fertilizer zinc by both the crops in different soils ranged from 0.47 to 1.34 percent and 0.41 to 0.95 percent at 10 and 20 ppm level of applied zinc, respectively. Application of fertilizer zinc resulted in a decrease in the uptake of soil zinc. The utilization of fertilizer zinc was found to be negatively correlated with soil pH but the interaction of different soil characters seemed to have determined the efficiency of fertilizer use by both the crops. The efficiency of fertilizer zinc utilization was found to be low in moong as compared with maize. (author)
Prior, René; Mittelbach, Moritz; Begerow, Dominik
2017-06-03
In this study, the impacts of three different fungicides to fungal phyllosphere communities on broad bean (Vicia faba, Fabaceae) and common bean (Phaseolus vulgaris, Fabaceae) were analyzed. The fungicides included copper, sulfur, and azoxystrobin. The plants were sowed, grown, and treated under conditions occurring in conventional and organic farming. A culture-based approach was used to identify changes in the phyllosphere fungal community after the treatment. Different effects on species richness and growth index of the epiphytic and endophytic communities for common bean and broad bean could be shown. Treatments with sulfur showed the weakest effect, followed by those based on copper and the systemic azoxystrobin, which showed the strongest effect especially on endophytic communities. The epiphytic fungal community took five weeks to recover after treatment with azoxystrobin. However, the effect of azoxystrobin on the endophytic community lasted more than five weeks. Finally, the data suggest that the surface structure of the host leaves have a huge impact on the mode of action that the fungicides exert.
Effect of vermicompost on soil fertility and crop productivity--beans (Phaseolus vulgaris).
Manivannan, S; Balamurugan, M; Parthasarathi, K; Gunasekaran, G; Ranganathan, L S
2009-03-01
Field experiments were conducted at Sivapuri, Chidambaram, Tamil Nadu to evaluate the efficacy of vermicompost, in comparison to inorganic fertilizers-NPK, on the physio-chemical and biological characteristics of the soils--clay loam soil (CLS) and sandy loam soil (SLS) and on the growth, yield and nutrient content of beans--Phaseolus vulgaris. Results showed that the application of vermicompost @ 5 tonnes ha(-1) had enhanced significantly the pore space (1.09 and 1.02 times), water holding capacity (1.1 and 1.3 times), cation exchange capacity (1.2 and 1.2 times). It reduced particles (1.2 and 1.2 times), and bulk density (1.2 and 1.2 times), pH (1 and 1.02 times) and electrical conductivity (1.4 and 1.2 times) and increased organic carbon (37 and 47 times), micro (Ca 3.07 and 1.9 times, Mg 1.6 and 1.6 times, Na 2.4 and 3.8 times, Fe 7 and 7.6 times, Mn 8.2 and 10.6 times, Zn 50 and 52 times and Cu 14 and 22 times) and macro (N 1.6 and 1.7 times, P 1.5 and 1.7 times, K 1.5 and 1.4 times) nutrients and microbial activity (1.4 and 1.5 times) in both soil types, particularly more in CLS. The growth, yield (1.6 times) and quality (protein (1.05 times) and sugar (1.01 times) content in seed) of bean were enhanced in CLS than SLS. On the other hand, the application of inorganic fertilizers @ 20:80:40 kg ha(-1) has resulted in reduced porosity (1.03 and 1.01 times), organic carbon (1.04 and 9.5 times) and microbial activity (1.02 and 1.03 times) in both soil types.
International Nuclear Information System (INIS)
Sasaki, K.; Taylor, I.E.P.
1986-01-01
Radiolabeled D-[1- 3 H]glucose was fed by imbibition under sterile conditions to bean (Phaseolus vulgaris L.) seeds. After 72 and 96 hours of feeding, the 3 H was located in uronic acid and pentose residues as well as hexose residues of cell wall polysaccharides in growing hypocotyl and root. Free myo-inositol present in cotyledons, hypocotyl, and root also contained 3 H, showing that de novo synthesis of myo-inositol from [1- 3 H]glucose did occur during the first 72 hours of germination. More than 90% of the labeled, free myo-inositol was present in the cotyledons. The 3 H percentage in trifluoroacetic acid-soluble arabinaose residues of cell wall polysaccharides from 72-hour-old bean hypocotyls was only half of their mole percentage. On the other hand, 3 H percentages in hexose residues were higher than their mole percentages. The results suggest that myo-inositol is synthesized from reserve sugars during the very early stages of germination, and that the newly synthesized myo-inositol, as well as that stored in cotyledons, can be used for the construction of new hypocotyl and root cell wall polysaccharides after conversion into uronic acids and pentoses via the myo-inositol oxidation pathway
Hernández-Álvarez, Alan Javier; Carrasco-Castilla, Janet; Dávila-Ortiz, Gloria; Alaiz, Manuel; Girón-Calle, Julio; Vioque-Peña, Javier; Jacinto-Hernández, Carmen; Jiménez-Martínez, Cristian
2013-03-15
Bean seeds are an inexpensive source of protein. Anthracnose disease caused by the fungus Colletotrichum lindemuthianum results in serious losses in common bean (Phaseolus vulgaris L.) crops worldwide, affecting any above-ground plant part, and protein dysfunction, inducing the synthesis of proteins that allow plants to improve their stress tolerance. The aim of this study was to evaluate the use of beans damaged by anthracnose disease as a source of peptides with angiotensin-converting enzyme (ACE-I)-inhibitory activity. Protein concentrates from beans spoiled by anthracnose disease and from regular beans as controls were prepared by alkaline extraction and precipitation at isolelectric pH and hydrolysed using Alcalase 2.4 L. The hydrolysates from spoiled beans had ACE-I-inhibitory activity (IC(50) 0.0191 mg protein mL(-1)) and were very similar to those from control beans in terms of ACE-I inhibition, peptide electrophoretic profile and kinetics of hydrolysis. Thus preparation of hydrolysates using beans affected by anthracnose disease would allow for revalorisation of this otherwise wasted product. The present results suggest the use of spoiled bean seeds, e.g. anthracnose-damaged beans, as an alternative for the isolation of ACE-I-inhibitory peptides to be further introduced as active ingredients in functional foods. © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
A. K. Gardezi
2014-02-01
Full Text Available The objective of this research was to evaluate the effect of organic matter on the association with Glomus intrarradices and soil contamination on beans (Phaseolus vulgaris L.. The study was done under greenhouse conditions at the Montecillo Campus of the Postgraduate College, Mexico. Two soils were used, one irrigated with sewage water and the other one with clean water from a well. Half of the plants were inoculated with Glomus intrarradices. Vermicompost was used as a source of organic matter. There were highly significant increases (p≤0.05 in all the variables recorded due to the application of organic matter, and to the inoculation with Glomus intarradices. The irrigation source of the soils used for this experiment only had a significant effect (p≤0.05 on pod number and nitrogen fixation. The best growth and grain yield occurred with inoculated plants and supplementary organic matter.
Directory of Open Access Journals (Sweden)
Klever Iván Granda Mora
2016-10-01
Full Text Available The development of biofertilizers based on Rhizobium strains for common bean (Phaseolus vulgaris L. requires studies about bacterial interaction with target cultivars. For these reason, the aim of this paper was to determine the effect of the inoculation of Rhizobium native strains, isolated from southern Ecuador, on P. vulgaris cultivar Mantequilla. An assay was performed in greenhouse. It were evaluated the parameters of nodulation, biomass, nitrogen fixation and efficiency of the symbiosis. All inoculated strains were able to nodulate bean seedlings. The total number of nodules, nodular biomass and plant biomass, were favourably affected by inoculation of Rhizobium strains. The best results were obtained with R. mesoamericanum NAM1, R. leguminosarum COL 6 and R. etli PIN 1 strains. The experimental evidences shows the potential of native strains of Rhizobium for it use as biofertilizers because they are able to raise the rates of nitrogen fixation in common bean in southern Ecuador.
Energy Technology Data Exchange (ETDEWEB)
Bleeker, P.M.; Teiga, P.M.; Santos, M.H.; Koe, T. de; Verkleij, J.A.C
2003-09-01
A residue of the sugar industry can be used in revegetation programs on metal contaminated sites. - Phytostabilisation of bare heavily contaminated substrate, such as abandoned mine sites, is considered a very appropriate technology in order to diminish erosion and dispersion of contaminants into the surroundings. In this short-term pot study, application of industrial sugar residue (ISR), a waste product of the sugar industry, proved to ameliorate spoils conditions for plant performance by elevating pH and immobilising several metals. Although arsenate concentrations were positively correlated to spoil pH and spoil treatment with ISR mobilised As, growth of both Phaseolus vulgaris and Holcus lanatus improved significantly after applications of 3.75 g ISR kg{sup -1} dry spoil. Nutrient uptake from the substrate, with the exception of potassium, was elevated by ISR. As a remediation technique ISR application could be effective although in As-contaminated sites application might be restricted to areas where leaching to (ground) water does not form a risk.
Weed Interference Effects on Leaves, Internode and Harvest Index of Dry Bean (Phaseolus vulgaris L.
Directory of Open Access Journals (Sweden)
Hossein GHAMARI
2015-03-01
Full Text Available The development of appropriate weed management strategies and efficient use of herbicides relies upon understanding weed-crop interactions. A field study was carried out to assess the effect of weed interference on leaves, internode and harvest index of dry bean (Phaseolus vulgaris L.. The experiment was established under a randomized complete block design with two types of weed interference treatments: plots with weeds and plots without weeds at different time intervals (0, 10, 20, 30, 40 and 50 days after crop emergence. The sigmoid Boltzmann model was used to quantify the crop traits as influenced by weed interference. Prolonged delays in weed removal reduced gradually the number of leaves of the crop. Weed interference decreased dry weight of leaves as well, so that the lowest value of it (33.49 g plant-1 was observed in full season during weed-infested treatment. Infestation of weeds affected the length of the crop internodes. While the weed interference duration increased, the length of the internodes decreased. Harvest index was also sensitive to weed competition. As the crop was kept weed-infested from the emergence for increasing periods of time, harvest index decreased to a value of 28.01%. A significant negative correlation between total biomass of weeds and dry bean traits (number of leaves, leaves dry weight, internode length and harvest index was observed. Therefore, weeds are able to adversely affect dry bean growth through constraining environmental resources and impairing leaves as the photosynthetic areas.
Madariaga-Navarrete, Alfredo; Rodríguez-Pastrana, Blanca Rosa; Villagómez-Ibarra, José Roberto; Acevedo-Sandoval, Otilio Arturo; Perry, Gregory; Islas-Pelcastre, Margarita
2017-06-03
The objective of the present study was to examine a biological model under greenhouse conditions for the bioremediation of atrazine contaminated soils. The model consisted in a combination of phytoremediation (using Phaseolus vulgaris L.) and rhizopheric bio-augmentation using native Trichoderma sp., and Rhizobium sp. microorganisms that showed no inhibitory growth at 10,000 mg L -1 of herbicide concentration. 33.3 mg of atrazine 50 g -1 of soil of initial concentration was used and an initial inoculation of 1 × 10 9 UFC mL -1 of Rhizobium sp. and 1 × 10 5 conidia mL -1 of Trichoderma sp. were set. Four treatments were arranged: Bean + Trichoderma sp. (B+T); Bean + Rhizobium sp. (BR); Bean + Rhizobium sp. + Trichoderma sp. (B+R+T) and Bean (B). 25.51 mg of atrazine 50 g -1 of soil (76.63%) was removed by the B+T treatment in 40 days (a = 0.050, Tukey). This last indicate that the proposed biological model and methodology developed is useful for atrazine contaminated bioremediation agricultural soils, which can contribute to reduce the effects of agrochemical abuse.
Nanjareddy, Kalpana; Arthikala, Manoj-Kumar; Blanco, Lourdes; Arellano, Elizabeth S; Lara, Miguel
2016-06-24
Phaseolus vulgaris is one of the most extensively studied model legumes in the world. The P. vulgaris genome sequence is available; therefore, the need for an efficient and rapid transformation system is more imperative than ever. The functional characterization of P. vulgaris genes is impeded chiefly due to the non-amenable nature of Phaseolus sp. to stable genetic transformation. Transient transformation systems are convenient and versatile alternatives for rapid gene functional characterization studies. Hence, the present work focuses on standardizing methodologies for protoplast isolation from multiple tissues and transient transformation protocols for rapid gene expression analysis in the recalcitrant grain legume P. vulgaris. Herein, we provide methodologies for the high-throughput isolation of leaf mesophyll-, flower petal-, hypocotyl-, root- and nodule-derived protoplasts from P. vulgaris. The highly efficient polyethylene glycol-mannitol magnesium (PEG-MMG)-mediated transformation of leaf mesophyll protoplasts was optimized using a GUS reporter gene. We used the P. vulgaris SNF1-related protein kinase 1 (PvSnRK1) gene as proof of concept to demonstrate rapid gene functional analysis. An RT-qPCR analysis of protoplasts that had been transformed with PvSnRK1-RNAi and PvSnRK1-OE vectors showed the significant downregulation and ectopic constitutive expression (overexpression), respectively, of the PvSnRK1 transcript. We also demonstrated an improved transient transformation approach, sonication-assisted Agrobacterium-mediated transformation (SAAT), for the leaf disc infiltration of P. vulgaris. Interestingly, this method resulted in a 90 % transformation efficiency and transformed 60-85 % of the cells in a given area of the leaf surface. The constitutive expression of YFP further confirmed the amenability of the system to gene functional characterization studies. We present simple and efficient methodologies for protoplast isolation from multiple P
International Nuclear Information System (INIS)
Cervantes, M.L.; Segovia, N.; Gaso, M.I.; Palacios, J.C.
2002-01-01
A study of 137 Cs in soil, maize plants, (Zea mays) and beans (Phaseolus vulgaris) has been performed at the confined Storage Centre for Radioactive Waste from Mexico. Under field conditions the site was divided in four zones with different soil contamination characteristics. The plants were grown 'in situ' reproducing the local agricultural practices without fertilizers, pesticides or artificial irrigation.The 137 Cs determinations were performed using a low background gamma spectrometry system with an HPGe detector. The results indicate that one of the zones had a striking 137 Cs contamination in the soil and the uptake by the grown plants showed the highest specific activities at the root. For the edible parts of the plants the amount of 137 Cs in the maize grains was one order of magnitude lower than for the beans. The transfer factors ranges for the different parts of the maize plants was from 0.001 in the grain to 0.6 in the root. (author)
Institute of Scientific and Technical Information of China (English)
Jibao; Chen; Jing; Wu; Yunfeng; Lu; Yuannan; Cao; Hui; Zeng; Zhaoyuan; Zhang; Lanfen; Wang; Shumin; Wang
2016-01-01
As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter(Pro T) plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a c DNA sequence for Pro T from common bean(Phaseolus vulgaris L.) and designated the gene Pv Pro T. The deduced amino acid sequence of Pv Pro T showed high similarity to Bet/Pro T proteins from other leguminous plants, and the highest similarity was observed with mothbean(Vigna aconitifolia L.) Vu Pro T.Relative quantification of the m RNA level of Pv Pro T using real-time PCR analysis showed that the Pv Pro T transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20%(w/w) PEG-6000 treatment,drought-resistant plants expressed a higher level of Pv Pro T transcripts than droughtsensitive plants. Although heterologous expression of Pv Pro T in the Escherichia coli mutant mkh13 showed that Pv Pro T exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that Pv Pro T plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.
Directory of Open Access Journals (Sweden)
Aarón Barraza
2016-11-01
Full Text Available Legumes form symbioses with rhizobia, producing nitrogen-fixing nodules on the roots of the plant host. The network of plant signaling pathways affecting carbon metabolism may determine the final number of nodules. The trehalose biosynthetic pathway regulates carbon metabolism and plays a fundamental role in plant growth and development, as well as in plant-microbe interactions. The expression of genes for trehalose synthesis during nodule development suggests that this metabolite may play a role in legume-rhizobia symbiosis. In this work, PvTPS9, which encodes a Class II trehalose-6-phosphate synthase (TPS of common bean (Phaseolus vulgaris, was silenced by RNA interference in transgenic nodules. The silencing of PvTPS9 in root nodules resulted in a reduction of 85% (± 1% of its transcript, which correlated with a 30% decrease in trehalose contents of transgenic nodules and in untransformed leaves. Composite transgenic plants with PvTPS9 silenced in the roots showed no changes in nodule number and nitrogen fixation, but a severe reduction in plant biomass and altered transcript profiles of all Class II TPS genes. Our data suggest that PvTPS9 plays a key role in modulating trehalose metabolism in the symbiotic nodule and, therefore, in the whole plant.
Szczygiel, Edward J; Harte, Janice B; Strasburg, Gale M; Cho, Sungeun
2017-09-01
Food products produced with bean ingredients are gaining in popularity among consumers due to the reported health benefits. Navy bean (Phaseolus vulgaris) powder produced through extrusion can be considered as a resource-efficient alternative to conventional methods, which often involve high water inputs. Therefore, navy bean powders produced with extrusion and conventional methods were assessed for the impact of processing on consumer liking in end-use products and odor-active compounds. Consumer acceptance results reveal significant differences in flavor, texture and overall acceptance scores of several products produced with navy bean powder. Crackers produced with extruded navy bean powder received higher hedonic flavor ratings than those produced with commercial navy bean powder (P < 0.001). GC-O data showed that the commercial powder produced through conventional processing had much greater contents of several aliphatic aldehydes commonly formed via lipid oxidation, such as hexanal, octanal and nonanal with descriptors of 'grassy', 'nutty', 'fruity', 'dusty', and 'cleaner', compared to the extruded powder. Extrusion processed navy bean powders were preferred over commercial powders for certain navy bean powder applications. This is best explained by substantial differences in aroma profiles of the two powders that may have been caused by lipid oxidation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
International Nuclear Information System (INIS)
Lee, Minhee; Yang, Minjune
2010-01-01
The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 μg/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.
Energy Technology Data Exchange (ETDEWEB)
Lee, Minhee, E-mail: heelee@pknu.ac.kr [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of); Yang, Minjune [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of)
2010-01-15
The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 {mu}g/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.
Directory of Open Access Journals (Sweden)
Rosa Navarrete
2000-01-01
Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas
Directory of Open Access Journals (Sweden)
Zhenlong Xing
2017-11-01
Full Text Available Plant trichomes often function as physical barriers in preventing arthropod feeding and oviposition. Even though insects are frequently reported being entrapped and killed by trichome traps, the actual trapping behavior has not yet been described in detail. Capture experiments showed that capture efficiency during the plant's vegetative stage was considerably higher than in the fruiting and cotyledon stages. The ventral surface of the leaf was more effective in trapping flies than other parts of the plant. Capture-events monitoring showed that the mouthparts, legs, and ovipositor of Liriomyza trifolii adults are the body parts involved in entrapment by surface trichomes on Phaseolus vulgaris plants, and subsequently, deter their ability to feed, walk, and oviposit. Of the three main body parts normally affected, mouthparts was found to be the body part most susceptible to the trichomes. Entrapments were most often caused by landing, followed by puncturing or feeding, and occasionally by walking or fighting. Using scanning electron microscopy (SEM and optical microscopy, we determined the susceptible positions of each body part and found that the flies were all trapped by hooked trichomes. This study revealed the process by which leafminer flies are entrapped by surface trichomes of the host plant and evaluated the capture efficiency. The results will contribute to our understanding of physical defenses against herbivores.
Thesis Abstract Bean (Phaseolus vulgaris L.) lines: chemical composition and protein digestibility.
Mesquita, F R; Silva, M I A; Corrêa, A D
2016-05-09
The bean represents the main source of proteins for the low income populations, although the digestibility of those proteins is relatively low. Consequently, the programs of plant genetic breeding have been working on the search for new lines with higher protein levels. Thus, with the purpose of supplying information to the researchers, in this study, 21 bean (Phaseolus vulgaris L.) lines were analyzed for the centesimal and mineral composition, protein digestibility, phenolic compounds, and trypsin inhibitor. The entirely randomized experimental design was used with 21 treatments (lines) and three repetitions. All values were within the following ranges: 22.34 to 36.28 g crude protein/100 g dry matter (DM); 7.56 to 20.91 g neutral detergent fiber/100 g DM; 0.53 to 2.55 g fat/100 g DM and 2.97 to 4.87 g ashes/100 g DM. The levels of phosphorus, potassium, calcium, magnesium, and sulfur, in g/100 g DM, varied from 0.45 to 0.72; 1.51 to 2.48; 0.03 to 0.28; 0.18 to 0.34 and 0.28 to 0.45, respectively. Regarding copper, manganese, zinc and iron, the levels, in mg/kg DM, varied from 11.37 to 17.73; 14.93 to 28.90; 36.67 to 69.90 and 71.37 to 126.90, respectively. The in vitro protein digestibility varied from 18.03 to 48.32%. The levels of phenolic compounds varied from 0.28 to 1.08 mg acid tanic/100 g DM and the one of trypsin inhibitor from 59.93 to 151.07 trypsin inhibited units/mg DM. Among the lines with higher protein contents, "ESAL 569" (beige with brown stripe) presented the largest protein digestibility and considerable levels of minerals. "P-180" (beige with brown stripe) was one of the lines with higher crude protein contents and digestibilities, and also presented high levels for most of the minerals. No relation between protein digestibility and the contents of phenolic compounds or trypsin inhibitor was observed.
Schmidt, M A; Souza, E M; Baura, V; Wassem, R; Yates, M G; Pedrosa, F O; Monteiro, R A
2011-03-01
Herbaspirillum seropedicae is an endophytic diazotrophic bacterium, which associates with important agricultural plants. In the present study, we have investigated the attachment to and internal colonization of Phaseolus vulgaris roots by the H. seropedicae wild-type strain SMR1 and by a strain of H. seropedicae expressing a red fluorescent protein (DsRed) to track the bacterium in the plant tissues. Two-day-old P. vulgaris roots were incubated at 30°C for 15 min with 6 x 10(8) CFU/mL H. seropedicae SMR1 or RAM4. Three days after inoculation, 4 x 10(4) cells of endophytic H. seropedicae SMR1 were recovered per gram of fresh root, and 9 days after inoculation the number of endophytes increased to 4 x 10(6) CFU/g. The identity of the recovered bacteria was confirmed by amplification and sequencing of the 16SrRNA gene. Furthermore, confocal microscopy of P. vulgaris roots inoculated with H. seropedicae RAM4 showed that the bacterial cells were attached to the root surface 15 min after inoculation; fluorescent bacteria were visible in the internal tissues after 24 h and were found in the central cylinder after 72 h, showing that H. seropedicae RAM4 is capable of colonizing the roots of the dicotyledon P. vulgaris. Determination of dry weight of common bean inoculated with H. seropedicae SMR1 suggested that this bacterium has a negative effect on the growth of P. vulgaris.
Directory of Open Access Journals (Sweden)
M.A. Schmidt
2011-03-01
Full Text Available Herbaspirillum seropedicae is an endophytic diazotrophic bacterium, which associates with important agricultural plants. In the present study, we have investigated the attachment to and internal colonization of Phaseolus vulgaris roots by the H. seropedicae wild-type strain SMR1 and by a strain of H. seropedicae expressing a red fluorescent protein (DsRed to track the bacterium in the plant tissues. Two-day-old P. vulgaris roots were incubated at 30°C for 15 min with 6 x 10(8 CFU/mL H. seropedicae SMR1 or RAM4. Three days after inoculation, 4 x 10(4 cells of endophytic H. seropedicae SMR1 were recovered per gram of fresh root, and 9 days after inoculation the number of endophytes increased to 4 x 10(6 CFU/g. The identity of the recovered bacteria was confirmed by amplification and sequencing of the 16SrRNA gene. Furthermore, confocal microscopy of P. vulgaris roots inoculated with H. seropedicae RAM4 showed that the bacterial cells were attached to the root surface 15 min after inoculation; fluorescent bacteria were visible in the internal tissues after 24 h and were found in the central cylinder after 72 h, showing that H. seropedicae RAM4 is capable of colonizing the roots of the dicotyledon P. vulgaris. Determination of dry weight of common bean inoculated with H. seropedicae SMR1 suggested that this bacterium has a negative effect on the growth of P. vulgaris.
Directory of Open Access Journals (Sweden)
Haroldo Rodrigues da Cunha
2007-09-01
Full Text Available
An experiment was carried out to test the effect of organic manure (swine slurry on common beans (Phaseolus vulgaris L. grain yield, CV. Carioca, on a red latossol, with low fertility, high acidity (pH = 4.8, medium aluminum toxicity (0.5 me/100 ml, medium contents of P (6.1 ppm and K+ (53 ppm and low contents of calcium plus magnesium (1.1 me/100ml at the Federal University of Goiás, School of Agronomy, Goiânia, Goiás. A randomized block design with four repetitions was used and the treatments: KPK dressing (T1; liming (T2; swine slurry (T3; NPK dressing + liming + swine slurry (T4 and NPK dressing + liming. The following average grain yield (kg/ha were obtained: T2 (liming = 400.7; T1 (NPK dressing = 537.8; T3 (swine slurry = 576.4; T5 (NPK dressing + liming = 577.1 and T4 (NPK dressing + liming + swine slurry = 616.4. The “complete” treatment (T4 showed the highest grain production, whilst the others showed no significant differences among them. However, the treatment with swine slurry gained a productivity of common beans equivalent to that obtained by conventional NPK dressings used in Brazil. Due to its easy obtention, swine slurry can be used as an alternative economic choice for little growers to fertilize their common beans crops.
Conduziu-se um experimento para testar o efeito da adubação orgânica (Chorume de suíno na produção de grãos de feijão-comum (Phaseolus vulgaris L., CV. Carioca, em um solo LE de baixa fertilidade, elevada acidez (pH = 4,8, toxidez média de A1+ + + (0,5 meq./100ml, com teores médios de P (6,1 ppm e de K+ (53 ppm nas dependências da Escola de Agronomia da UFG, Goiânia, Goiás. Utilizou-se o delineamento em blocos casualizados, e os tratamentos: adubação NPK (T1, calagem (T2, chorume de suínos (T3, adubação NPK + chorume de su
Energy Technology Data Exchange (ETDEWEB)
Kanoun, M.
2002-04-15
In order to characterize and quantify, in semi-natural situation, the incidence of atmospheric pollution on some physiological and metabolic functions in plants, the aim of our work was to identify sub-cellular impact markers, in bean (Phaseolus vulgaris L.), able to characterize a chronic and realistic ozone pollution climate. Two criteria were chosen: the foliar phenolic metabolism and the Rubisco, the key enzyme of photosynthesis. Using Open Top Chambers system, we demonstrated that, according to concentration, exposure kinetic and leaf type, ozone could induce amount variations of some constitutive soluble phenolic and the synthesis of new phenolic (iso-flavonoids). In some cases, these disturbances were observed jointly with foliar injuries and/or biomass reduction. Concurrently, this chronic and moderate ozone exposure could also induce carbonyl formation in amino acid residues constitutive of Rubisco small subunit (Rubisco-SSU) and a reduction in the amount of the native Rubisco. The amount of a constitutive kaempferol glucuronide and the ozone-induced oxidative alteration of Rubisco-SSU were selected and tested for the construction of dose-response relationships. Whatever the marker, the linear model was able to describe the relation. For the phenolic response, several exposure indexes were tested. According to their mode of calculation, these exposure forms emphasize more or less the contribution of high ozone concentrations. If, for Rubisco oxidation, the use of the exposure index AOT40 seems relevant, in the case of the phenolic marker, the choice of the right index is leaf type dependant. (author)
International Nuclear Information System (INIS)
Suhet, A.R.
1976-09-01
A study is made of the effects of iron and zinc on yield and chemical composition of common bean (phaseolus vulgaris L.) and on atmospheric nitrogen fixation in three soils, classified as Terra Roxa Estruturada (TRE), Latossol Vermelho Escuro (LVE) and Podzolico Vermelho Amarelo (PVA). The coefficient of utilization of these micronutrients by this crop and their distribution in the aerial part and in the roots were also assessed. There was no influence of treatments of iron and zinc on yield of aerial parts and also on the weight and number of modules. There was significative effect of treatments on nitrogen, potassium, calcium, magnesium and zinc contents in aerial parts and on nitrogen, calcium and zinc contents in the root. (A.R.) [pt
Directory of Open Access Journals (Sweden)
Juan Alberto Resendiz Vazquez
2015-01-01
Full Text Available The purpose of this study was to evaluate the effect of dehydration conditions on the chemical, physical, and rehydration properties of instant whole beans (Phaseolus vulgaris L. var. Azufrado using a 22 factorial design (air temperature: 25°C and 30°C, air velocity: 0.5 m/s and 1.0 m/s. To determine the kinetic parameters, the rehydration data were fitted to three models: Peleg’s, First Order, and Sigmoid. The protein, fat, and ash contents of the beans were not significantly affected (P>0.05 by the dehydration conditions. Of the 11 physical properties of the instant whole beans, only water activity and splitting were significantly affected by dehydration conditions (P0.05 between the observed and predicted equilibrium moisture contents of the instant whole beans. Regarding the rehydration kinetics for the instant whole beans, the activation energy values ranged from 23.56 kJ/mol to 30.48 kJ/mol, depending on the dehydration conditions. The dehydration conditions had no significant effect (P>0.05 on the rehydration properties of instant whole beans.
Victoria H. Del Pino; Franco M. Lajolo
2003-01-01
Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L.) sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró e...
International Nuclear Information System (INIS)
Cen Yan-Ping.
1993-01-01
In order to follow some of the changes induced by ultraviolet-B (UV-B, 280-320 nm) radiation in Phaseolus vulgaris and Brassica napus, experiments were designed to localize sites of changes in leaves and to correlate some of the physiological and biochemical changes with penetration of UV-B radiation. B.napus was exposed to 8.9 kJ m -2 day -1 biologically effective UV-B radiation (UV-B BE ). The penetration of UV-B radiation into the leaf was followed using a quartz fibre optic microprobe. Monochromatic radiation at 310 nm was decreased by ca 50 and 34% in the adaxial and abaxial epidermis, respectively, in plants not exposed to UV-B, whereas the radiation was decreased by ca 70 and 42%, respectively, in the same region in UV-treated plants. Polychromatic radiation showed a wavelength dependent change mainly for the collimated radiation. The results correlated with the distribution of phenolic compounds analysed from 40 μm paradermal leaf sections. The first adaxial section (40μm) contained 35% of the whole leaf sample flavonoid glycosides in control plants, and 66% in UV-treated plants. Hydroxycinnamic acid derivatives increased by 26% in UV-treated plants relative to controls. The ratio of quercetin to kaempferol derivatives increased from 0.11 in controls to 0.91 in leaves of UV-treated plants. The leaf epidermis protected the inner leaf tissue where most of the photosynthetic apparatus is located. P. vulgaris was subjected to 6.17 kJ m -2 day -1 UV-B BE with different levels of visible light. The largest UV-induced changes in photosynthesis, chlorophyll, carotenoids, UV-screening pigments, and surface leaf reflectance occurred under growth conditions of low levels of visible light together with UV radiation
Energy Technology Data Exchange (ETDEWEB)
Cen Yan-Ping
1993-12-31
In order to follow some of the changes induced by ultraviolet-B (UV-B, 280-320 nm) radiation in Phaseolus vulgaris and Brassica napus, experiments were designed to localize sites of changes in leaves and to correlate some of the physiological and biochemical changes with penetration of UV-B radiation. B.napus was exposed to 8.9 kJ m{sup -2} day{sup -1} biologically effective UV-B radiation (UV-B{sub BE}). The penetration of UV-B radiation into the leaf was followed using a quartz fibre optic microprobe. Monochromatic radiation at 310 nm was decreased by ca 50 and 34% in the adaxial and abaxial epidermis, respectively, in plants not exposed to UV-B, whereas the radiation was decreased by ca 70 and 42%, respectively, in the same region in UV-treated plants. Polychromatic radiation showed a wavelength dependent change mainly for the collimated radiation. The results correlated with the distribution of phenolic compounds analysed from 40 {mu}m paradermal leaf sections. The first adaxial section (40{mu}m) contained 35% of the whole leaf sample flavonoid glycosides in control plants, and 66% in UV-treated plants. Hydroxycinnamic acid derivatives increased by 26% in UV-treated plants relative to controls. The ratio of quercetin to kaempferol derivatives increased from 0.11 in controls to 0.91 in leaves of UV-treated plants. The leaf epidermis protected the inner leaf tissue where most of the photosynthetic apparatus is located. P. vulgaris was subjected to 6.17 kJ m{sup -2} day{sup -1} UV-B{sub BE} with different levels of visible light. The largest UV-induced changes in photosynthesis, chlorophyll, carotenoids, UV-screening pigments, and surface leaf reflectance occurred under growth conditions of low levels of visible light together with UV radiation.
International Nuclear Information System (INIS)
Rodriguez, M.G.; Escalante-Estrada, J.A.; Gonzalez, M.T.R.; Reynolds, M.P.
2006-01-01
Common bean plants (Phaseolus vulgaris L.) were grown under three phosphorous levels (0,100 & 200 kg ha-1) and under rain fed conditions with the objective to examine the association between vegetative indices (NDVI, normalized difference vegetation index; and GNDVI, green normalized difference vegetation index) and intercepted radiation, leaf area index, biomass and yield during the growing season. The maximum intercepted radiation, leaf area index (LAI) and biomass were reached during the pod filling stage {80 days after sowing (DAS)}, and the P treatment of 200 kg ha-1 showed the highest values. The high intercepted radiation was derived from an increase in LAI inducing a major biomass accumulation. Near to physiological maturity LAI decreased as a result of leaf abscission. NDVI and GNDVI were higher with P supply than without P at anthesis and pod filling stage (50 - 80 DAS). Near to physiological maturity, NDVI and GNDVI decreased in all the treatments . When the maximum intercepted radiation, LAI, and biomass production were reached during anthesis and pod filling stage, NDVI and GNDVI also had the highest values. The association between the vegetative indices and seed yield during the pod filling stage showed a linear relationship by the P supply. The relationship between GNDVI and seed yield was higher (r2 = 0.77) than the relationship between NDVI and seed yield (r2 = 0.61)
Yang, Zhong-Bao; Eticha, Dejene; Albacete, Alfonso; Rao, Idupulapati Madhusudana; Roitsch, Thomas; Horst, Walter Johannes
2012-01-01
Aluminium (Al) toxicity and drought are two major factors limiting common bean (Phaseolus vulgaris) production in the tropics. Short-term effects of Al toxicity and drought stress on root growth in acid, Al-toxic soil were studied, with special emphasis on Al–drought interaction in the root apex. Root elongation was inhibited by both Al and drought. Combined stresses resulted in a more severe inhibition of root elongation than either stress alone. This result was different from the alleviation of Al toxicity by osmotic stress (–0.60 MPa polyethylene glycol) in hydroponics. However, drought reduced the impact of Al on the root tip, as indicated by the reduction of Al-induced callose formation and MATE expression. Combined Al and drought stress enhanced up-regulation of ACCO expression and synthesis of zeatin riboside, reduced drought-enhanced abscisic acid (ABA) concentration, and expression of NCED involved in ABA biosynthesis and the transcription factors bZIP and MYB, thus affecting the regulation of ABA-dependent genes (SUS, PvLEA18, KS-DHN, and LTP) in root tips. The results provide circumstantial evidence that in soil, drought alleviates Al injury, but Al renders the root apex more drought-sensitive, particularly by impacting the gene regulatory network involved in ABA signal transduction and cross-talk with other phytohormones necessary for maintaining root growth under drought. PMID:22371077
Energy Technology Data Exchange (ETDEWEB)
Hoppler, Matthias [ETH Zurich, Laboratory of Human Nutrition, Zurich (Switzerland); Meile, Leo [ETH Zurich, Laboratory of Food Biotechnology, Zurich (Switzerland); Walczyk, Thomas [National University of Singapore, Department of Chemistry and Department of Biochemistry, Singapore (Singapore)
2008-01-15
Ferritin is the major iron storage protein in the biosphere. Iron stores of an organism are commonly assessed by measuring the concentration of the protein shell of the molecule in fluids and tissues. The amount of ferritin-bound iron, the more desirable information, still remains inaccessible owing to the lack of suitable techniques. Iron saturation of ferritin is highly variable, with a maximum capacity of 4,500 iron atoms per molecule. This study describes the direct isotopic labeling of a complex metalloprotein in vivo by biosynthesis, in order to measure ferritin-bound iron by isotope dilution mass spectrometry. [{sup 57}Fe]ferritin was produced by cloning and overexpressing the Phaseolus vulgaris ferritin gene pfe in Escherichia coli in the presence of {sup 57}FeCl{sub 2}. Recombinant ferritin was purified in a fully assembled form and contained approximately 1,000 iron atoms per molecule at an isotopic enrichment of more than 95% {sup 57}Fe. We did not find any evidence of species conversion of the isotopic label for at least 5 months of storage at -20 C. Transfer efficiency of enriched iron into [{sup 57}Fe]ferritin of 20% was sufficient to be economically feasible. Negligible amounts of non-ferritin-bound iron in the purified [{sup 57}Fe]ferritin solution allows for use of this spike for quantification of ferritin-bound iron by isotope dilution mass spectrometry. (orig.)
Directory of Open Access Journals (Sweden)
Jibao Chen
2016-10-01
Full Text Available As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter (ProT plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a cDNA sequence for ProT from common bean (Phaseolus vulgaris L. and designated the gene PvProT. The deduced amino acid sequence of PvProT showed high similarity to Bet/ProT proteins from other leguminous plants, and the highest similarity was observed with mothbean (Vigna aconitifolia L. VuProT. Relative quantification of the mRNA level of PvProT using real-time PCR analysis showed that the PvProT transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20% (w/w PEG-6000 treatment, drought-resistant plants expressed a higher level of PvProT transcripts than drought-sensitive plants. Although heterologous expression of PvProT in the Escherichia coli mutant mkh13 showed that PvProT exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that PvProT plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.
Choudhary, Neeraj; Bawa, Vanya; Paliwal, Rajneesh; Singh, Bikram; Bhat, Mohd Ashraf; Mir, Javid Iqbal; Gupta, Moni; Sofi, Parvaze A; Thudi, Mahendar; Varshney, Rajeev K; Mir, Reyazul Rouf
2018-01-01
Common bean (Phaseolus vulgaris L.) is one of the most important grain legume crops in the world. The beans grown in north-western Himalayas possess huge diversity for seed color, shape and size but are mostly susceptible to Anthracnose disease caused by seed born fungus Colletotrichum lindemuthianum. Dozens of QTLs/genes have been already identified for this disease in common bean world-wide. However, this is the first report of gene/QTL discovery for Anthracnose using bean germplasm from north-western Himalayas of state Jammu & Kashmir, India. A core set of 96 bean lines comprising 54 indigenous local landraces from 11 hot-spots and 42 exotic lines from 10 different countries were phenotyped at two locations (SKUAST-Jammu and Bhaderwah, Jammu) for Anthracnose resistance. The core set was also genotyped with genome-wide (91) random and trait linked SSR markers. The study of marker-trait associations (MTAs) led to the identification of 10 QTLs/genes for Anthracnose resistance. Among the 10 QTLs/genes identified, two MTAs are stable (BM45 & BM211), two MTAs (PVctt1 & BM211) are major explaining more than 20% phenotypic variation for Anthracnose and one MTA (BM211) is both stable and major. Six (06) genomic regions are reported for the first time, while as four (04) genomic regions validated the already known QTL/gene regions/clusters for Anthracnose. The major, stable and validated markers reported during the present study associated with Anthracnose resistance will prove useful in common bean molecular breeding programs aimed at enhancing Anthracnose resistance of local bean landraces grown in north-western Himalayas of state Jammu and Kashmir.
Dunkel, F V; Serugendo, A; Breene, W M; Sriharan, S
1995-07-01
Three plant products with known insecticidal properties, a dry extract of flowers of Chrysanthemum cinerariaefolium (Trevir.) Vis. produced in Rwanda, an ethanol extract of seeds of neem, Azadirachta indica A. Juss, and crushed leaves of Tetradenia riparia Hochst Codd, a traditional Rwandan medicine, were mixed with beans, Phaseolus vulgaris L., for storage protection. These plant-protected beans were compared with "off the shelf' beans that were being sold to consumers by the Rwandan National Agricultural Products Marketing Organization (OPROVIA). A trained sensory panel determined that beans treated with neem and C. cinerariaefolium were as acceptable after 8 months storage as those being sold throughout Rwanda by the marketing organization. Beans marketed by this organization were all treated with the standard insecticide application in Rwanda, 0.01% weight/weight pirimiphos methyl in a powder formulation. Instrumental hardness (% hard-to-cook/mean gram force) after 20 months of storage was acceptable for beans stored with neem or with C. cinerariaefolium or with the conventional government application of pirimiphos methyl. Use of either neem or C. cinerariaefolium for storage protection should not affect consumer acceptance of dry beans.
Venturelli, Gustavo L; Brod, Fábio C A; Rossi, Gabriela B; Zimmermann, Naíra F; Oliveira, Jaison P; Faria, Josias C; Arisi, Ana C M
2014-11-01
The Embrapa 5.1 genetically modified (GM) common bean was approved for commercialization in Brazil. Methods for the quantification of this new genetically modified organism (GMO) are necessary. The development of a suitable endogenous reference is essential for GMO quantification by real-time PCR. Based on this, a new taxon-specific endogenous reference quantification assay was developed for Phaseolus vulgaris L. Three genes encoding common bean proteins (phaseolin, arcelin, and lectin) were selected as candidates for endogenous reference. Primers targeting these candidate genes were designed and the detection was evaluated using the SYBR Green chemistry. The assay targeting lectin gene showed higher specificity than the remaining assays, and a hydrolysis probe was then designed. This assay showed high specificity for 50 common bean samples from two gene pools, Andean and Mesoamerican. For GM common bean varieties, the results were similar to those obtained for non-GM isogenic varieties with PCR efficiency values ranging from 92 to 101 %. Moreover, this assay presented a limit of detection of ten haploid genome copies. The primers and probe developed in this work are suitable to detect and quantify either GM or non-GM common bean.
Directory of Open Access Journals (Sweden)
Chinnannan Karthik
2016-11-01
Full Text Available Contamination of agriculture land by heavy metals is a worldwide risk that has sped up noticeably since the beginning of the industrial revolution. Hence, there arise the demands of heavy metal tolerant plant growth promoting bacterial strains for specific metal contaminated agricultural sites restoration. In this study, 36 bacterial isolates were screened out from the rhizospheric soil of Phaseolus vulgaris. Among these, two bacterial strains AR6 and AR8 were selected based on their higher Cr(VI tolerance (1200 and 1100 μg/mL, respectively and the maximum production of plant growth promoting substances. In the molecular characterization study, both the bacterial strains showed 99% homology with Cellulosimicrobium funkei KM032184. In greenhouse experiments, the exposure of Cr(VI to P.vulgaris inhibited the growth and photosynthetic pigments and increased the enzymatic and non-enzymatic antioxidant expressions. However, rhizosphere bacterial inoculations alleviated the negative effect of Cr(VI and enhanced the seed germination rate (89.54%, shoot (74.50%,root length (60%, total biomass (52.53%, chlorophyll a (15.91%, chlorophyll b (17.97%, total chlorophyll (16.58% and carotenoid content (3.59%. Moreover, bacterial inoculations stabilized and modulated the antioxidant system of P. vulgaris by reducing the accumulation of Cr in plant tissues. The present finding shows the Cr(VI tolerance and plant growth promoting properties of the rhizosphere bacterial strains which might make them eligible as biofertilizer of metal-contaminated soils.
Yin, Shou-Wei; Tang, Chuan-He; Wen, Qi-Biao; Yang, Xiao-Quan
2010-03-15
Kidney bean (Phaseolus vulgris L.) seed is an underutilised plant protein source with good potential to be applied in the food industry. Phaseolin (also named G1 globulin) represents about 50 g kg(-1) of total storage protein in the seed. The aim of the present study was to characterise physicochemical, functional and conformational properties of phaseolin, and to compare these properties with those of kidney bean protein isolate (KPI). Compared with kidney bean protein isolate (KPI), the acid-extracted phaseolin-rich protein product (PRP) had much lower protein recovery of 320 g kg(-1) (dry weight basis) but higher phaseolin purity (over 950 g kg(-1)). PRP contained much lower sulfhydryl (SH) and disulfide bond contents than KPI. Differential scanning calorimetry analyses showed that the phaseolin in PRP was less denatured than in KPI. Thermal analyses in the presence or absence of dithiothreitol, in combination with SH and SS content analyses showed the contributions of SS to the thermal stability of KPI. The analyses of near-UV circular dichroism and intrinsic fluorescence spectra indicated more compacted tertiary conformation of the proteins in PRP than in KPI. PRP exhibited much better protein solubility, emulsifying activity index, and gel-forming ability than KPI. The relatively poor functional properties of KPI may be associated with protein denaturation/unfolding, with subsequent protein aggregation. The results presented here suggest the potential for acid-extracted PRP to be applied in food formulations, in view of its functional properties.
Directory of Open Access Journals (Sweden)
Yader Mejía Bermúdez
2012-01-01
Full Text Available Este trabajo tuvo como propósito evaluar la efectividad de las diferentes dosis de un biofertilizante foliar sobre el rendimiento del cultivo de frijol común (Phaseolus vulgaris en época de postrera, en la comunidad El Cañal, Kukra River, Bluefields, en el ciclo productivo 2008-2009. Se utilizó un diseño completo al azar, cuatro tratamientos con dos repeticiones, cada repetición constó de 63 plantas de frijol (n=126. Los tratamientos fueron: T1 (testigo; T2: 0.25 litros de biofertilizante; T3: 0.37 lt. y T4: 0.5 lt. En todos los tratamientos, incluyendo al testigo, se hizo deshierbe y en todos, excepto el testigo, se aplicó el biofertilizante disuelto en 10 litros de agua. Se realizaron tres mediciones (21, 36 y 51 días después de la siembra.Los resultados indican que no existen diferencias significativas entre los tratamientos en la altura de las plantas, pero si en el porcentaje de afectación por herbívoros, así como en el número de vainas por planta y de granos por vaina. El tratamiento T4 registró el menor ataque por herbívoros, la mayor producción en función del número de vainas por planta, de granos por vaina y peso total de los granos de frijol, en cambio el testigo fue el que registró el menor rendimiento con respecto a todas estas variables. El uso del biofertilizante foliar aumentó el rendimiento del cultivo de frijol en todas las dosis.SummaryThe aim of this work was to evaluate the effectiveness of different doses of a foliar biofertilizer on crop production of common bean (Phaseolus vulgaris throughout season time in the community of El Cañal, Kukra River, Bluefields, during the production cycle 2008-2009. A random design was used, four treatments with two replications, each replication consisted of 63 bean plants (n=126. The treatments were: T1 (baton, T2: 0.25 liters of biofertilizer, T3: 0.37 lt. and T4: 0.5 lt. In all the treatments, including the baton, weeding was done, and in all except the baton
Directory of Open Access Journals (Sweden)
Baudoin J.P.
1999-01-01
Full Text Available Preliminary analysis of the situation and prospects of the Lima bean crop (Phaseolus lunatus L. in the Peruvian Coast (Valleys of Ica, Pisco and Casma. The Lima bean, Phaseolus lunatus L., is a crop of regional importance on the Peruvian Coast. Within the framework of a collaborative project between the ""faculté universitaire des Sciences agronomiques'"" in Gembloux and the ""Universidad Nacional Agraria La Molina"" in Lima, we carried out a diagnosis of this speculation in the Ica, Pisco and Casma valleys in order to define the constraints which limit crop yields and to suggest improvements within the reach of the smallholders. To achieve these objectives we carried out a formal survey, centred on the Lima bean crop and smallholder relations with the agro-socio-economical environment, and an informal survey, centred on the studied farm systems. To complete these data we met some key informants belonging to all the sectors in contact with agriculture. This study allowed us to identify five undersystems in the farm systems of the Peruvian Coastal Valleys. These undersystems are: cotton, commercial food crops, self-subsistence food crops, livestock and fruit trees. The Lima bean usually belongs to the commercial food crops undersystem. There are two types of constraints. External constraints affect all the components of the farm system and are mainly: end of State support to agriculture, liberalization of trade and unavailability of credit. Internal constraints directly affect the Lima bean crop. Low income leads to a deficiency in pest control and adequate crop management. The Lima bean is also in competition with other components of the system such as cotton and common beans
Energy Technology Data Exchange (ETDEWEB)
Voorman, R; Penner, D
1986-09-01
(/sup 14/C)-MBOCA was absorbed by cabbage (Brassica oleracea L.), bean (Phaseolus vulgaris L.), and sugar beet (Beta vulgaris L.) leaves, but did not move beyond the absorption point. Radio autographs of bean, sorghum (Sorghum vulgare Pers.), orchard grass (Dactylis glomerata L.) and carrot (Daucus carrota L.) plants exposed to (/sup 14/C)-MBOCA via hydroponic culture showed considerable radioactivity associated with the roots with only limited translocation of (/sup 14/C) into upper plant parts. Bean and cucumber (Cucumis sativa L.) plants grown in (/sup 14/C)-MBOCA amended soil translocated virtually no (/sup 14/C) into aerial parts, but again considerable radioactivity was found on roots. Radioactivity could not be rinsed off roots with water or acetone, and a small amount of radioactivity was observed in the xylem-phloem layer of the carrot root.
Directory of Open Access Journals (Sweden)
Anna Siedlecka
2014-01-01
Full Text Available The interaction between cadmium, one of the most toxic heavy metals, and iron, an essential plant nutritional element, was investigated in Phaseolus vulgaris L. (cv. Słowianka seedlings. The interaction was externally induced by changing the content of both metals in the nutrient medium. Under iron deficiency conditions (0 and 0.5 of normal dose of this element, the toxic effects of cadmium on plant growth parameters, like fresh and dry weight accumulation, primary leaves area, etc., were generally much more pronounced than under normal iron supply. At normal and excess iron supply (1, 2 and 4 doses cadmium diminished iron accumulation in roots and primary leaves, but on the other hand excess iron decreased cadmium level, preventing plants from extreme toxicity of very high cadmium concentrations in the growth environment. It is to be noted that iron is classified also as a heavy metal, and its excess may become toxic, e.g. decreasing root dry weight or diminishing leaf area, especially at the highest dose. The detoxication role of iron against cadmium, and possibly other toxic metals is, however, limited to concentrations of this element in the nutrient solution which themselves are not toxic for the organism.
Mbofung, C M; Rigby, N; Waldron, K
1999-01-01
Koki is a nutritious cowpea-based food product usually processed by steam cooking whipped cowpea (Vigna unguiculata) paste mixed with spices and palm oil. A study was carried out to investigate the effect of the partial replacement of cowpeas (CP) with hard-to-cook (HTC) beans on the chemical, nutritional and sensory characteristics of koki. Towards this objective, two varieties of beans--Phaseolus vulgaris (red kidney beans--RKB and mottled brown beans--MBB), each with the HTC defect, were separately incorporated into cowpea paste in the following Bean:CP ratios 0:100, 20:80, 30:70, 40:60, 50:50, 60:40 and processed into koki. Incorporation of dry HTC beans into cowpeas in the making of koki affected the bulking properties of the uncooked paste, the nutrient composition, essential amino acid content, antinutritional factors, digestibility as well as the sensory attributes of cooked koki. Sensory tests showed that a highly acceptable, nutritious and digestible koki can be processed from cowpeas partially replaced with dry HTC bean paste up to levels of about 40-50% depending on the variety of dry bean used.
Directory of Open Access Journals (Sweden)
Daniel J Ballhorn
Full Text Available Plant associations with root microbes represent some of the most important symbioses on earth. While often critically promoting plant fitness, nitrogen-fixing rhizobia and arbuscular mycorrhizal fungi (AMF also demand significant carbohydrate allocation in exchange for key nutrients. Though plants may often compensate for carbon loss, constraints may arise under light limitation when plants cannot extensively increase photosynthesis. Under such conditions, costs for maintaining symbioses may outweigh benefits, turning mutualist microbes into parasites, resulting in reduced plant growth and reproduction. In natural systems plants commonly grow with different symbionts simultaneously which again may interact with each other. This might add complexity to the responses of such multipartite relationships. We experimented with lima bean (Phaseolus lunatus, which efficiently forms associations with both types of root symbionts. We applied full light and low-light to each of four treatments of microbial inoculation. After an incubation period of 14 weeks, we quantified vegetative aboveground and belowground biomass and number and viability of seeds to determine effects of combined inoculant and light treatment on plant fitness. Under light-limited conditions, vegetative and reproductive traits were inhibited in AMF and rhizobia inoculated lima bean plants relative to controls (un-colonized plants. Strikingly, reductions in seed production were most critical in combined treatments with rhizobia x AMF. Our findings suggest microbial root symbionts create additive costs resulting in decreased plant fitness under light-limited conditions.
Víquez Rodríguez, Floribeth; Bonilla Leiva, Ana Ruth
2000-01-01
El propósito de este estudio fue determinar, mediante un estudio de digestibilidad in vitro, la porción indigerible presente en dos variedades de frijol común Phaseolus vulgaris L. consumidas en Costa Rica y cuantificar en dicha porción, dos de los principales polisacáridos no almidonosos causantes de flatulencia: pectina y celulosa. Se determinaron además, las principales características físicas (tamaño y tasa de absorción de agua) y químicas (contenido de proteínas, grasa, cenizas y carbohi...
Moreira, Xoaquín; Abdala-Roberts, Luis; Hernández-Cumplido, Johnattan; Cuny, Maximilien A C; Glauser, Gaetan; Benrey, Betty
2015-08-01
• Following herbivore attack, plants can either reduce damage by inducing defenses or mitigate herbivory effects through compensatory growth and reproduction. It is increasingly recognized that such induced defenses in plants are herbivore-specific, but less is known about the specificity of compensatory responses. Damage by multiple herbivores may also lead to synergistic effects on induction and plant fitness that differ from those caused by a single herbivore species. Although largely unstudied, the order of arrival and damage by different herbivore species might also play an important role in the impacts of herbivory on plants.• We investigated the specificity of defense induction (phenolics) and effects on growth (number of stems and leaves) and reproduction (number of seeds, seed mass, and germination rate) from feeding by two generalist leaf-chewing herbivores (Spodoptera eridania and Diabrotica balteata) on Phaseolus lunatus plants and evaluated whether simultaneous attack by both herbivores and their order of arrival influenced such dynamics.• Herbivory increased levels of leaf phenolics, but such effects were not herbivore-specific. In contrast, herbivory enhanced seed germination in an herbivore-specific manner. For all variables measured, the combined effects of both herbivore species did not differ from their individual effects. Finally, the order of herbivore arrival did not influence defense induction, plant growth, or seed number but did influence seed mass and germination.• Overall, this study highlights novel aspects of the specificity of plant responses induced by damage from multiple species of herbivores and uniquely associates such effects with plant lifetime fitness. © 2015 Botanical Society of America, Inc.
Yin, Shou-Wei; Tang, Chuan-He; Wen, Qi-Biao; Yang, Xiao-Quan; Li, Lin
2008-10-15
The effects of high-pressure (HP) treatment at 200-600MPa, prior to freeze-drying, on some functional properties and in vitro trypsin digestibility of vicilin-rich red kidney bean (Phaseolus vulgaris L.) protein isolate (KPI) were investigated. Surface hydrophobicity and free sulfhydryl (SH) and disulfide bond (SS) contents were also evaluated. HP treatment resulted in gradual unfolding of protein structure, as evidenced by gradual increases in fluorescence strength and SS formation from SH groups, and decrease in denaturation enthalpy change. The protein solubility of KPI was significantly improved at pressures of 400MPa or higher, possibly due to formation of soluble aggregate from insoluble precipitate. HP treatment at 200 and 400MPa significantly increased emulsifying activity index (EAI) and emulsion stability index (ESI); however, EAI was significantly decreased at 600MPa (relative to untreated KPI). The thermal stability of the vicilin component was not affected by HP treatment. Additionally, in vitro trypsin digestibility of KPI was decreased only at a pressure above 200MPa and for long incubation time (e.g., 120min). The data suggest that some physiochemical and functional properties of vicilin-rich kidney proteins can be improved by means of high-pressure treatment. Copyright © 2008 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kasina, M.; Nderitu, J.; Nyamasyo, G.; Waturu, C.; Olubayo, F.; Obudho, E.; Yobera, D.
2009-07-01
The aim of this research was to study spatial distribution of flower thrips on French beans (Phaseolus vulgaris L.) in Kenya. Their build up and seasonal population dynamics was monitored using sticky blue colour traps and sampling of leaves and flowers in two seasons in 2002. Thrips infested French beans from the second week after crop emergence. Their population peaked at peak flowering. The sticky trap catches were linearly related to the actual presence of thrips on the crop and could estimate population build up of adult thrips on leaves and flowers. On the plants, most adults were on flowers. Larvae mainly inhabited leaves, buds and pods. The two thrips species, Frankliniella occidentalis (Pergande) and Megalurothrips sjostedti Trybom were spatially separated. The former colonized lower-canopy leaves and early flowers while the latter inhabited middle-canopy leaves and mature flowers. Overall, M. sjostedti was less than 5% of the total thrips population, implying that F. occidentalis was the main thrips pest of French beans. This study suggests that French bean growers should monitor thrips population before initiating any control measure. In addition, they should commence thrips control early, at pre-flowering, using larvicides to reduce the thrips pool and their migration to flowers. A combination of monitoring with sticky traps and proper sampling would contribute to sustainable thrips management. (Author) 36 refs.
Directory of Open Access Journals (Sweden)
Ulacio Osorio Dilcia
2013-02-01
Full Text Available The effect of chemical, physical, biologycal and cultural strategies individually or combinated were evaluated in the epidemiology of the basal rot (Sclerotium rolfsii, charcoal rot (Macrophomina phaseolina and the Phaseolus vulgaris cv Tacarigua yield at Barinas state from Venezuela. In the experiment, Tebuconazole (Teb was applicated at seed (1 L/Ton and at soil, a los 30 y 60 days after of the sow (1 L/ha; Trichoderma harzianum (Tri was applicated at seed (15 g for each 1.5 k and to 15, 30, 45 y 60 days after of the sow (30 g/10 L of water. On the other hand, soil was solarizated (Sol during 15 days and calcium nitrate (Ca (60 g/10 L of water was applicated each 15 days until 60 days of growth of cultivated plants. Basal rot was registered as far as 42 days after of the sow, showing less of 5.3% in Teb y the combination SolTeb. The hightest incidence of this disease was observed in the treatment Tri with 28.5%, being highter that control (14.5%. Last to 42 days predominated the charcoal rot in the rest of the plants for a total of 100% of incidente in everything the treatments. Nevertheless, Teb showed the hightest yield with 555 k/ha, being different estatistically at treatment TriCa, which showed the lowest yield with 31 k/ha, however, the roots not formed nodules nitrogen uptake in these replications with the fungicide and Ca. It is concluded that S. rolfsii was sensible at action of some of the treatments; but not M. phaseolina; nevertheless, the plants were capables to produce seeds health apparently in treatments in which observed less severity of charcoal rot.
International Nuclear Information System (INIS)
Reddy, S.J.
1978-01-01
Experiments were conducted with day-old broiler type chicks to study the effect of a cobalt-60 source of gamma irradiation and autoclaving on nutritional value of dry field beans (Phaseolus vulgaris). The variability in nutritional value of varieties and breeding lines of dry field beans and peas was also studied. Total protein (N x 6.25) was not changed appreciably by gamma irradiation (21 Mrad cobalt-60) and autoclaving but solubility in water was decreased. In vitro enzymic digestibility of irradiated bean protein was increased by pepsin alone and with a mixture of trypsin, chymotrypsin and peptidase. The nutritional value of all varieties of beans, based on chick growth, was significantly improved by gamma irradiation. The irradiated treatment of beans increased nitrogen retention by chicks and decreased uric acid nitrogen excretion in relation to nitrogen intake
Maougal, Rim Tinhinen; Bargaz, Adnane; Sahel, Charaf; Amenc, Laurie; Djekoun, Abdelhamid; Plassard, Claude; Drevon, Jean-Jacques
2014-04-01
Soil organic phosphorus (Po) such as phytate, which comprises up to 80 % of total Po, must be hydrolyzed by specific enzymes called phytases to be used by plants. In contrast to plants, bacteria, such as Bacillus subtilis, have the ability to use phytate as the sole source of P due to the excretion of a beta-propeller phytase (BPP). In order to assess whether the B. subtilis BPP could make P available from phytate for the benefit of a nodulated legume, the P-sensitive recombinant inbred line RIL147 of Phaseolus vulgaris was grown under hydroaeroponic conditions with either 12.5 μM phytate (C₆H₁₈O₂₄P₆) or 75 μmol Pi (K₂HPO₄), and inoculated with Rhizobium tropici CIAT899 alone, or co-inoculated with both B. subtilis DSM 10 and CIAT899. The in situ RT-PCR of BPP genes displayed the most intense fluorescent BPP signal on root tips. Some BPP signal was found inside the root cortex and the endorhizosphere of the root tip, suggesting endophytic bacteria expressing BPP. However, the co-inoculation with B. subtilis was associated with a decrease in plant P content, nodulation and the subsequent plant growth. Such a competitive effect of B. subtilis on P acquisition from phytate in symbiotic nitrogen fixation might be circumvented if the rate of inoculation were reasoned in order to avoid the inhibition of nodulation by excess B. subtilis proliferation. It is concluded that B. subtilis BPP gene is expressed in P. vulgaris rhizosphere.
Directory of Open Access Journals (Sweden)
Samira eMafi Moghaddam
2014-05-01
Full Text Available Next generation sequence data provides valuable information and tools for genetic and genomic research and offers new insights useful for marker development. This data is useful for the design of accurate and user-friendly molecular tools. Common bean (Phaseolus vulgaris L. is a diverse crop in which separate domestication events happened in each gene pool followed by race and market class diversification that has resulted in different morphological characteristics in each commercial market class. This has led to essentially independent breeding programs within each market class which in turn has resulted in limited within market class sequence variation. Sequence data from selected genotypes of five bean market classes (pinto, black, navy, and light and dark red kidney were used to develop InDel-based markers specific to each market class. Design of the InDel markers was conducted through a combination of assembly, alignment and primer design software using 1.6x to 5.1x coverage of Illumina GAII sequence data for each of the selected genotypes. The procedure we developed for primer design is fast, accurate, less error prone, and higher throughput than when they are designed manually. All InDel markers are easy to run and score with no need for PCR optimization. A total of 2,687 InDel markers distributed across the genome were developed. To highlight their usefulness, they were employed to construct a phylogenetic tree and a genetic map, showing that InDel markers are reliable, simple, and accurate.
Metabolic origin of the {delta}{sup 13}C of respired CO{sub 2} in roots of Phaseolus vulgaris
Energy Technology Data Exchange (ETDEWEB)
Bathellier, C.; Tcherkez, G.; Cornic, G.; Ghashghaie, J. [Laboratoire d' Ecologie, Systematique et Evolution - ESE, CNRS-UMR 8079 - IFR 87, Batiment 362, Universite Paris-Sud, 91405-Orsay Cedex (France); Tcherkez, G. [Plateforme Metabolisme-Metabolome, IFR87 La Plante et son Environnement, Institut de Biotechnologie des Plantes, Batiment 630, Universite Paris-Sud, 91405-Orsay Cedex (France); Bligny, R.; Gout, E. [Laboratoire de Physiologie Cellulaire Vegetale CEA-Grenoble 17, rue des Martyrs, 38054 Grenoble Cedex 9 (France)
2009-07-01
- Root respiration is a major contributor to soil CO{sub 2} efflux, and thus an important component of ecosystem respiration. But its metabolic origin, in relation to the carbon isotope composition ({delta}{sup 13}C), remains poorly understood. - Here, {sup 13}C analysis was conducted on CO{sub 2} and metabolites under typical conditions or under continuous darkness in French bean (Phaseolus vulgaris) roots. {sup 13}C contents were measured either under natural abundance or following pulse-chase labeling with {sup 13}C-enriched glucose or pyruvate, using isotope ratio mass spectrometer (IRMS) and nuclear magnetic resonance (NMR) techniques. - In contrast to leaves, no relationship was found between the respiratory quotient and the {delta}{sup 13}C of respired CO{sub 2}, which stayed constant at a low value (c. -27.5 per thousand) under continuous darkness. With labeling experiments, it is shown that such a pattern is explained by the {sup 13}C-depleting effect of the pentose phosphate pathway; and the involvement of the Krebs cycle fueled by either the glycolytic input or the lipid/protein recycling. The anaplerotic phosphoenolpyruvate carboxylase (PEPc) activity sustained glutamic acid (Glu) synthesis, with no net effect on respired CO{sub 2}. - These results indicate that the root {delta}{sup 13}C signal does not depend on the availability of root respiratory substrates and it is thus plausible that, unless the {sup 13}C photosynthetic fractionation varies at the leaf level, the root {delta}{sup 13}C signal hardly changes under a range of natural environmental conditions. (authors)
Kumar, Vinod; Chopra, A K
2014-11-01
Ferti-irrigation response of 5, 10, 25, 50, 75, and 100 % concentrations of the sugar mill effluent (SME) on French bean (Phaseolus vulgaris L., cv. Annapurna) in the rainy and summer seasons was investigated. The fertigant concentrations produced significant (P potassium (K(+)), calcium (Ca(2+)), magnesium (Mg(2+)), total Kjeldahl nitrogen (TKN), phosphate (PO4 (3-)), sulfate (SO4 (2-)), ferrous (Fe(2+)), cadmium (Cd), chromium (Cr), copper (Cu), manganese (Mn), and zinc (Zn), in both seasons. The contents of Cr, Cu, Mn, and Zn except Cd were found to be below the maximum levels permitted for soils in India. The agronomic performance of P. vulgaris was gradually increased at lower concentrations, i.e., from 5 to 25 %, and decreased at higher concentrations, i.e., from 50 to 100 %, of the SME in both seasons when compared to controls. The accumulations of heavy metals were increased in the soil and P. vulgaris from 5 to 100 % concentrations of the SME in both seasons. The contents of Cu, Mn, and Zn except Cd and Cr were noted under the permissible limit of Food and Agriculture Organization (FAO)/World Health Organization (WHO) standards. Most contents of biochemical components like crude proteins, crude fiber, and total carbohydrates were found with 25 % concentration of the SME in both seasons. The contamination factor (Cf) of various metals was in the order of Cd > Cr > Zn > Mn > Cu for soil and Mn > Zn > Cu > Cr > Cd for P. vulgaris in both seasons after fertigation with SME. Therefore, the SME can be used to improve the soil fertility and yield of P. vulgaris after appropriate dilution.
Directory of Open Access Journals (Sweden)
Dávila Guillermo
2007-07-01
Full Text Available Abstract Background Fabaceae (legumes is one of the largest families of flowering plants, and some members are important crops. In contrast to what we know about their great diversity or economic importance, our knowledge at the genomic level of chloroplast genomes (cpDNAs or plastomes for these crops is limited. Results We sequenced the complete genome of the common bean (Phaseolus vulgaris cv. Negro Jamapa chloroplast. The plastome of P. vulgaris is a 150,285 bp circular molecule. It has gene content similar to that of other legume plastomes, but contains two pseudogenes, rpl33 and rps16. A distinct inversion occurred at the junction points of trnH-GUG/rpl14 and rps19/rps8, as in adzuki bean 1. These two pseudogenes and the inversion were confirmed in 10 varieties representing the two domestication centers of the bean. Genomic comparative analysis indicated that inversions generally occur in legume plastomes and the magnitude and localization of insertions/deletions (indels also vary. The analysis of repeat sequences demonstrated that patterns and sequences of tandem repeats had an important impact on sequence diversification between legume plastomes and tandem repeats did not belong to dispersed repeats. Interestingly, P. vulgaris plastome had higher evolutionary rates of change on both genomic and gene levels than G. max, which could be the consequence of pressure from both mutation and natural selection. Conclusion Legume chloroplast genomes are widely diversified in gene content, gene order, indel structure, abundance and localization of repetitive sequences, intracellular sequence exchange and evolutionary rates. The P. vulgaris plastome is a rapidly evolving genome.
Enomoto, Hirofumi; Sensu, Takuya; Sato, Kei; Sato, Futoshi; Paxton, Thanai; Yumoto, Emi; Miyamoto, Koji; Asahina, Masashi; Yokota, Takao; Yamane, Hisakazu
2017-02-01
The plant hormone abscisic acid (ABA) and the jasmonic acid related-compound 12-oxo-phytodienoic acid (OPDA) play crucial roles in seed development, dormancy, and germination. However, a lack of suitable techniques for visualising plant hormones has restricted the investigation of their biological mechanisms. In the present study, desorption electrospray ionisation-imaging mass spectrometry (DESI-IMS), a powerful tool for visualising metabolites in biological tissues, was used to visualise ABA and OPDA in immature Phaseolus vulgaris L. seed sections. The mass spectra, peak values and chemical formulae obtained from the analysis of seed sections were consistent with those determined for ABA and OPDA standards, as were the precursor and major fragment ions observed in tandem mass spectrometry (MS/MS) imaging. Furthermore, the precursor and fragment ion images showed similar distribution patterns. In addition, the localisation of ABA and OPDA using DESI-IMS was confirmed using liquid chromatography-MS/MS (LC-MS/MS). The results indicated that ABA was mainly distributed in the radical and cotyledon of the embryo, whereas OPDA was distributed exclusively in external structures, such as the hilum and seed coat. The present study is the first to report the visualisation of plant hormones using IMS, and demonstrates that DESI-IMS is a promising technique for future plant hormone research.
DEFF Research Database (Denmark)
Vrang, Niels; Mrosovsky, N.; Mikkelsen, Jens D.
2003-01-01
Circadian rhythms, Suprachiasmatic nucleus, Cholera toxin B, Phaseolus vulgaris-leucoagglutinin, Nonphotic......Circadian rhythms, Suprachiasmatic nucleus, Cholera toxin B, Phaseolus vulgaris-leucoagglutinin, Nonphotic...
Beans (Phaseolus spp.) - model food legumes
International Nuclear Information System (INIS)
Broughton, W.J.; Hemandez, H.; Blair, M.; Beebe, S.; Gepts, P.; Vanderleyden, J.
2001-01-01
Globally, 800 million people are malnourished. Heavily subsidised farmers in rich countries produce sufficient surplus food to feed the hungry, but not at a price the poor can afford. Even donating the rich world's surplus to the poor would not solve the problem. Most poor people earn their living from agriculture, so a deluge of free food would destroy their livelihoods. Thus, the only answer to world hunger is to safeguard and improve the productivity of farmers in poor countries. Diets of subsistence level farmers in Africa and Latin America often contain sufficient carbohydrates (through cassava, corn/maize, rice, wheat, etc.), but are poor in proteins. Dietary proteins can take the form of scarce animal products (eggs, milk, meat, etc.), but are usually derived from legumes (plants of the bean and pea family). Legumes are vital in agriculture as they form associations with bacteria that 'fix-nitrogen' from the air. Effectively this amounts to internal fertilisation and is the main reason that legumes are richer in proteins than all other plants. Thousands of legume species exist but more common beans (Phaseolus vulgaris L.) are eaten than any other. In some countries such as Mexico and Brazil, beans are the primary source of protein in human diets. As half the grain legumes consumed worldwide are common beans, they represent the species of choice for the study of grain legume nutrition. Unfortunately, the yields of common beans are low even by the standards of legumes, and the quality of their seed proteins is sub-optimal. Most probably this results from millennia of selection for stable rather than high yield, and as such, is a problem that can be redressed by modem genetic techniques. We have formed an international consortium called 'Phaseomics' to establish the necessary framework of knowledge and materials that will result in disease-resistant, stress-tolerant, high-quality protein and high-yielding beans. Phaseomics will be instrumental in improving
Mingote, Raquel M; Nogueira, Regina A
2016-10-01
A survey of 210 Pb activity concentration, one of the major internal natural radiation sources to man, has been carried in the most common species of beans (Phaseolus vulgaris L.) grown and consumed in Brazil. The representative bean types chosen, Carioca beans and black type sown in the Brazilian Midwestern and Southern regions, have been collected in this study and 210 Pb determined by liquid scintillation spectrometry after separation with chromatographic extraction using Sr-resin. Available values in data set of radioactivity in Brazil (GEORAD) on the 210 Pb activity concentration in black beans grown in Southeastern region have been added to the results of this study with the purpose of to amplify the population considered. Concerning the multiple detection limits and due to the high level of censored observations, a robust semi-parametric statistical method called regression on order statistics (ROS) has been employed to provide a reference value of the 210 Pb in Brazilian beans, which amounted to 41 mBq kg -1 fresh wt. The results suggest that the 210 Pb activity concentration in carioca beans is lower than in black beans. Also evaluated was the 210 Pb activity concentration in vegetable component of a typical diet, which displays lower values than those shown in the literature for food consumed in Europe. Copyright © 2016 Elsevier Ltd. All rights reserved.
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-01-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote. PMID:19218416
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-04-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote.
Directory of Open Access Journals (Sweden)
Rolando Ramírez Olivera
2010-01-01
Full Text Available Argumenta la evaluación de algunas alternativas de nutrición en el frijol común (Phaseolus vulgaris, L., variedad Velasco Largo, que se desarrolló en áreas de la subestación de Granos de la Unidad de Extensión, Investigación y Capacitación Agropecuaria de Holguín (UEICA-H, ubicada en Velasco, municipio de Gibara, provincia de Holguín, en el periodo comprendido entre diciembre de 2007 y marzo de 2008. Se aplicaron seis (6 variantes de fertilización, que comprendió el uso de fertilizantes químicos a dosis menores que las recomendadas, la utilización de abonos orgánicos: humus de lombriz tanto sólido como líquido y el biofertilizante Ecomic. Se tomaron mediciones de altura de las plantas, nodulación y rendimiento y sus componentes, así como, se realizó un análisis económico en base a los rendimientos obtenidos. Los resultados mostraron que la utilización de diferentes alternativas de fertilización provocó un efecto directo sobre el crecimiento de las plantas de frijol, sobre la nodulación natural y el rendimiento y sus componentes, los mismos sugieren la utilización de combinaciones de fertilizantes químicos, orgánicos y biofertilizantes para la obtención de altos rendimientos de forma sostenible en el cultivo del frijol.
Directory of Open Access Journals (Sweden)
Rodino A.P.
1999-01-01
Full Text Available Common bean (Phaseolus vulgaris L. is widely intercropped with maize (Zea mays L. in the North of Spain. Breeding beans for multiple cropping systems is important for the development of a productive and sustainable agriculture, and is mainly oriented to minimize intercrop competition and to stabilize complementarity with maize. Most agricultural research on intercropping to date has focused on the agronomic and overall yield effects of the different species, but characters related with socio-economic and food quality aspects are also important. The effect of intercropping beans with maize on food seed quality traits was studied for thirty-five bush bean varieties under different environments in Galicia (Northwestern Spain. Parameters determining Asturian (Northern Spain white bean commercial and culinary quality have also been evaluated in fifteen accessions. There are significant differences between varieties in the selected cropping systems (sole crop, intercrop with field maize and intercrop with sweet maize for dry and soaked seed weight, coat proportion, crude protein, crude fat and moisture. Different white bean accessions have been chosen according to their culinary quality. Under these environmental conditions it appears that intercropping systems with sweet maize give higher returns than sole cropping system. It is also suggested that the culinary and nutritional quality potential of some white bean accessions could be the base material in a breeding programme the objectives of which are to develop varieties giving seeds with high food quality.
Directory of Open Access Journals (Sweden)
Meaghan J. Wilton
2017-12-01
Full Text Available To ease food insecurities in northern Canada, some remote communities started gardening initiatives to gain more access to locally grown foods. Bush beans (Phaseolus vulgaris L. and potatoes (Solanum tuberosum L. were assessed for N, P, K, Mg, and Ca concentrations of foliage as indicators of plant nutrition in a calcareous silty loam soil of northern Ontario James Bay lowlands. Crops were grown in sole cropping and intercropping configurations, with comparisons made between an open field and an agroforestry site enclosed with willow (Salix spp. trees. Foliage chemical analysis of the sites revealed an abundance of Ca, adequacies for Mg and N, and deficiencies in P and K. Intercropping bean and potato did not show significant crop–crop facilitation for nutrients. The agroforestry site showed to be a superior management practice for the James Bay lowland region, specifically for P. The agroforestry site had significantly greater P for bean plant (p = 0.024 and potato foliage (p = 0.002 compared to the open site. It is suspected that the presence of willows improve plant available P to bean and potatoes by tree root—crop root interactions and microclimate enhancements.
Energy Technology Data Exchange (ETDEWEB)
Satoh, S; Matsuda, K; Tamari, K
1976-12-01
A small amount of cytoplasmic ..beta..-1,4-glucan, which might be involved in the synthesis of cellulose in the cell wall, was found in the homogenate prepared from the hypocotyls of seedlings of Phaseolus aureus. Upon hydrolysis by cellulase of the 20,000xg pellet from the cytoplasmic fraction of segments incubated in a (/sup 14/C)-glucose solution, (/sup 14/C)-cellobiose was produced, with specific radioactivities 3 to 10 times greater than those of the cellobiose from cellulose in the cell wall at various incubation periods. The incoporation of radioactivity from (/sup 14/C)-glucose into this cytoplasmic ..beta..-1,4-glucan was therefore faster than that into cellulose constituting the cell wall. Hence, it seemed that the former ..beta..-1,4-glucan could be turned over. To examine whether the cytoplasmic ..beta..-1,4-glucan is carried by some subcellular components, cytoplasmic ..beta..-1,4-glucan in the cell was fractionated by differential centrifugation, two enzyme activities being measured as the markers of subcellular components. The distribution of ..beta..-1,4-glucan was similar to that of UDPG-glucosyl-transferase activity but not to that of IDP-ase activity. The result suggests that the cytoplasmic ..beta..-1,4-glucan has some relation to plasma membranes. Coumarin, known as a specific inhibitor for the biosynthesis of cellulose in plant cells, was shown to inhibit the incorporation of radio-carbon from (/sup 14/C)-glucose into cytoplasmic ..beta..-1,4-glucan to the same extent as that into cellulose in the cell wall of the hypocotyls.
Directory of Open Access Journals (Sweden)
Carolina eRípodas
2015-01-01
Full Text Available In the past decade, plant nuclear factor Y (NF-Y genes have gained major interest due to their roles in many biological processes in plant development or adaptation to environmental conditions, particularly in the root nodule symbiosis established between legume plants and nitrogen fixing bacteria. NF-Ys are heterotrimeric transcriptional complexes composed of three subunits, NF-YA, NF-YB and NF-YC, which bind with high affinity and specificity to the CCAAT box, a cis element present in many eukaryotic promoters. In plants, NF-Y subunits consist of gene families with about ten members each. In this study, we have identified and characterized the NF-Y gene families of common bean (Phaseolus vulgaris, a grain legume of worldwide economical importance and the main source of dietary protein of developing countries. Expression analysis showed that some members of each family are up-regulated at early or late stages of the nitrogen fixing symbiotic interaction with its partner Rhizobium etli. We also showed that some genes are differentially accumulated in response to inoculation with high or less efficient R. etli strains, constituting excellent candidates to participate in the strain-specific response during symbiosis. Genes of the NF-YA family exhibit a highly structured intron-exon organization. Moreover, this family is characterized by the presence of upstream ORFs when introns in the 5' UTR are retained and miRNA target sites in their 3' UTR, suggesting that these genes might be subjected to a complex post-transcriptional regulation. Multiple protein alignments indicated the presence of highly conserved domains in each of the NF-Y families, presumably involved in subunit interactions and DNA binding. The analysis presented here constitutes a starting point to understand the regulation and biological function of individual members of the NF-Y families in different developmental processes in this grain legume.
Directory of Open Access Journals (Sweden)
Meilla Dwi Andrestian
2015-06-01
Mung bean milk is one of the diversification of processed mung beans. The process of making mung bean milk using Ultra High Temperature (UHT is abundantly sold in the market. As another alternative to have a high shelf life, it needs the addition of natural preservatives such as red ginger. In general, this research aim was to determine the effect of addition of the percentage of red ginger extract (Zingiber officinale var. Rubrum on storability of green beans milk (Phaseolus radiatus L.. This research consisted of two phases, preliminary research and main research. The former stage was conducted to determine the best acceptability of nine treatment variations of red ginger extract addition. After preliminary research was made and it obtained the best results preferred by panelist, it was then followed by main research to determine the storability of green beans milk. From preliminary research, theres were three treatment preferred by panelists, namely P3 (0.75%, P5 (1.25% and P6 (1.5%. After that, those treatments were tested for their storability in main research. From main research it showed that Q0 (control treatment can last for 0 day, Q1 treatment with the addition of red ginger extract 0,75% and Q2 (1.25% having storability for 1 day and Q3 (1.5% having the best treatment that had the longest storability (for 2 days. The more addition of red ginger extract, the longer storability of green beans milk. The best favored and longest storability of green beans milk was one added with red ginger extract of 1.5%. Keywords: Green Bean Milk, Storability, Red ginger
DEFF Research Database (Denmark)
Vrang, N.; Larsen, P.J.; Mikkelsen, J.D.
1995-01-01
Suprachiasmatic nucleus, paraventricular nucleus, circadian rhythms, phaseolus vulgaris-leucoagglutinin, corticotropin-releasing factor, dual immunocytochemistry......Suprachiasmatic nucleus, paraventricular nucleus, circadian rhythms, phaseolus vulgaris-leucoagglutinin, corticotropin-releasing factor, dual immunocytochemistry...
Directory of Open Access Journals (Sweden)
Saleh A. Mohamed
2016-10-01
Full Text Available Escherichia coli-derived L-asparaginases have been used in the treatment of acute lymphoblastic leukemia (ALL, however, clinical hypersensitivity reactions and silent inactivation due to antibodies against E. coli-asparaginase, lead to inactivation of these preparations in most cases.Therefore, this study was aimed to investigate the cytotoxicity and antitumor effects ofa novel L-asparaginaseenzyme, isolated from Phaseolus vulgaris seeds (P-Asp on the ALL cell line (Jurkat. The immunogenicity of the enzyme was also evaluated in-vivo and results were compared to commercially available enzymes of microbial sources. The data demonstrated that P-Asp has an enhanced anti-proliferative effect on ALL cells as detected by the WST-8 cell viability assay kit. Cells treated with P-Asp also exhibited a higher degree of early apoptosis compared with asparaginase from Escherichia coli (L-Asp or its pegylated form Pegasparagas (PEG-ASP that induced higher rates of late apoptosis and necrosis as detected by an Annexin V/Propidium iodide binding assay. In-vivo experiments indicated that mice treated with P-Asp had less distinct allergenic responses than other bacterial enzyme preparations as indicated by lower serum concentrations of IgG, IgE, IgM and mMCP-1 compared with other treated groups. In conclusion, P-Asp can be considered as a promising candidate for use in the treatment of ALL.
Projections from the raphe nuclei to the suprachiasmatic nucleus of the rat
DEFF Research Database (Denmark)
Hay-Schmidt, Anders; Vrang, N.; Larsen, P.J.
2003-01-01
Hypothalamus, Circadian rhythm, Serotonin, Nucleus, Neuronal connections, Phaseolus vulgaris-leucoagglutinin (PHA-L), Cholera toxin (ChB)......Hypothalamus, Circadian rhythm, Serotonin, Nucleus, Neuronal connections, Phaseolus vulgaris-leucoagglutinin (PHA-L), Cholera toxin (ChB)...
Directory of Open Access Journals (Sweden)
Jean-Jacques Drevon
2012-06-01
Full Text Available The effect of phosphorus (P deficiency on phosphatases activities in N2-fixing legumes has been widely studied in hydroponic culture. However, the response of acid phosphatase (APase and phytase in rhizosphere, nodules and seeds of Phaseolus vulgaris to low soil’s P-availability is not yet fully understood. In this study, six genotypes of N2-fixing P. vulgaris were grown under contrasting soil P-availabilities; i.e., low (4.3 mg P kg−1 and sufficient (16.7 mg P kg−1 in the Haouz region of Morocco. At flowering and maturity stages, plants were harvested and analyzed for their phosphatases activities, growth and P content. Results show that, low P decreased nodulation, growth, P uptake and N accumulation in all the genotypes, but to a greater extent in the sensitive recombinant inbreed line 147. In addition, while seed P content was slightly reduced under low P soil; a higher P was noticed in the Flamingo and Contender large seeded-beans (6.15 to 7.11 mg g−1. In these latter genotypes, high APase and phytase activities in seeds and nodules were associated with a significant decline in rhizosphere’s available P. APase activity was mainly stimulated in nodules, whereas phytase activity was highly induced in seeds (77%. In conclusion, the variations of APase and phytase activities in nodules and seeds depend on genotype and can greatly influence the internal utilization of P, which might result in low P soil tolerance in N2-fixing legumes.
Mutungi, C; Affognon, H D; Njoroge, A W; Manono, J; Baributsa, D; Murdock, L L
2015-10-01
Fumigated dry common beans (Phaseolus vulgaris L.) that were artificially infested with Acanthoscelides obtectus Say, and others that were not artificially infested, were stored in hermetic triple-layer PICS (Lela Agro, Kano, Nigeria) or woven polypropylene (PP) bags for 6 mo at ambient laboratory temperature conditions of 22.6 ± 1.9°C and 60.1 ± 4.3% relative humidity. In an additional trial, beans contained in PP bags were treated with Actellic Super dust before introducing A. obtectus. Moisture content, number of live adult A. obtectus, seed damage, weight loss, and seed germination were determined at monthly intervals. At 6 mo, beans stored in PICS bags retained higher moisture than those stored in PP bags, but in all treatments the moisture level remained below that recommended for safe storage of beans. In the PICS bags, proliferation of A. obtectus did not proceed and at 6 mo, beans stored in these bags did not have insect-inflicted seed damage or weight loss. In contrast, seed damage and weight loss in PP bags exceeded economic threshold after 1 mo in the absence of Actellic Super dust (Syngenta Crop protection AG, Basle, Switzerland), and after 2 mo in the presence of it. Germination of beans stored in PP bags decreased greatly whereas the beans stored in PICS bags did not show reduced germination. Chemical free storage of common beans in PICS bags protects them against damage by A. obtectus. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
A. Koocheki
2014-12-01
Full Text Available Response surface models predict crop yield based on crop density and this is an important tool for evaluation competition at different density and hence selection of optimum density based on yield. In order to study intra and inter specific competition in intercropping bean (Phaseolus vulgaris and sesame (Sesamum indicum, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad during the growing season of 2010. For this purpose a complete randomized block design with 3 replications and 16 treatments based on different densities of sesame and bean intercropping was used. The model predicted the maximum yield of an isolated plant of bean and sesame approximately 33 and 17g per plant respectively. The area associated with the maximum yield per plant in bean and sesame were 0.6 and 0.1 m2, respectively. Bean was the dominant competitor with respect to both grain and biomass, and competition coefficient was 0.35 and 0.3 for bean grain yield and bean biomass respectively. Intra-specific competition was more important than inter-specific competition for bean. Competition coefficient was 2.6 and 2.9 for sesame grain yield and biomass respectively. Intra-specific competition was much less important than Interspecific competition in sesame. The highest grain yield in bean (300 g m-2 was obtained of sole crop with density of 20 plants, and the highest sesame grain yield (195 g m-2 was obtained of sole crop with density of 40 plants, the highest land equivalent ratio (1.14 was obtained in intercropping of 20 plants of bean and 10 plants of sesame.
Yin, Shou-Wei; Tang, Chuan-He; Yang, Xiao-Quan; Wen, Qi-Biao
2011-01-12
Fluorescence and differential scanning calorimetry (DSC) were used to study changes in the conformation of red kidney bean (Phaseolus vulgaris L.) protein isolate (KPI) under various environmental conditions. The possible relationship between fluorescence data and DSC characteristics was also discussed. Tryptophan fluorescence and fluorescence quenching analyses indicated that the tryptophan residues in KPI, exhibiting multiple fluorophores with different accessibilities to acrylamide, are largely buried in the hydrophobic core of the protein matrix, with positively charged side chains close to at least some of the tryptophan residues. GdnHCl was more effective than urea and SDS in denaturing KPI. SDS and urea caused variable red shifts, 2-5 nm, in the emission λ(max), suggesting the conformational compactness of KPI. The result was further supported by DSC characteristics that a discernible endothermic peak was still detected up to 8 M urea or 30 mM SDS, also evidenced by the absence of any shift in emission maximum (λ(max)) at different pH conditions. Marked decreases in T(d) and enthalpy (ΔH) were observed at extreme alkaline and/or acidic pH, whereas the presence of NaCl resulted in higher T(d) and ΔH, along with greater cooperativity of the transition. Decreases in T(d) and ΔH were observed in the presence of protein perturbants, for example, SDS and urea, indicating partial denaturation and decrease in thermal stability. Dithiothreitol and N-ethylmaleimide have a slight effect on the thermal properties of KPI. Interestingly, a close linear relationship between the T(d) (or ΔH) and the λ(max) was observed for KPI in the presence of 0-6 M urea.
Directory of Open Access Journals (Sweden)
O. Georgieva
2015-01-01
Full Text Available A periodic phytopathology field monitoring was conducted on 35 introduced common bean (Phaseolus accessions at Maritsa Vegetable Crops Research Institute in 2014. The epiphytotic disease black root rot on the bean crops (over 75 % reduction of the stand was recorded for the first time for the area of Bulgaria. The causal agent isolated from the plant tissue was identified as the fungus Thielaviopsis basicola (Berkeley Ferraris. A strong relationship between disease severity variation and environmental and soil conditions was established. Black root rot was most severe when cool and wet weather occurred from seedling time to about three weeks after planting, combined with increased soil compaction. Field resistance was recorded in Bulgarian var. “Plovdivski zult”, var. “Starozagorski tzer” and line № 564 (3,66%, 5.33% and 6,50 % dumping-off of bean seedlings, respectively. Bean accession introduced from dry climate areas were highly susceptible to black root rot pathogen (over 76.0 % dumping-off of bean seedlings. Indirect relationship was found between bean tolerance to Th. basicola and presence of the anthocyanin in the hypocotyl and seed coat color. Install the average negative correlation between seed color signs (and hypocotyl and the resistance of plants to Th. basicola. Samples with resistance to black root rot belong to the group with beige, red, brown or black color of seeds. The presence of phenolic compounds (anthocyanins in the seed coat and hypocotyls beans can serve as an indirect indication of the selection of resistant to black rot breeding materials.
International Nuclear Information System (INIS)
Jana, Milan; Saha, Sanjit; Khanra, Partha; Murmu, Naresh Chandra; Srivastava, Suneel Kumar; Kuila, Tapas; Lee, Joong Hee
2014-01-01
Graphical abstract: - Highlights: • Green reduction of GO using mung bean soaked water has been demonstrated. • The isolation of reduced is very simple and precludes extra purification process. • The specific capacitance of rGO is 137 F g −1 at a current density of 1.3 A g −1 . • The retention in specific capacitance is ∼98% after 1000 charge–discharge cycles. - Abstract: Green reduction of graphene oxide (GO) using drained water from soaked mung beans (Phaseolus aureus L.) has been demonstrated. In comparison to the toxic and hazardous reducing chemicals, the drained water from soaked mung beans (P. aureus L.) is completely green reducing agent, the reduction process is very simple and cost effective. The removal of oxygen containing functional groups of GO has been confirmed by UV–vis, Fourier transform infrared and X-ray photoelectron spectroscopy analysis. Morphological characterization of rGO has been performed by atomic force and transmission electron microscopy analysis. Electrochemical performances of rGO have been evaluated by cyclic voltammetry (CV), charge–discharge and electrochemical impedance spectroscopy techniques. The specific capacitance (SC) of rGO has been found to be 137 F g −1 at a current density of 1.3 A g −1 . The retention in SC is more than 98% after 1000 charge–discharge cycles suggesting long-term electrochemical cyclic stability as supercapacitor electrode materials
1527-IJBCS-Article-Pamphile Nguema+
African Journals Online (AJOL)
hp
1Université des Sciences et Techniques de Masuku, Institut National Supérieur .... embryos of Phaseolus polyanthus and Phaseolus vulgaris. It allows a ..... Tests of pre- and postpollination barriers to hybridization between sympatric species.
Blair, Matthew W; Prieto, Sergio; Díaz, Lucy M; Buendía, Héctor F; Cardona, César
2010-04-29
An interesting seed protein family with a role in preventing insect herbivory is the multi-gene, APA family encoding the alpha-amylase inhibitor, phytohemagglutinin and arcelin proteins of common bean (Phaseolus vulgaris). Variability for this gene family exists and has been exploited to breed for insect resistance. For example, the arcelin locus has been successfully transferred from wild to cultivated common bean genotypes to provide resistance against the bruchid species Zabrotes subfasciatus although the process has been hampered by a lack of genetic tools for and understanding about the locus. In this study, we analyzed linkage disequilibrium (LD) between microsatellite markers at the APA locus and bruchid resistance in a germplasm survey of 105 resistant and susceptible genotypes and compared this with LD in other parts of the genome. Microsatellite allele diversity was found to vary with each of the eight APA-linked markers analyzed, and two markers within the APA locus were found to be diagnostic for bruchid resistance or susceptibility and for the different arcelin alleles inherited from the wild accessions. Arc1 was found to provide higher levels of resistance than Arc5 and the markers in the APA locus were highly associated with resistance showing that introgression of this gene-family from wild beans provides resistance in cultivated beans. LD around the APA locus was found to be intermediate compared to other regions of the genome and the highest LD was found within the APA locus itself for example between the markers PV-atct001 and PV-ag004. We found the APA locus to be an important genetic determinant of bruchid resistance and also found that LD existed mostly within the APA locus but not beyond it. Moderate LD was also found for some other regions of the genome perhaps related to domestication genes. The LD pattern may reflect the introgression of arcelin from the wild into the cultivated background through breeding. LD and association studies for
Directory of Open Access Journals (Sweden)
Bin Jiang
2017-09-01
Full Text Available A fast and efficient method based on a polyethylene glycol (PEG 600/(NH42SO4 aqueous two-phase system for extracting lectin from Zihua snap-bean (Phaseolus vulgaris seeds was established. According to a Box–Behnken design (BBD, involving four factors at three levels each subjected to analysis of variance (ANOVA and response surface analysis, the protein recovery and the purification factor of lectin in the top phase were used as the response values of the variance analysis to acquire the multivariate quadratic regression model. SDS–PAGE electrophoresis and the hemagglutination test were used to detect the distribution of lectin in the aqueous two-phase system (ATPS. The obtained data indicated that lectin was preferentially partitioned into the PEG-rich phase, and the ATPS, composed of 15% (NH42SO4 (w/w, 18% PEG 600 (w/w, 0.4 g/5 g NaCl and 1 mL crude extract, showed good selectivity for lectin when the pH value was 7.5. Under the optimal conditions, most of the lectin was assigned to the top phase in the ATPS, and the hemagglutination activity of the purified lectin in the top phase was 3.08 times that of the crude extract. Consequently, the PEG 600/(NH42SO4 aqueous two-phase system was an effective method for separating and enriching lectin directly from the crude extract of Zihua snap-bean seeds.
International Nuclear Information System (INIS)
Gerosa, Giacomo; Marzuoli, Riccardo; Rossini, Micol; Panigada, Cinzia; Meroni, Michele; Colombo, Roberto; Faoro, Franco; Iriti, Marcello
2009-01-01
Stomatal ozone uptake, determined with the Jarvis' approach, was related to photosynthetic efficiency assessed by chlorophyll fluorescence and reflectance measurements in open-top chamber experiments on Phaseolus vulgaris. The effects of O 3 exposure were also evaluated in terms of visible and microscopical leaf injury and plant productivity. Results showed that microscopical leaf symptoms, assessed as cell death and H 2 O 2 accumulation, preceded by 3-4 days the appearance of visible symptoms. An effective dose of ozone stomatal flux for visible leaf damages was found around 1.33 mmol O 3 m -2 . Significant linear dose-response relationships were obtained between accumulated fluxes and optical indices (PRI, NDI, ΔF/F m ' ). The negative effects on photosynthesis reduced plant productivity, affecting the number of pods and seeds, but not seed weight. These results, besides contributing to the development of a flux-based ozone risk assessment for crops in Europe, highlight the potentiality of reflectance measurements for the early detection of ozone stress. - Ozone stomatal fluxes affect leaf cell viability, photosynthetic performance, optical properties and crop yield of bean.
Directory of Open Access Journals (Sweden)
Bruna Borba Dias
2010-07-01
Full Text Available O presente trabalho teve o objetivo de analisar os efeitos do enxofre e da chuva ácida simulada sobre a estrutura foliar do feijoeiro (Phaseolus vulgaris L, nos aspectos morfoanatômicos, teores de clorofila a, b, total e feofitina. As plantas-controle sofreram simulações de chuva com pH 6,0 e as plantas-teste sofreram simulação de chuva ácida com pH 3,0. As concentrações de clorofila a, b e total diminuíram no estádio de floração (R6. Já, no estádio R7, onde surgem as primeiras vagens, os teores aumentaram, indicando possível resistência e/ou adaptação dos espécimes às simulações ácidas. O tratamento ácido afetou a concentração de clorofila que foi degradada por processos oxidativos sem a sua conversão em feofitina. Também se observou diminuição na frequência de tricomas tectores e glandulares, assim como de estômatos. As injúrias visualizadas foram classificadas como de caráter leve, provavelmente pela existência de anexos epidérmicos para proteção foliar e peciolar.The goal of this work was to evaluate the effects of sulfur and simulated acid rain on the leaf of Phaseolus vulgaris. Acid rain (pH 3.0 and an aqueous solution (Ph 6.0 were performed on test and control plants, respectively. A decrease in chlorophyll a, chlorophyll b and total chlorophyll concentrations was observed in theflowering stage (R6. However, increased rates were determined in the maturation stage (R7, which can suggest a resistance and/or adjustment of the plants to the acid simulation conditions. The acid treatment achieved chlorophyll degradation by oxidative processes without conversion to pheophytin. A reduction was also seen in the number of glandular and non-glandular trichomes and stomata on the test plants. Moreover, only small injuries were verified on the blade and peciolar areas of the tested individuals of P. vulgaris, probablydue to the presence of the reported epidermal structures.
International Nuclear Information System (INIS)
Costa, L C; Justino, F; Oliveira, L J C; Sediyama, G C; Lemos, C F; Ferreira, W P M
2009-01-01
Based upon sensitivity experiments, this study aims to investigate the impact of increased atmospheric CO 2 concentration, climate changes, and ongoing technological advancements on bean (Phaseolus vulgaris) and maize (Zea mays) yield. This investigation assumes that the atmospheric CO 2 concentration evolves according to the A2 scenario. For these analyses we have used climate data as projected by climate simulations conducted with the HadCM3 climate model for both present day and greenhouse warming conditions. The results demonstrated that warming conditions associated with increased greenhouse gases as delivered by the HadCM3 model lead to reductions in the potential productivity of maize and beans for the years 2050 and 2080 by up to 30%. This thermal response is, however, damped by the highly efficient CO 2 fertilization effect which is expected to increase bean productivity as compared to present day conditions. A similar investigation for maize yield revealed a different picture. It has been found that the CO 2 fertilization feedback is much weaker and cannot cancel out the thermal effect. We have found, therefore, that climate changes as simulated to occur in the future are not favorable for increasing the maize yield in southeast Brazil. By the inclusion of the third forcing evaluated, representing technological advancements, it is demonstrated that improvements in the crop system reduce the negative effect associated with warmer climate conditions for both crops. We conclude that appropriate soil and technological management as well as genetic improvements may very likely induce an increase in bean and maize yield despite the unfavorable future climate conditions.
International Nuclear Information System (INIS)
Chatfield, J.M.; Armstrong, D.J.
1987-01-01
The effects of metal ions on cytokinin oxidase activity extracted from callus tissues of Phaseolus vulgaris L. cv Great Northern have been examined using an assay based on the oxidation of N 6 -(Δ 2 -isopentenyl)-adenine-2,8- 3 H (i 6 Ade) to adenine (Ade). The addition of cupric ions to reaction mixtures containing imidazole buffer markedly enhanced cytokinin oxidase activity. In the presence of optimal concentrations of copper and imidazole, cytokinin oxidase activity was stimulated more than 20-fold. The effect was enzyme dependent, specific for copper, and observed only in the presence of imidazole. The substrate specificity of the copper-imidazole enhanced reaction, as judged by substrate competition tests, was the same as that observed in the absence of copper and imidazole. Similarly, in tests involving DEAE-cellulose chromatography, elution profiles of cytokinin oxidase activity determined using a copper-imidazole enhanced assay were identical to those obtained using an assay without copper and imidazole. On the basis of these results, the addition of copper and imidazole to reaction mixtures used to assay for cytokinin oxidase activity is judged to provide a reliable and specific assay of greatly enhanced sensitivity for the enzyme. The mechanism by which copper and imidazole enhance cytokinin oxidase activity is not certain, but the reaction catalyzed by the enzyme was not inhibited by anaerobic conditions when these reagents were present. This observation suggests that copper-imidazole complexes are substituting for oxygen in the reaction mechanism by which cytokinin oxidase effects cleavage of the N 6 -side chain of i 6 Ade
Barrett, Marilyn L; Udani, Jay K
2011-03-17
Obesity, and resultant health hazards which include diabetes, cardiovascular disease and metabolic syndrome, are worldwide medical problems. Control of diet and exercise are cornerstones of the management of excess weight. Foods with a low glycemic index may reduce the risk of diabetes and heart disease as well as their complications. As an alternative to a low glycemic index diet, there is a growing body of research into products that slow the absorption of carbohydrates through the inhibition of enzymes responsible for their digestion. These products include alpha-amylase and glucosidase inhibitors. The common white bean (Phaseolus vulgaris) produces an alpha-amylase inhibitor, which has been characterized and tested in numerous clinical studies. A specific and proprietary product named Phase 2® Carb Controller (Pharmachem Laboratories, Kearny, NJ) has demonstrated the ability to cause weight loss with doses of 500 to 3000 mg per day, in either a single dose or in divided doses. Clinical studies also show that Phase 2 has the ability to reduce the post-prandial spike in blood glucose levels. Experiments conducted incorporating Phase 2 into food and beverage products have found that it can be integrated into various products without losing activity or altering the appearance, texture or taste of the food. There have been no serious side effects reported following consumption of Phase 2. Gastro-intestinal side effects are rare and diminish upon extended use of the product. In summary, Phase 2 has the potential to induce weight loss and reduce spikes in blood sugar caused by carbohydrates through its alpha-amylase inhibiting activity.
Directory of Open Access Journals (Sweden)
Barrett Marilyn L
2011-03-01
Full Text Available Abstract Obesity, and resultant health hazards which include diabetes, cardiovascular disease and metabolic syndrome, are worldwide medical problems. Control of diet and exercise are cornerstones of the management of excess weight. Foods with a low glycemic index may reduce the risk of diabetes and heart disease as well as their complications. As an alternative to a low glycemic index diet, there is a growing body of research into products that slow the absorption of carbohydrates through the inhibition of enzymes responsible for their digestion. These products include alpha-amylase and glucosidase inhibitors. The common white bean (Phaseolus vulgaris produces an alpha-amylase inhibitor, which has been characterized and tested in numerous clinical studies. A specific and proprietary product named Phase 2® Carb Controller (Pharmachem Laboratories, Kearny, NJ has demonstrated the ability to cause weight loss with doses of 500 to 3000 mg per day, in either a single dose or in divided doses. Clinical studies also show that Phase 2 has the ability to reduce the post-prandial spike in blood glucose levels. Experiments conducted incorporating Phase 2 into food and beverage products have found that it can be integrated into various products without losing activity or altering the appearance, texture or taste of the food. There have been no serious side effects reported following consumption of Phase 2. Gastro-intestinal side effects are rare and diminish upon extended use of the product. In summary, Phase 2 has the potential to induce weight loss and reduce spikes in blood sugar caused by carbohydrates through its alpha-amylase inhibiting activity.
Directory of Open Access Journals (Sweden)
Juliana Morini Küpper Cardoso Perseguini
Full Text Available The common bean (Phaseolus vulgaris L. is the world's most important legume for human consumption. Anthracnose (ANT; Colletotrichum lindemuthianum and angular leaf spot (ALS; Pseudocercospora griseola are complex diseases that cause major yield losses in common bean. Depending on the cultivar and environmental conditions, anthracnose and angular leaf spot infections can reduce crop yield drastically. This study aimed to estimate linkage disequilibrium levels and identify quantitative resistance loci (QRL controlling resistance to both ANT and ALS diseases of 180 accessions of common bean using genome-wide association analysis. A randomized complete block design with four replicates was performed for the ANT and ALS experiments, with four plants per genotype in each replicate. Association mapping analyses were performed for ANT and ALS using a mixed linear model approach implemented in TASSEL. A total of 17 and 11 significant statistically associations involving SSRs were detected for ANT and ALS resistance loci, respectively. Using SNPs, 21 and 17 significant statistically associations were obtained for ANT and angular ALS, respectively, providing more associations with this marker. The SSR-IAC167 and PvM95 markers, both located on chromosome Pv03, and the SNP scaffold00021_89379, were associated with both diseases. The other markers were distributed across the entire common bean genome, with chromosomes Pv03 and Pv08 showing the greatest number of loci associated with ANT resistance. The chromosome Pv04 was the most saturated one, with six markers associated with ALS resistance. The telomeric region of this chromosome showed four markers located between approximately 2.5 Mb and 4.4 Mb. Our results demonstrate the great potential of genome-wide association studies to identify QRLs related to ANT and ALS in common bean. The results indicate a quantitative and complex inheritance pattern for both diseases in common bean. Our findings will
Perseguini, Juliana Morini Küpper Cardoso; Oblessuc, Paula Rodrigues; Rosa, João Ricardo Bachega Feijó; Gomes, Kleber Alves; Chiorato, Alisson Fernando; Carbonell, Sérgio Augusto Morais; Garcia, Antonio Augusto Franco; Vianello, Rosana Pereira; Benchimol-Reis, Luciana Lasry
2016-01-01
The common bean (Phaseolus vulgaris L.) is the world's most important legume for human consumption. Anthracnose (ANT; Colletotrichum lindemuthianum) and angular leaf spot (ALS; Pseudocercospora griseola) are complex diseases that cause major yield losses in common bean. Depending on the cultivar and environmental conditions, anthracnose and angular leaf spot infections can reduce crop yield drastically. This study aimed to estimate linkage disequilibrium levels and identify quantitative resistance loci (QRL) controlling resistance to both ANT and ALS diseases of 180 accessions of common bean using genome-wide association analysis. A randomized complete block design with four replicates was performed for the ANT and ALS experiments, with four plants per genotype in each replicate. Association mapping analyses were performed for ANT and ALS using a mixed linear model approach implemented in TASSEL. A total of 17 and 11 significant statistically associations involving SSRs were detected for ANT and ALS resistance loci, respectively. Using SNPs, 21 and 17 significant statistically associations were obtained for ANT and angular ALS, respectively, providing more associations with this marker. The SSR-IAC167 and PvM95 markers, both located on chromosome Pv03, and the SNP scaffold00021_89379, were associated with both diseases. The other markers were distributed across the entire common bean genome, with chromosomes Pv03 and Pv08 showing the greatest number of loci associated with ANT resistance. The chromosome Pv04 was the most saturated one, with six markers associated with ALS resistance. The telomeric region of this chromosome showed four markers located between approximately 2.5 Mb and 4.4 Mb. Our results demonstrate the great potential of genome-wide association studies to identify QRLs related to ANT and ALS in common bean. The results indicate a quantitative and complex inheritance pattern for both diseases in common bean. Our findings will contribute to more
Luiten, P.G.M.; Horst, G.J. ter; Karst, H.; Steffens, A.B.
1985-01-01
By application of the anterograde transport technique of Phaseolus vulgaris leuco-agglutinin the descending autonomic projection of the paraventricular hypothalamic nucleus was investigated. The Phaseolus lectin technique allowed the detection of the cells of origin in the paraventricular PVN, the
Directory of Open Access Journals (Sweden)
Mingli Chen
Full Text Available Anthracnose is a destructive disease of the common bean (Phaseolus vulgaris L.. The Andean cultivar Hongyundou has been demonstrated to possess strong resistance to anthracnose race 81. To study the genetics of this resistance, the Hongyundou cultivar was crossed with a susceptible genotype Jingdou. Segregation of resistance for race 81 was assessed in the F2 population and F2:3 lines under controlled conditions. Results indicate that Hongyundou carries a single dominant gene for anthracnose resistance. An allele test by crossing Hongyundou with another resistant cultivar revealed that the resistance gene is in the Co-1 locus (therefore named Co-1HY. The physical distance between this locus and the two flanking markers was 46 kb, and this region included four candidate genes, namely, Phvul.001G243500, Phvul.001G243600, Phvul.001G243700 and Phvul.001G243800. These candidate genes encoded serine/threonine-protein kinases. Expression analysis of the four candidate genes in the resistant and susceptible cultivars under control condition and inoculated treatment revealed that all the four candidate genes are expressed at significantly higher levels in the resistant genotype than in susceptible genotype. Phvul.001G243600 and Phvul.001G243700 are expressed nearly 15-fold and 90-fold higher in the resistant genotype than in the susceptible parent before inoculation, respectively. Four candidate genes will provide useful information for further research into the resistance mechanism of anthracnose in common bean. The closely linked flanking markers identified here may be useful for transferring the resistance allele Co-1HY from Hongyundou to elite anthracnose susceptible common bean lines.
Chen, Mingli; Wu, Jing; Wang, Lanfen; Mantri, Nitin; Zhang, Xiaoyan; Zhu, Zhendong; Wang, Shumin
2017-01-01
Anthracnose is a destructive disease of the common bean (Phaseolus vulgaris L.). The Andean cultivar Hongyundou has been demonstrated to possess strong resistance to anthracnose race 81. To study the genetics of this resistance, the Hongyundou cultivar was crossed with a susceptible genotype Jingdou. Segregation of resistance for race 81 was assessed in the F2 population and F2:3 lines under controlled conditions. Results indicate that Hongyundou carries a single dominant gene for anthracnose resistance. An allele test by crossing Hongyundou with another resistant cultivar revealed that the resistance gene is in the Co-1 locus (therefore named Co-1HY). The physical distance between this locus and the two flanking markers was 46 kb, and this region included four candidate genes, namely, Phvul.001G243500, Phvul.001G243600, Phvul.001G243700 and Phvul.001G243800. These candidate genes encoded serine/threonine-protein kinases. Expression analysis of the four candidate genes in the resistant and susceptible cultivars under control condition and inoculated treatment revealed that all the four candidate genes are expressed at significantly higher levels in the resistant genotype than in susceptible genotype. Phvul.001G243600 and Phvul.001G243700 are expressed nearly 15-fold and 90-fold higher in the resistant genotype than in the susceptible parent before inoculation, respectively. Four candidate genes will provide useful information for further research into the resistance mechanism of anthracnose in common bean. The closely linked flanking markers identified here may be useful for transferring the resistance allele Co-1HY from Hongyundou to elite anthracnose susceptible common bean lines.
Farinha do subproduto de feijão Phaseolus vulgaris em dietas para juvenis de tilápia do Nilo
Directory of Open Access Journals (Sweden)
K. S. P. Azevedo
2017-07-01
Full Text Available A procura por fontes proteicas alternativas em dietas para peixes é necessária, pois alguns ingredientes proteicos tradicionais apresentam grande variação no preço e disponibilidade. Um experimento de 45 dias foi conduzido em um sistema de recirculação de água com juvenis de tilápia do Nilo (peso inicial de 16,2 ± 0,1 g para avaliar os efeitos da inclusão de farinha do subproduto de feijão Phaseolus vulgaris sobre os índices produtivos e composição corporal. Três dietas isonitrogenadas (35% de proteína bruta e isocalóricas (3.100 kcal/kg de energia digestível foram preparadas para incluir 0%; 6,2% e 12,4% de farinha do subproduto de feijão substituindo 0%; 10% e 20% da proteína bruta do farelo de soja, em um delineamento inteiramente casualizado (n=4. O peso final, ganho de peso, taxa de crescimento específico, índice de consumo alimentar, taxa de eficiência proteica e sobrevivência foram similares (P>0,05 entre os peixes alimentados com as dietas experimentais. Nenhuma diferença (P>0,05 foi registrada no teor de proteína bruta, cinzas e extrato etéreo corporais dos peixes. O valor produtivo da proteína bruta e a matéria seca corporal diminuíram (P<0,05 nos peixes alimentados com 12,4% da farinha do subproduto de feijão. A inclusão de farinha do subproduto de feijão até 6,2% como substituto do farelo de soja não diminui o desempenho produtivo e a composição corporal dos peixes.
Directory of Open Access Journals (Sweden)
Bernardo Villar S\\u00E1nchez
2000-01-01
Full Text Available Estrategia para el manejo de suelos ácidos en frijol (Phaseolus vulgaris L. en el estado de Chiapas, México. Por su contribución en la dieta alimenticia y la generación de empleos, y por existir una ancestral cultura productiva y una superficie de siembra de más de 100 mil hectáreas, el cultivo de frijol es de fundamental importancia en el estado de Chiapas. Sin embargo, se ha determinado una brecha tecnológica de más de 700 kg/ha entre el potencial del cultivo y los rendimientos actuales. Esta es ocasionada por numerosos factores limitantes entre los que destaca la presencia de suelos de baja fertilidad y ácidos. La estrategia adoptada para el manejo de este problema incluye: 1.Aplicación de cal y fósforo; 2. Mejoramiento genético para resistencia; 3.Manejo de los ciclos de materia orgánica y nutrientes del suelo; y 4.Combinación de las tres alternativas. En este reporte se dan los avances obtenidos con relación a la primera alternativa considerada como el paso inicial para el logro de un manejo integral de suelos en Chiapas. Durante 1997 se estudiaron cinco dosis de cal y tres de fósforo en condiciones de invernadero y campo para suelos de diferentes localidades. Se utilizó un experimento factorial completo con cuatro repeticiones, los experimentos fueron evaluados en términos de la producción de grano y al efecto de la cal sobre las propiedades químicas del suelo. Hubo respuesta del frijol en rendimiento a la aplicación de cal y fósforo
Directory of Open Access Journals (Sweden)
Abdul Khalil Gardezi
2013-12-01
Full Text Available The objective of this research was to evaluate the effect of fungicides on the association with Glomus intraradices and soil contamination on three genotypes of beans (Phaseolus vulgaris L., one of oat (Avena sativa L., and another one of wheat (Triticum aestivum L.. The study was done under greenhouse conditions at the Montecillo Campus of the Postgraduate College, Mexico. Two soils were used, one irrigated with sewage water and the other one with clean water from a well. Half of the plants were inoculated with Glomus intraradices. Metacaptan was used as a fungicide applied to half of the seeds. The pH of the soil was alkaline. Electric conductivity, and organic matter, nitric and ammoniac nitrogen, phosphorous, copper and nickel quantities were higher on the soils irrigated with sewage water. The soil contamination did not affect significantly plant responses in this study. It is concluded that endomycorrhiza inoculation (Glomus intraradices gave better growth and yield, especially in beans. The application of fungicides improved plant growth.
Directory of Open Access Journals (Sweden)
Kolima Peña Calzada
2015-09-01
Full Text Available El objetivo de la investigación fue evaluar el efecto de un promotor del crecimiento activado molecularmente sobre la germinación y producción del cultivo de frijol (Phaseolus vulgaris L.. Se hicieron dos experimentos, uno in vitro con un diseño completamente aleatorizado y otro en campo con dos variantes y 8 réplicas (diseño de bloques al azar. El tratamiento en ambos ensayos fue inmersión de las semillas en una solución del promotor al 0,02% por 3 horas y otro grupo testigo con inmersión por igual tiempo en agua natural. Los resultados mostraron que la germinación y la altura de las plantas fueron mejores con la inmersión en el producto en ambos experimentos. En el ensayo de campo los vainas por planta no hubo diferencia entre los tratamientos. En los granos por vaina y granos por planta el grupo tratado fue superior al control en 16,70 y 15,22% respectivamente. La masa de 100 granos no mostró diferencia entre ambos tratamientos. El rendimiento agrícola fue superior en los tratados(1,22t.ha-1 vs. 1,02. Con ambos experimentos se determinó que el promotor del crecimiento influyó positivamente en la germinación, desarrollo y producción del cultivo del frijol.
Energy Technology Data Exchange (ETDEWEB)
Jana, Milan [Surface Engineering and Tribology Division, Council of Scientific and Industrial Research-Central Mechanical Engineering Research Institute, Durgapur 713209 (India); Academy of Scientific and Innovation Research (AcSIR), Anusandhan Bhawan, 2 Rafi Marg, New Delhi 110001 (India); Saha, Sanjit [Surface Engineering and Tribology Division, Council of Scientific and Industrial Research-Central Mechanical Engineering Research Institute, Durgapur 713209 (India); Khanra, Partha [Advanced Materials Research Institute for BIN Fusion Technology (BK Plus Global, Program), Department of BIN Fusion Technology, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Murmu, Naresh Chandra [Surface Engineering and Tribology Division, Council of Scientific and Industrial Research-Central Mechanical Engineering Research Institute, Durgapur 713209 (India); Srivastava, Suneel Kumar [Department of Chemistry, Indian Institute of Technology, Kharagpur 721302 (India); Kuila, Tapas, E-mail: tkuila@gmail.com [Surface Engineering and Tribology Division, Council of Scientific and Industrial Research-Central Mechanical Engineering Research Institute, Durgapur 713209 (India); Lee, Joong Hee, E-mail: jhl@jbnu.ac.kr [Advanced Materials Research Institute for BIN Fusion Technology (BK Plus Global, Program), Department of BIN Fusion Technology, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of)
2014-08-01
Graphical abstract: - Highlights: • Green reduction of GO using mung bean soaked water has been demonstrated. • The isolation of reduced is very simple and precludes extra purification process. • The specific capacitance of rGO is 137 F g{sup −1} at a current density of 1.3 A g{sup −1}. • The retention in specific capacitance is ∼98% after 1000 charge–discharge cycles. - Abstract: Green reduction of graphene oxide (GO) using drained water from soaked mung beans (Phaseolus aureus L.) has been demonstrated. In comparison to the toxic and hazardous reducing chemicals, the drained water from soaked mung beans (P. aureus L.) is completely green reducing agent, the reduction process is very simple and cost effective. The removal of oxygen containing functional groups of GO has been confirmed by UV–vis, Fourier transform infrared and X-ray photoelectron spectroscopy analysis. Morphological characterization of rGO has been performed by atomic force and transmission electron microscopy analysis. Electrochemical performances of rGO have been evaluated by cyclic voltammetry (CV), charge–discharge and electrochemical impedance spectroscopy techniques. The specific capacitance (SC) of rGO has been found to be 137 F g{sup −1} at a current density of 1.3 A g{sup −1}. The retention in SC is more than 98% after 1000 charge–discharge cycles suggesting long-term electrochemical cyclic stability as supercapacitor electrode materials.
Directory of Open Access Journals (Sweden)
somayyeh soheili movahhed
2017-10-01
Full Text Available Introduction Drought or water deficit stress is the most important environmental factor which has severe negative impacts on crop yields, especially when the water stress occurs in the flowering stage. Iran is located in arid and semi-arid areas, therefore, attention to the effects of water deficit stress in different stages of plants growth seems necessary. Bean (Phaseolus vulgaris L. is one of the most important legumes that has a major contribution to human diet and provides an important part of the human protein. According to studies, cultivation areas of legumes in Iran are about 97300 hectares and its total production is about 208350 tons of grain. Bean is a fast-growing plant (Tran and Singh, 2002, thus soil water must be sufficiently available to ensure its desirable growth and yield. The aim of this study was to investigate the effect of drought stress on yield and yield components of some pinto bean (Phaseolus vulgaris L. cultivated in Zanjan province. Materials and methods An experiment was conducted as spilt plot based on randomized complete block design with four replications in Zanjan university research farm. Irrigation levels (control and drought stress and genotypes (Local khomein, Sadri, Ks21193 and Ks21189 were set in the main and subplot, respectively. Water deficit stress was applied during flowering stage (50% of the plants were at anthesis. Sampling was performed to measure yield and yield components at the end of the growth period and final maturity. In this experiment number of pod per Plant, numberof grain per pod, 100 grain weight, grain yield, biological yield and harvest index were measured. Results and Discussion In this experiment it was observed that drought stress, genotype and interact irrigation×genotyps were significantly for all traits except biological yield. Drought stress reduced number of pod perplant, number of grain per pod, 100 grain weight, grain yield, biological yield and Harvest Index. Results
Navarro-Meléndez, Ariana L; Heil, Martin
2014-07-01
Symptomless ‘type II’ fungal endophytes colonize their plant host horizontally and exert diverse effects on its resistance phenotype. Here, we used wild Lima bean (Phaseolus lunatus) plants that were experimentally colonized with one of three strains of natural endophytes (Bartalinia pondoensis, Fusarium sp., or Cochliobolus lunatus) to investigate the effects of fungal colonization on the endogenous levels of salicylic acid (SA) and jasmonic acid (JA) and on two JA-dependent indirect defense traits. Colonization with Fusarium sp. enhanced JA levels in intact leaves, whereas B. pondoensis suppressed the induction of endogenous JA in mechanically damaged leaves. Endogenous SA levels in intact leaves were significantly decreased by all strains and B. pondoensis and Fusarium sp. decreased SA levels after mechanical damage. Colonization with Fusarium sp. or C. lunatus enhanced the number of detectable volatile organic compounds (VOCs) emitted from intact leaves, and all three strains enhanced the relative amount of several VOCs emitted from intact leaves as well as the number of detectable VOCs emitted from slightly damaged leaves. All three strains completely suppressed the induced secretion of extrafloral nectar (EFN) after the exogenous application of JA. Symptomless endophytes interact in complex and strain-specific ways with the endogenous levels of SA and JA and with the defense traits that are controlled by these hormones. These interactions can occur both upstream and downstream of the defense hormones.
Directory of Open Access Journals (Sweden)
L. Rostami
2016-05-01
Full Text Available In order to determinate the effects of plant densities in intercropped corn (Zea mays L. and bean (Phaseolus vulgaris L. on radiation absorption and use efficiency, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad, Iran during growing season of 2007-2008. This experiment was conducted in low input system. A randomized complete block design with three replications was used. Treatments were included bean intercropping with corn in normal density of bean plus 10%, 20% and 30% excess bean C (B+10%, C (B+20%, C (B+30%, increasing in density bean intercropping with corn in normal density of corn plus 10%, 20% and 30% excess corn B (C+10%, B (C+20%, B (C+30% and sole crops of corn (C and bean (B. Results indicated that leaf area index, radiation absorption, total dry matter and radiation use efficiency of corn increased in all intercropped treatments compared to sole cropping, but it reversed for bean. It seems that complementary and facilitative effects of intercropping were more for corn. Range of corn and bean radiation use efficiency was from 1.92 g.MJ-1 (in sole cropping and 0.72 g.MJ-1 {in (C+30% (B+30%} to 2.30 g.MJ-1 {in C (B+30%} and 1.45 g.MJ-1 (in sole cropping, respectively.
Directory of Open Access Journals (Sweden)
Nieto Joaquín J
2010-07-01
Full Text Available Abstract Background Associated with appropriate crop and soil management, inoculation of legumes with microbial biofertilizers can improve food legume yield and soil fertility and reduce pollution by inorganic fertilizers. Rhizospheric bacteria are subjected to osmotic stress imposed by drought and/or NaCl, two abiotic constraints frequently found in semi-arid lands. Osmostress response in bacteria involves the accumulation of small organic compounds called compatible solutes. Whereas most studies on rhizobial osmoadaptation have focussed on the model species Sinorhizobium meliloti, little is known on the osmoadaptive mechanisms used by native rhizobia, which are good sources of inoculants. In this work, we investigated the synthesis and accumulations of compatible solutes by four rhizobial strains isolated from root nodules of Phaseolus vulgaris in Tunisia, as well as by the reference strain Rhizobium tropici CIAT 899T. Results The most NaCl-tolerant strain was A. tumefaciens 10c2, followed (in decreasing order by R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3, R. etli 12a3 and R. gallicum bv. phaseoli 8a3. 13C- and 1H-NMR analyses showed that all Rhizobium strains synthesized trehalose whereas A. tumefaciens 10c2 synthesized mannosucrose. Glutamate synthesis was also observed in R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3 and A. tumefaciens 10c2. When added as a carbon source, mannitol was also accumulated by all strains. Accumulation of trehalose in R. tropici CIAT 899 and of mannosucrose in A. tumefaciens 10c2 was osmoregulated, suggesting their involvement in osmotolerance. The phylogenetic analysis of the otsA gene, encoding the trehalose-6-phosphate synthase, suggested the existence of lateral transfer events. In vivo 13C labeling experiments together with genomic analysis led us to propose the uptake and conversion pathways of different carbon sources into trehalose. Collaterally, the β-1,2-cyclic glucan from R
International Nuclear Information System (INIS)
Abed EI-Gawad, E.I.; Aiad, S.K.
2008-01-01
This Study was established to assess the effect of supplemental dietary raw green snap (Phaseolus vulgaris) for three months to overcome gamma-irradiation induced alterations on some oxidant/ antioxidant parameters (Fe 3+ , Cu 2+ , total iron, ferritin, transferrin and ceruloplasmin) and the hyper lipidemic state (triglycerides, cholesterol, high- and low density lipoprotein (HDL-c and LDL-c) in aged male rats. Raw green snap is an indigenous plant used in Unani and Ayurvedic medicine in India. The study also aimed to estimate the effect of dietary raw green snap on general health through the follow up of body weight and mortality during the course of supplementation. Thirty-two aged male rats (24 months, 370-375 g) were divided equally into four groups. 1- Control group, the animals fed on a balanced diet for 3 months. 2- Supplemented group, the animals balanced diet was supplemented with raw green snap (70 g / kg body wt/ day) for 3 months. 3- Irradiated group, the animals fed on a balanced diet for 3 months were then exposed to whole body y-radiation at a dose level of 4 Gy. 4-Supplemented-irradiated group, the animals' balanced diet was supplemented with raw green snap (70 g/ kg/ day) for three months and then exposed to whole body gamma irradiation at a dose level of 4 Gy. The blood samples were taken from orbital venous plexuses after 48 h of stopping green snap supplementation (supplemented group) or after irradiation (irradiated and supplemented gamma-irradiated groups). The results obtained showed reduction in the body wt in green snap supplemented group which increased gradually concomitant with occurrence of animal mortality on week 7 reaching II) maximal values (-32.79 and 33.33 %) respectively, on week 12 of supplementation. Also, the supplemented group showed non significant changes in tested parameters although the level of total iron and triglycerides recorded noticeable changes as compared with controls
Directory of Open Access Journals (Sweden)
Francisco Castillo Rangel
Full Text Available ABSTRACT The objective was to evaluate the effect of three levels of cull pinto beans (CPB; Phaseolus vulgaris on ruminal fermentation, kinetics, and nutrient digestibility in hair lambs. Six cannulated lambs averaging 56.6±3.8 kg were used and were randomly assigned to one of three treatments. Treatments were: 0.0 kg kg−1 of CPB in the supplement (control; 0.25 kg kg−1 of CPB in the supplement (CB25; and 0.40 kg kg−1 of CPB in the supplement (CB40. Dry matter intake, ruminal pH, NH3, and volatile fatty acid (VFA concentration, methane production, Kp (passage rate, MRT (mean retention time, and digestibility of dry matter, crude protein, and neutral detergent fiber were evaluated. Data were analyzed in a Latin square design, repeated in line, by MIXED procedure of SAS. Estimates used for Kp and MRT were obtained by a non-linear regression model (PROC NLIN. Dry matter intake was reduced by supplementation of CPB. No differences were found in ruminal pH or ruminal NH3. During the trial, differences were found for ruminal VFA concentration (mM, which were greater for the CB25 group. The propionate:acetate ratio was greater for the CB40 treatment. Methane production (mM/m differed among treatments, but it was the greatest for the CB40 group. Passage rate (kg kg−1/h and MRT (h were similar among treatments and the digestibility (kg kg−1 of dry matter, crude protein, and neutral detergent fiber was not different among treatments. The inclusion of 0.25 kg kg−1 of CPB in the diet of hair lambs allows for appropriate nutrient digestion without affecting Kp and MRT and increases the molar proportion of the ability of VFA to maintain acetate:propionate ratio without increasing methane production.
Interspecific hybridization among cultivars of hardy Hibiscus species section Muenchhusia
DEFF Research Database (Denmark)
Kuligowska, Katarzyna; Lütken, Henrik Vlk; Christensen, Brian
2016-01-01
Rose mallows belong to the Muenchhusia section of the Hibiscus genus. They represent a small group of cold tolerant North American plants and are popular ornamentals mainly because of their abundant, large and colorful flowers. Due to their geographical origin they are well suited for garden use...... in temperate regions worldwide. The aim of the study was to investigate hybridization barriers in crosses among cultivars of Hibiscus species from the Muenchhusia section: H. coccineus, H. laevis and H. moscheutos. Crossing barriers were identified as both pre- and post-zygotic. The analysis of pollen tube...
Energy Technology Data Exchange (ETDEWEB)
Gerosa, Giacomo [Department of Mathematics and Physics, Universita Cattolica del Sacro Cuore, via dei Musei 41, 20125 Brescia (Italy); Marzuoli, Riccardo [Department of Mathematics and Physics, Universita Cattolica del Sacro Cuore, via dei Musei 41, 20125 Brescia (Italy); Fondazione Lombardia per l' Ambiente, piazza Diaz 9, 20123 Milano (Italy); Rossini, Micol; Panigada, Cinzia; Meroni, Michele; Colombo, Roberto [Remote Sensing of Environmental Dynamics Lab., DISAT, University of Milano-Bicocca, Piazza della Scienza 1, 20126 Milano (Italy); Faoro, Franco [Plant Pathology Institute, Universita di Milano, via Celoria 2, 20133 Milano (Italy); Iriti, Marcello, E-mail: marcello.iriti@unimi.i [Plant Pathology Institute, Universita di Milano, via Celoria 2, 20133 Milano (Italy)
2009-05-15
Stomatal ozone uptake, determined with the Jarvis' approach, was related to photosynthetic efficiency assessed by chlorophyll fluorescence and reflectance measurements in open-top chamber experiments on Phaseolus vulgaris. The effects of O{sub 3} exposure were also evaluated in terms of visible and microscopical leaf injury and plant productivity. Results showed that microscopical leaf symptoms, assessed as cell death and H{sub 2}O{sub 2} accumulation, preceded by 3-4 days the appearance of visible symptoms. An effective dose of ozone stomatal flux for visible leaf damages was found around 1.33 mmol O{sub 3} m{sup -2}. Significant linear dose-response relationships were obtained between accumulated fluxes and optical indices (PRI, NDI, DELTAF/F{sub m}{sup '}). The negative effects on photosynthesis reduced plant productivity, affecting the number of pods and seeds, but not seed weight. These results, besides contributing to the development of a flux-based ozone risk assessment for crops in Europe, highlight the potentiality of reflectance measurements for the early detection of ozone stress. - Ozone stomatal fluxes affect leaf cell viability, photosynthetic performance, optical properties and crop yield of bean.
Construcción de una genoteca de cDNA de fríjol (Phaseolus vulgaris L. para mapeo genético
Directory of Open Access Journals (Sweden)
Roca William M.
1995-06-01
Full Text Available
A small cDNA library from beans (Phaseolus vulgaris L. of about 1500 clones was constructed, to further saturate the bean RFLP linkage map. The primarily synthesized cDNAs were amplified by PCR using the adaptors as primers for amplification (Jepson et al., 1991. Inserts in the range of 500 bp were obtained. 93 clones were singled for further analysis. They showed a degree of repeatibility of around 61 %. Around 80% of the unique clones were single copy, and 20% were low copy sequences as expected from a cDNA library. Three pairs of parental bean lines were chosen for their agronomical traits, and evaluated for polymorphism, which was highest as revealed by digestion with EcoRV (77%, followed by DraI (73%, EcoRI (63% and HindIIl (60%. The highest polymorphism was observed between the pair DOR60 and APNI8, 71% for EcoRV and 57% for EcoRI, respectively. Two clones of the two groups with the most repeated clones were analyzed by slot blot hybridization against the other clones and ribosomal DNA, to understand the origin of the repetitions. Only one clone seemed to be of ribosomal origin, as confirmed by the patterns obtained by hybridization to bean genomic DNA digested with HaelIl, implying that the whole group to which it belonged was of ribosomal origin. It can be explained by the combined utilization of the PCR amplification methodology and the multipleprimers for the synthesis of the first cDNA strand.
Se construyó una pequeña librería de cDNA de fríjol (phaseolus vulgaris L. de alrededor de 1500 clones, con el fin de incrementar la saturación del mapa de ligamiento de fríjol con marcadores de RFLPs. Para la generación de la librería se utilizó la técnica de amplificación por PCR (Jepson et al., 1991. En ella se utilizan como iniciadores para la reacción los mismos adaptadores empleados para generar los terminales cohesivos del cDNA. Se obtuvieron insertos con un promedio de 500 pares de bases. Se aislaron 93 clones, los
Directory of Open Access Journals (Sweden)
Elliot Watanabe Kitajima
2008-02-01
Full Text Available Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae mite-transmitted viruses (BTrV. Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV.Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido
Directory of Open Access Journals (Sweden)
Cristhian Vega Ponce
2017-06-01
Full Text Available El propósito de esta investigación consistió en estudiar el efecto de reducciones controladas de riego sobre el módulo de elasticidad (Ev en plantas de frejol común (Phaseolus vulgaris L. cultivadas en maceteros de respuesta hidrogravitrópica. Las plantas fueron sometidas a riego completo de raíces (RCR y riego parcial de raíces (RPR, donde el agua asignada de acuerdo a la curva de retención agua-suelo permitió controlar y configurar cuatro tratamientos (RPR300, RPR500, RCR300 y RCR500 o control. Se monitoreó el potencial hídrico xilemático (Mx de las hojas, para luego construir la curva presión-volumen (P-V y determinar Ev. Los resultados mostraron que los diferentes volúmenes de agua aplicados generaron importantes variaciones en los niveles de Ev; sin embargo, en los tratamientos configurados para llevar el suelo a capacidad de campo (RPR500 y RCR500 fue donde se obtuvieron los mejores desempeños de Ev, efecto esperado principalmente antes de aplicar el riego a las plantas (15,63 y 15,34 MPA, respectivamente. Finalmente, aunque ambos tratamientos obtuvieron el mismo nivel de significancia de Ev, RPR500 se destacó sobre el tratamiento control, porque los volúmenes de agua reducidos, combinados con el mantenimiento de diferentes valores de humedad en el suelo explorado por las raíces, pudieron ser claves en el favorecimiento de un ajuste elástico.
Directory of Open Access Journals (Sweden)
Rose Masiga
2014-09-01
Full Text Available Yields of commercially important crops in Kenya are often far below their potential. Amongst the possible reasons for such low yields may be the ecosystem degradation that can be expected to have negative impacts on pollinator presence in cropland, and the consequent food security issue for smallholder farmers who depend on these crops for their livelihood. Our study was carried out to assess the potential pollination deficit of French beans (Phaseolus vulgaris L., a major export vegetable crop in Kenya grown by small-scale farmers. Sufficient pollination of French beans likely results in high seed set and uniform heavier green pods. Such pods get the highest grade while malformed pods are unmarketable, reducing family income. We hypothesized that pollination success was linked to the abundance and diversity of large pollinators, itself associated with the proximity to natural habitats. Flower visitors to French beans were sampled in 2011 and 2012 in ten farmer-managed plots, five within 200 m from the edge of Mt. Kenya forest and five farther away, more than 1000 m. Each plot measured 760 m2 and was planted at the same time, with the “Julia” variety. Flowers were observed for 2 h in each plot once weekly for three weeks at peak flowering from 0900-1100 h in the morning and 1200 – 1400 h in the afternoon on alternate days. Honey bees (Apis mellifera were the most abundant visitors of French bean flowers followed by carpenter bees (Xylocopa spp. and leafcutter bees (Megachile spp.. Significantly higher numbers of leafcutter bees were recorded on farms far to the forest. There was no significant difference in honey bee abundance among the study sites, probably because apiaries and wild colonies are located across the landscape. French bean yield was significantly correlated with the mean abundance of carpenter bees in 2011. This suggests the possible occurrence of pollination deficit in French beans where the density of carpenter bees is
Directory of Open Access Journals (Sweden)
Jefferson Luís Meirelles Coimbra
1999-09-01
Full Text Available A importância das leguminosas de grãos na alimentação humana, principalmente do feijão preto (Phaseolus vulgaris, tem estimulado os melhoristas a selecionar genótipos com alto potencial de rendimento de grãos e com adaptabilidade às diferentes condições de cultivo do sul do Brasil. O presente trabalho foi realizado com o objetivo de avaliar os reflexos da interação genótipo x ambiente e suas implicações nos ganhos genéticos com diferentes critérios de seleção. Os resultados revelaram que o componente da interação genótipo x ambiente superestima a predição dos parâmetros genéticos, como por exemplo a variância genética e a herdabilidade. As diferenças observadas entre estas estimativas parecem ocorrer devido à alta percentagem da parte complexa da interação. Além disto, os ganhos genéticos obtidos com a seleção direta foram sempre superiores à resposta indireta. Comparativamente, o par de ambientes 1x3 revelou uma resposta correlacionada inferior e de sinal contrário às demais estimativas para os outros pares de ambientes estudados neste trabalho. O primeiro ambiente foi o que mais acumulou a interação genótipo x ambiente. Portanto, pode ser concluído que o componente da interação tem grande relevância nas estimativas dos ganhos genéticos, evidenciando que essa influência deva ser considerada na seleção e na recomendação de genótipos específicos nos programas de melhoramento genético da cultura do feijoeiro.The importance of grains of legume plants for human feeding, specially black beans (Phaseolus vulgaris L., has stimulated the breeders to select genotypes with high grains yield potential and wide adaptability to different conditions of cultivation in southern Brazil. The present work aimed at evaluating the reflexes of the genotype x environment interaction and its implications in the genetic gains of different selection approaches. The results revealed that the component of the
Directory of Open Access Journals (Sweden)
Corival Cândido da Silva
2007-09-01
Full Text Available
It was studied the non-preferential oviposition of Zabrotes subfasciatus (Boheman, 1833 in common beans (P. vulgaris L. cv. carioca applied with some vegetal products. The applied products were andiroba oil (Carapa guianensis, neem oil (Azadirachta indica, neem solution and the commercial product Azatin with rates 2, 4 and 6 ml/kg grain. The experimental design was completely randomized in factorial scheme 4 x 4 with 5 replications. Data were transformed in (x + 1^1/2 and variance analysis while averages were evaluated by Tukey test 5%. All products differed in control. Neem solution and Azatin at 4 ml/kg grain, neem oil at 6 ml/kg grain and andiroba oil (2, 4 and 6 ml/kg grain showed better results than other treatments.
KEY-WORDS: Zabrotes; Phaseolus; Carapa; Azadirachta; resistance.
Foi estudada a não-preferência para a oviposição de Zabrotes subfasciatus (Boheman,1833 em feijão (Phaseolus vulgaris cultivar carioca, tratado com
Energy Technology Data Exchange (ETDEWEB)
Costa, L C; Justino, F; Oliveira, L J C; Sediyama, G C; Lemos, C F [Department of Agricultural Engineering, Federal University of Vicosa, PH Rolfs S/N, Vicosa, MG, 36570 000 (Brazil); Ferreira, W P M [Embrapa Milho e Sorgo, Rodovia MG 424, km 45, Caixa Postal 285, CEP 35701-970 Sete Lagoas, MG (Brazil)], E-mail: fjustino@ufv.br
2009-01-15
Based upon sensitivity experiments, this study aims to investigate the impact of increased atmospheric CO{sub 2} concentration, climate changes, and ongoing technological advancements on bean (Phaseolus vulgaris) and maize (Zea mays) yield. This investigation assumes that the atmospheric CO{sub 2} concentration evolves according to the A2 scenario. For these analyses we have used climate data as projected by climate simulations conducted with the HadCM3 climate model for both present day and greenhouse warming conditions. The results demonstrated that warming conditions associated with increased greenhouse gases as delivered by the HadCM3 model lead to reductions in the potential productivity of maize and beans for the years 2050 and 2080 by up to 30%. This thermal response is, however, damped by the highly efficient CO{sub 2} fertilization effect which is expected to increase bean productivity as compared to present day conditions. A similar investigation for maize yield revealed a different picture. It has been found that the CO{sub 2} fertilization feedback is much weaker and cannot cancel out the thermal effect. We have found, therefore, that climate changes as simulated to occur in the future are not favorable for increasing the maize yield in southeast Brazil. By the inclusion of the third forcing evaluated, representing technological advancements, it is demonstrated that improvements in the crop system reduce the negative effect associated with warmer climate conditions for both crops. We conclude that appropriate soil and technological management as well as genetic improvements may very likely induce an increase in bean and maize yield despite the unfavorable future climate conditions.
Luzardo-Ocampo, I; Campos-Vega, R; Gaytán-Martínez, M; Preciado-Ortiz, R; Mendoza, S; Loarca-Piña, G
2017-10-01
Corn (Zea mays L.) and common beans (Phaseolus vulgaris L.) are alternative suitable ingredients for snacks, because of their content of bioactive compounds such as phenolic compounds (PC) and oligosaccharides (OS). However, there is no information about the transformation of these compounds associated with food matrix during gastrointestinal digestion. Therefore, the objective of this work was to simulate the whole digestion process (mouth to colon) to estimate bioaccessibility and small intestine permeability of free PC and OS, and the antioxidant capacity of free PC. Digested nixtamalized corn-cooked common bean chips exhibited significant different quantities of free PC and OS, and higher antioxidant activity compared to methanolic extract. The free PC showed high values of apparent permeability coefficients (0.023-0.729×10 -3 ), related with their absorption in the small intestine. Both free PC and OS were retained in the non-digestible fraction of chips (10.24-64.4%) and were able to reach the colon. Our results suggest the digestion potential to increase chip bioactive compounds and antioxidant activity. Additional studies are required to evaluate their in vivo effects. Copyright © 2017. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
María Virginia Mujica
2017-12-01
Full Text Available El endurecimiento de los granos de caraota (Phaseolus vulgaris generado por el almacenamiento en condiciones de alta temperatura y humedad relativa representa una limitante importante para su consumo. El objetivo del presente trabajo fue evaluar el efecto de un tratamiento con vapor y luego secado a los granos de P. vulgaris recién cosechados en la prevención de su endurecimiento. Inicialmente, se construyeron las curvas de secado a 40; 47,5 y 55 ºC. Seguidamente, los granos se trataron con vapor por 8 min 20 s y se sometieron a un proceso de secado, bajo un diseño central compuesto cuyos factores fueron la temperatura del aire (40 y 55 ºC y el tiempo de secado (4 y 8 h. La muestra secada de cada tratamiento se dividió en 3 lotes, el primero se analizó de inmediato y los otros se almacenaron por 5 semanas bajo 2 condiciones distintas 5 ºC/34 % HR y 37 ºC/75 % HR. Las determinaciones realizadas fueron humedad, capacidad de imbibición, tiempo de cocción y actividad de la peroxidasa soluble. El tiempo de secado fue de 6,5; 5 y 2,5 h a 40; 47,5 y 55 ºC, respectivamente, para alcanzar una humedad de 13 % (b.s.. El coeficiente de difusión resultó igual a 3,40x10-9; 3,52x10-9 y 3,87x10-9 m2/s, a 40, 47,5 y 55 ºC, respectivamente. El valor de la energía de activación fue de 7,33 kJ/mol. La aplicación de vapor y posterior secado de los granos no previno su endurecimiento, y este no dependió de la actividad de la peroxidasa soluble. Por lo que se puede inferir que los compuestos fenólicos y la enzima peroxidasa no son los únicos implicados en el mecanismo de endurecimiento de los granos de P. vulgaris.
Directory of Open Access Journals (Sweden)
Hakime Ziaei
2016-05-01
Full Text Available In order to evaluate the intercropping of corn (Zea mays L. and bean cultivars (Phaseolus spp. an experiment was carried out in a randomized complete block design with three replicaties at Sari Agricultural Sciences and Natural Resources University during growing season of 2010. The experimental treatments consisted of sole cropping of corn, white bean, bush bean, red bean, pinto bean and sword bean and 50:50 ratio of corn and bean types. In this experiment, the corn-bush bean and corn-pinto bean intercropping had the highest seed yield (5734.4 and 5674.3 kg/ha-1, respectively and land equivalent ratio (LER=1.13 and 1.21, respectively. Evaluated intercropping indices indicated that red bean (k= 1.85, pinto bean (k= 2.41 and sword bean (k= 2.80 had the highest crowding coefficient whereas the maximum aggressivity value was belonged to pinto bean intercropped with corn (A= -0.02. Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.
Directory of Open Access Journals (Sweden)
Novian Swasono Hadi
2016-01-01
Full Text Available Background: Lifestyle changes with high-fat food consumption is one of the factors the risks of cardiovascular diseases like of coronary heart disease and atherosclerosis. A healthy diet and a balanced diet and consume foods that contain lots of antioxidants is one of the effective ways to prevent hyperlipidemia. Mung bean sprouts have properties that neutralize free radicals cause Hyperlipidemia and cardiovascular diseases because it is an antioxidant compound. Objective: The aim of this study was to determinate the effect of mung bean sprouts (Phaseolus radiatus (L to blood pressure and histopathology aorta of Sprague-Dawley male rats. Method: The type of study was experimental research using pre-post test controlled group design for blood pressure variable and post test only controlled group design histopathology aorta. The thirty-five of Sprague-Dawley male rats was eight weeks divided into 5 groups. The first group was given standard diet, group 2 was given a hight fat diet, the third group was given a high-fat diet and mung bean sprout 0,67 gram, group 4 was given a high-fat diet and mung bean 1,34 gram, and group 5 was given a high-fat diet and vitamin E doses of 23 IU. Results: Result of this study showed that after 4 weeks of treatment, increased in blood pressure systole in the given of high fat diet higher than group who were given a high fat diet and mung bean sprout and also on group who were given high fat diet and vitamin E, but there is no difference effect a decrease in blood pressure between the provision of mung bean sprouts and vitamin E (p>0,05. Statistical analysis to thick the wall the aorta show the similarity meaningful in all the treatment group, it can be said that overall thick the wall the aorta in this research is not different. Conclusion: A dose of mung bean sprout 0,67 g is optimal doses in preventing a rise in blood pressure and prevent alterations histopathology Sprague-Dawley male rats.
Directory of Open Access Journals (Sweden)
Christine D. Barbeau
2015-05-01
Full Text Available Aboriginal people in Canada experience disproportionately high rates of diet-related illnesses, such as obesity and diabetes. Food insecurity has been identified as a contributing factor to these illnesses along with a loss of traditional lifestyle. Current food systems within northern subarctic and arctic regions of Canada rely heavily on imported foods that are expensive (when available, and are environmentally unsustainable. A warming subarctic and arctic climate present challenges, but also offers the opportunity for local agricultural production that can increase food security and promote a more sustainable food system. In this study the feasibility of sustainably growing potatoes (Solanum tuberosum L. utilizing agroforestry practices to enhance food security in remote subarctic communities is explored through a case study in Fort Albany First Nation in northern Ontario, Canada. Potato crops were grown over a two-year period and rotated into plots that had been planted with green bush beans (Phaseolus vulgaris L.. Results showed that potatoes and bush beans could be grown successfully in the subarctic without the use of greenhouses with yields comparable to more conventional high-input agricultural methods. In subarctic Canada, sustainable local food production can help to promote social capital, healthier lifestyles, and food security.
Dall'Agnol, Rebeca Fuzinatto; Bournaud, Caroline; de Faria, Sérgio Miana; Béna, Gilles; Moulin, Lionel; Hungria, Mariangela
2017-04-01
Some species of the genus Paraburkholderia that are able to nodulate and fix nitrogen in symbiosis with legumes are called β-rhizobia and represent a group of ecological and biotechnological importance. We used Mimosa pudica and Phaseolus vulgaris to trap 427 rhizobial isolates from rhizospheric soil of Mimoseae trees in the Brazilian Atlantic Forest. Eighty-four representative strains were selected according to the 16S rRNA haplotypes and taxonomically characterized using a concatenated 16S rRNA-recA phylogeny. Most strains were assembled in the genus Paraburkholderia, including Paraburkholderia sabiae and Pa. nodosa. Mesorhizobium (α-rhizobia) and Cupriavidus (β-rhizobia) were also isolated, but in smaller proportions. Multilocus sequence analysis and BOX-PCR analyses indicated that six clusters of Paraburkholderia represent potential new species. In the phylogenetic analysis of the nodC gene, the majority of the strains were positioned in the same groups as in the 16S rRNA-recA tree, indicative of stability and vertical inheritance, but we also identified horizontal transfer of nodC in Pa. sabiae. All α- and β-rhizobial species were trapped by both legumes, although preferences of the host plants for specific rhizobial species have been observed. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Energy Technology Data Exchange (ETDEWEB)
Macacini, Jose Flavio
2000-01-15
Due to the increasing use of nuclear fission for the generation of electrical energy, the safety aspects of power plants must be minutely appraised. In case of an accident, with liberation of radioactive material into the atmosphere, knowledge about the behavior of plant species when in contact with radionuclides is indispensable. An important route through which agricultural products are contaminated by radionuclides is leaf-fruit translocation. This phenomenon can be evaluated by simulating a fallout contamination in a controlled atmosphere using as a tracer man-made radionuclides. In order to quantity the leaf-fruit translocation coefficients for {sup 60}Co, {sup 90}Sr and {sup 137}Cs in the common bean (Phaseolus vulgaris), variety black diamond, an experiment was carried out in a greenhouse with completely randomized blocks design with six treatments and four blocks. A mixture of these three radionuclides was prepared and used to determine their translocation coefficients. The bean plants were contaminated inside a device especially designed to avoid environmental contamination. In each treatment four vases were sprinkled and one was used to estimate the initial activity of the other three vases. High-resolution gamma-ray spectrometry was used for {sup 60}Co and {sup 137}Cs activity determinations and chemical separation followed by beta counting of {sup 90}Y was used for {sup 90}Sr determinations. The number of treatments was reduced from six to four sprayings corresponding to 30, 45, 60 and 75 days after planting. This reduction was due to the attack of common and gold mosaic viroses. Symptoms were observed on the diseased bean plants 50 days after planting. It was possible, however, to verify a functional dependence between instant of tracer application and the level of physiological development of the bean plant. It was verified that the temporal relationship values for leaf-fruit translocation were similar for {sup 60}Co and {sup 137}Cs. For the {sup 90
Atkinson, C.T.; Lease, J.K.; Dusek, Robert J.; Samuel, M.D.
2005-01-01
Introduced avian pox virus and malaria have had devastating impacts on native Hawaiian forest birds, yet little has been published about their prevalence and distribution in forest bird communities outside of windward Hawaii Island. We surveyed native and non-native forest birds for these two diseases at three different elevations on leeward Mauna Loa Volcano at the Kona Forest Unit of Hakalau Forest National Wildlife Refuge. Prevalence of malaria by both serology and microscopy varied by elevation and ranged from 28% at 710 m to 13% at 1830 m. Prevalence of pox-like lesions also varied by altitude, ranging in native species from 10% at 710 m to 2% at 1830 m. Native species at all elevations had the highest prevalence of malarial antibody and pox-like lesions. By contrast, pox-like lesions were not detected in individuals of four non-native species and only 5% of Japanese White-eye (Zosterops japonicus) was positive for malaria. A significantly high proportion of birds with pox-like lesions also had serological evidence of concurrent, chronic malarial infections, suggesting an interaction between these diseases, dual transmission of both diseases by the primary mosquito vector (Culex quinquefasciatus) or complete recovery of some pox-infected birds without loss of toes. Results from this study document high prevalence of malaria and pox at this refuge. Development of effective disease control strategies will be important for restoration of remnant populations of the endangered 'Akiapola'au (Hemignathus munroi), Hawaii Creeper (Oreomystis mana), and Hawaii 'Akepa (Loxops coccineus coccineus) that still occur on the refuge.
Coefficients of leaf-fruit translocation for 60Co, 90Sr and 137Cs in bean plant (Phaseolus vulgaris)
International Nuclear Information System (INIS)
Macacini, Jose Flavio
2000-01-01
Due to the increasing use of nuclear fission for the generation of electrical energy, the safety aspects of power plants must be minutely appraised. In case of an accident, with liberation of radioactive material into the atmosphere, knowledge about the behavior of plant species when in contact with radionuclides is indispensable. An important route through which agricultural products are contaminated by radionuclides is leaf-fruit translocation. This phenomenon can be evaluated by simulating a fallout contamination in a controlled atmosphere using as a tracer man-made radionuclides. In order to quantity the leaf-fruit translocation coefficients for 60 Co, 90 Sr and 137 Cs in the common bean (Phaseolus vulgaris), variety black diamond, an experiment was carried out in a greenhouse with completely randomized blocks design with six treatments and four blocks. A mixture of these three radionuclides was prepared and used to determine their translocation coefficients. The bean plants were contaminated inside a device especially designed to avoid environmental contamination. In each treatment four vases were sprinkled and one was used to estimate the initial activity of the other three vases. High-resolution gamma-ray spectrometry was used for 60 Co and 137 Cs activity determinations and chemical separation followed by beta counting of 90 Y was used for 90 Sr determinations. The number of treatments was reduced from six to four sprayings corresponding to 30, 45, 60 and 75 days after planting. This reduction was due to the attack of common and gold mosaic viroses. Symptoms were observed on the diseased bean plants 50 days after planting. It was possible, however, to verify a functional dependence between instant of tracer application and the level of physiological development of the bean plant. It was verified that the temporal relationship values for leaf-fruit translocation were similar for 60 Co and 137 Cs. For the 90 Sr, the translocation was below 2,5 mBq kg -1 /Bq
Barbosa, Aulus E A D; Albuquerque, Erika V S; Silva, Maria C M; Souza, Djair S L; Oliveira-Neto, Osmundo B; Valencia, Arnubio; Rocha, Thales L; Grossi-de-Sa, Maria F
2010-06-17
Coffee is an important crop and is crucial to the economy of many developing countries, generating around US$70 billion per year. There are 115 species in the Coffea genus, but only two, C. arabica and C. canephora, are commercially cultivated. Coffee plants are attacked by many pathogens and insect-pests, which affect not only the production of coffee but also its grain quality, reducing the commercial value of the product. The main insect-pest, the coffee berry borer (Hypotheneumus hampei), is responsible for worldwide annual losses of around US$500 million. The coffee berry borer exclusively damages the coffee berries, and it is mainly controlled by organochlorine insecticides that are both toxic and carcinogenic. Unfortunately, natural resistance in the genus Coffea to H. hampei has not been documented. To overcome these problems, biotechnological strategies can be used to introduce an alpha-amylase inhibitor gene (alpha-AI1), which confers resistance against the coffee berry borer insect-pest, into C. arabica plants. We transformed C. arabica with the alpha-amylase inhibitor-1 gene (alpha-AI1) from the common bean, Phaseolus vulgaris, under control of the seed-specific phytohemagglutinin promoter (PHA-L). The presence of the alpha-AI1 gene in six regenerated transgenic T1 coffee plants was identified by PCR and Southern blotting. Immunoblotting and ELISA experiments using antibodies against alpha-AI1 inhibitor showed a maximum alpha-AI1 concentration of 0.29% in crude seed extracts. Inhibitory in vitro assays of the alpha-AI1 protein against H. hampei alpha-amylases in transgenic seed extracts showed up to 88% inhibition of enzyme activity. This is the first report showing the production of transgenic coffee plants with the biotechnological potential to control the coffee berry borer, the most important insect-pest of crop coffee.
Directory of Open Access Journals (Sweden)
Oliveira-Neto Osmundo B
2010-06-01
Full Text Available Abstract Background Coffee is an important crop and is crucial to the economy of many developing countries, generating around US$70 billion per year. There are 115 species in the Coffea genus, but only two, C. arabica and C. canephora, are commercially cultivated. Coffee plants are attacked by many pathogens and insect-pests, which affect not only the production of coffee but also its grain quality, reducing the commercial value of the product. The main insect-pest, the coffee berry borer (Hypotheneumus hampei, is responsible for worldwide annual losses of around US$500 million. The coffee berry borer exclusively damages the coffee berries, and it is mainly controlled by organochlorine insecticides that are both toxic and carcinogenic. Unfortunately, natural resistance in the genus Coffea to H. hampei has not been documented. To overcome these problems, biotechnological strategies can be used to introduce an α-amylase inhibitor gene (α-AI1, which confers resistance against the coffee berry borer insect-pest, into C. arabica plants. Results We transformed C. arabica with the α-amylase inhibitor-1 gene (α-AI1 from the common bean, Phaseolus vulgaris, under control of the seed-specific phytohemagglutinin promoter (PHA-L. The presence of the α-AI1 gene in six regenerated transgenic T1 coffee plants was identified by PCR and Southern blotting. Immunoblotting and ELISA experiments using antibodies against α-AI1 inhibitor showed a maximum α-AI1 concentration of 0.29% in crude seed extracts. Inhibitory in vitro assays of the α-AI1 protein against H. hampei α-amylases in transgenic seed extracts showed up to 88% inhibition of enzyme activity. Conclusions This is the first report showing the production of transgenic coffee plants with the biotechnological potential to control the coffee berry borer, the most important insect-pest of crop coffee.
Amelia, Kassim; Khor, Chin Yin; Shah, Farida Habib; Bhore, Subhash J
2015-01-01
Common beans (Phaseolus vulgaris L.) are widely consumed as a source of proteins and natural products. However, its yield needs to be increased. In line with the agenda of Phaseomics (an international consortium), work of expressed sequence tags (ESTs) generation from bean pods was initiated. Altogether, 5972 ESTs have been isolated. Alcohol dehydrogenase (AD) encoding gene cDNA was a noticeable transcript among the generated ESTs. This AD is an important enzyme; therefore, to understand more about it this study was undertaken. The objective of this study was to elucidate P. vulgaris L. AD (PvAD) gene cDNA sequence and to predict the three-dimensional (3D) structure of deduced protein. positive and negative strands of the PvAD cDNA clone were sequenced using M13 forward and M13 reverse primers to elucidate the nucleotide sequence. Deduced PvAD cDNA and protein sequence was analyzed for their basic features using online bioinformatics tools. Sequence comparison was carried out using bl2seq program, and tree-view program was used to construct a phylogenetic tree. The secondary structures and 3D structure of PvAD protein were predicted by using the PHYRE automatic fold recognition server. The sequencing results analysis showed that PvAD cDNA is 1294 bp in length. It's open reading frame encodes for a protein that contains 371 amino acids. Deduced protein sequence analysis showed the presence of putative substrate binding, catalytic Zn binding, and NAD binding sites. Results indicate that the predicted 3D structure of PvAD protein is analogous to the experimentally determined crystal structure of s-nitrosoglutathione reductase from an Arabidopsis species. The 1294 bp long PvAD cDNA encodes for 371 amino acid long protein that contains conserved domains required for biological functions of AD. The predicted deduced PvAD protein's 3D structure reflects the analogy with the crystal structure of Arabidopsis thaliana s-nitrosoglutathione reductase. Further study is required
Directory of Open Access Journals (Sweden)
Disney Ribeiro Dias
2010-03-01
Full Text Available The common bean (Phaseolus vulgaris L. is a staple food in the Brazilian diet and represents the major source of dietary protein and other micronutrients and minerals. Despite the considerable protein concentration in beans, the food is considered of low biological value when compared to animal proteins and other plant protein sources. To improve the availability of protein in beans, enzymatic treatments were performed in four cultivars (ON, OPNS, TAL and VC3. The approach was a completely randomized design with four replicates. We used a 4 × 3 factorial arrangement (four cultivars and three treatments: treatment 1-addition of commercial protease (Trypsin 250, Difco, treatment 2-addition of protease from Bacillus sp., and treatment 3:-control without enzyme addition. The enzyme: substrate ratio was 5% w/w (amount of enzyme per total protein in bean flour. The approach was a completely randomized design with four replicates. A 4 × 3 factorial arrangement (four cultivars and three treatments, the same as those mentioned above was used. The concentration of total protein (g.100 g-1 of dry matter in the samples ranged from 16.94 to 18.06%, while the concentration of total phenolics was between 0.78 and 1.12% (g Eq. tannic acid.100 g-1 dry matter. The in vitro protein digestibility of enzymatically untreated bean flour (control ranged from 47.30 to 56.17% based on the digestibility of casein. Concentrations of P, K, Ca, Mg, and Zn observed in the four cultivars tested were within the average values available in the literature. Treatment 2 with protease from Bacillus sp. induced decreases in the levels of Cu and Mn. The average Fe content increased in all bean flour samples when treated with proteases, reaching a maximum increase of 102% in the TAL flour treated with protease from Bacillus sp. The digestibility of all beans tested was significantly increased (p O feijão (Phaseolus vulgaris L. é um alimento básico na refeição do brasileiro
Energy Technology Data Exchange (ETDEWEB)
Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)
2005-08-15
The effects of foliar applications of ethylenediurea (EDU) on responses to ozone by field-grown bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive) and 'R123' (O{sub 3}-tolerant), and cultivars 'BBL 290' (O{sub 3}-sensitive) and 'BBL 274' (O{sub 3}-tolerant) were investigated during the 2001 and 2002 growing seasons. EDU was applied weekly to designated plants between primary leaf expansion and pod senescence. Results were compared with control plants at harvests made at pod maturation and pod senescence. In 2001, average hourly ambient O{sub 3} concentrations ranged between 41 and 59 ppb for a total of 303 h; in 2002, for 355 h. EDU applications prior to pod maturation significantly increased the number of marketable pods in 'R123', but not for the other cultivars. Harvests at pod senescence showed significant improvements in crop yield production in EDU-treated 'S156' plants, whereas for EDU-treated 'R123' plants significant reductions were determined in above-ground biomass and seed production. In contrast, results from 'BBL 290' and 'BBL 274' at both harvest points were inconclusive. Growth and reproductive responses of O{sub 3}-sensitive and O{sub 3}-tolerant bush bean plants to EDU applications varied, depending on developmental stages, duration of EDU applications, and fluctuations in ambient O{sub 3}. - Plant sensitivity to ozone, stage of plant development, number of applications of EDU and ambient ozone affect bean plant responses to EDU.
Energy Technology Data Exchange (ETDEWEB)
Marcos Filho, Julio
1971-07-01
Seeds of the field bean variety 'Goiano Precoce' (Phaseolus vulgaris L.) subjected to various radiation doses ({sup 60}Co) ( Co) were used in a series of experiments with the objective of studying the different aspects of seed behavior thus treated. The radiation doses, comprising six treatments, varied from 0,0 to 6,4 krad of gamma radiation. Effect on seed germination and seedling dry weight was studied by means of a factorial experiment conducted under laboratory controlled conditions. The factors used were the radiation doses and nine increasing lengths of time from date of seed irradiation. Seed vigor was determined by the rate of seedling emergence when planted in small field plots. A factorial design was used. The variables were the radiation dosages and six lengths of time elapsed since date of seed irradiation. The effect of seed irradiation on yield was evaluated by means of two randomized block design field experiments. After the seed vigor experiment was conducted infestation by the bean weevil, Acanthoscelidcs obtectus Say , was observed in irradiated seeds stored under normal conditions, indicating a relationship between radiation dosage and insect damage. An analysis was made of this effect at fourteen increasing time intervals. The analysis was made according to a factorial scheme considering as factors radiation dosage and time interval. The following conclusions could be drawn from the analysis and discussion of the results obtained: a) Seed germination was adversely affected by all radiation doses in relation to the check treatment. This effect however decreased significantly with storing time. b) Seed vigor was higher for those treated with 0,4 , 0,8 and 1,6 krad when compared with those that were not irradiated. c) Pod and seed weight were lowered by the 1,6 and 6,4 krad radiation doses in relation to the check treatment. d) Infestation by the bean weevil was significantly checked by all radiation treatments in relation to the check treatment
Antracnosis de la faba ("Colletotrichum lindemuthianum" (Sacc. & Magn.) Scribner)
Landeras, Elena; Menéndez, Fermín; Braña, Máximo
2010-01-01
1 h. (2 p.) il. col. Este hongo produce graves daños a la judía común ("Phaseolus vulgaris"), y especialmente a la variedad "faba granja", pero también puede atacar a otras especies de "Phaseolus" y a otros cultivos de leguminosas de menor importancia. UNIÓN EUROPEA, Fondo Europeo de Orientación y Garantía Agrícola
Directory of Open Access Journals (Sweden)
Del Pino Victoria H.
2003-01-01
Full Text Available Cantidades variables de dos sistemas multienzimáticos de tripsina-quimotripsina-peptidasa y pepsina-pancreatina, fueron utilizados para evaluar el efecto de los taninos provenientes de frijol Carioca (Phaseolus vulgaris L. sobre la digestibilidad de la faseolina, en las formas nativa y denaturalizada. Esta evaluación hecha por los métodos de caida de pH, de hidrólisis en medio tamponado con posterior medición del grado de hidrólisis con ninhidrina y por la técnica electroforética, demostró el efecto adverso de los taninos condensados sobre la digestibilidad de la faseolina, después de producirse una significativa inhibición en el grado de hidrólisis de esa proteína por los dos sistemas multienzimáticos. Se comprobó la dificultad de hidrólisis de la faseolina cuando esta unida al tanino en el punto de saturación (proporción 5/20 tanino/proteína p/p y mayores, después de detectarse en los perfiles electroforéticos, péptidos de 45.7 y 24KDa, resistentes a la hidrólisis hasta por prolongados períodos de incubación. Esto se debió a la existencia de un complejo de naturaleza refractária no digeríble, incluso en condiciones excesivas de enzima. Los resultados sugieren la unión simultánea del tanino con mas de un ligante a través de sus múltiples grupos hidróxilos libres, formando un complejo proteína-tanino-enzima (PTE* que correspondería a la fracción no digeríble de la faseolina.
Interrelationship among some yield characters and the productivity of mutants of three grain legumes
International Nuclear Information System (INIS)
Rubaihayo, P.R.
1976-01-01
The effect of gamma-ray irradiation dosage and environmental conditions on yield component correlations was studied on food beans (Phaseolus vulgaris), white haricot beans (Phaseolus vulgaris) and soy beans (Glycine max L.). It was found that in general radiation dosage had no significant effects on these factors. Differences in the relationships in different generations were attributed to the environmental conditions under which the plants were grown during different generations. (author)
Freixas Coutin, José A; Munholland, Seth; Silva, Anjali; Subedi, Sanjeena; Lukens, Lewis; Crosby, William L; Pauls, K Peter; Bozzo, Gale G
2017-05-25
Edible dry beans (Phaseolus vulgaris L.) that darken during postharvest storage are graded lower and are less marketable than their non-darkened counterparts. Seed coat darkening in susceptible genotypes is dependent upon the availability of proanthocyanidins, and their subsequent oxidation to reactive quinones. Mature cranberry beans lacking this postharvest darkening trait tend to be proanthocyanidin-deficient, although the underlying molecular and biochemical determinants for this metabolic phenomenon are unknown. Seed coat proanthocyanidin levels increased with plant maturation in a darkening-susceptible cranberry bean recombinant inbred line (RIL), whereas these metabolites were absent in seeds of the non-darkening RIL plants. RNA sequencing (RNA-seq) analysis was used to monitor changes in the seed coat transcriptome as a function of bean development, where transcript levels were measured as fragments per kilobase of exon per million fragments mapped. A total of 1336 genes were differentially expressed between darkening and non-darkening cranberry bean RILs. Structural and regulatory genes of the proanthocyanidin biosynthesis pathway were upregulated in seed coats of the darkening RIL. A principal component analysis determined that changes in transcript levels for two genes of unknown function and three proanthocyanidin biosynthesis genes, FLAVANONE 3-HYDROXYLASE 1, DIHYDROFLAVONOL 4-REDUCTASE 1 and ANTHOCYANIDIN REDUCTASE 1 (PvANR1) were highly correlated with proanthocyanidin accumulation in seed coats of the darkening-susceptible cranberry bean RIL. HPLC-DAD analysis revealed that in vitro activity of a recombinant PvANR1 was NADPH-dependent and assays containing cyanidin yielded epicatechin and catechin; high cyanidin substrate levels inhibited the formation of both of these products. Proanthocyanidin oxidation is a pre-requisite for postharvest-related seed coat darkening in dicotyledonous seeds. In model plant species, the accumulation of
Salehi, Hajar; Chehregani, Abdolkarim; Lucini, Luigi; Majd, Ahmad; Gholami, Mansour
2018-03-01
Chemically synthesized nanoparticles (NPs) are widely used in industry and concern over their impact on the environment is rising. In this study, greenhouse grown bean (Phaseolus vulgaris L.) plants were treated with CeO 2 NPs suspensions at 0, 250, 500, 1000, and 2000mgL -1 either aerially by spraying or via soil application. At 15days after treatment, plants were analyzed for Ce uptake, morphological and biochemical assays, as well as high-resolution mass spectrometry based metabolomics and proteomics. The results from ICP-MS assays showed a dose dependent absorption, uptake and translocation of Ce through both roots and leaves; Ce content increased from 0.68 up to 1894mgkg -1 following spray application, while concentrations were three orders lower following soil application (0.59 to 2.19mgkg -1 ). Electrolyte leakage increased with NPs rate, from 25.2% to 70.3% and from 24.8% to 32.9% following spray and soil application, respectively. Spraying lowered stomatal density (from 337 to 113 per mm 2 ) and increased stomatal length (from 12.8 to 19.4μm), and altered photosynthesis and electron transport chain biochemical machinery. The increase in Ce content induced accumulation of osmolites (proline increased from 0.54 to 0.65mg/g under spray application), phytosiderophores (muconate and mugineate compounds showed increase fold-changes >16) and proteins involved in folding or turnover. NPs application induced membrane damage, as evidenced by the increase in membrane lipids degradates and by the increase in electrolyte leakage, and caused oxidative stress. Most of the responses were not linear but dose-dependent, whereas metabolic disruption is expected at the highest NPs dosage. Both proteomics and metabolomics highlighted a stronger effect of CeO 2 NPs spraying, as compared to soil application. High concentrations of NPs in the environment have been confirmed to pose toxicity concern towards plants, although important differences could be highlighted between
Directory of Open Access Journals (Sweden)
Renfeng Xue
Full Text Available Fusarium wilt of common bean (Phaseolus vulgaris L., caused by Fusarium oxysporum Schlechtend.:Fr. f.sp. phaseoli (Fop, is one of the most important diseases of common beans worldwide. Few natural sources of resistance to Fop exist and provide only moderate or partial levels of protection. Despite the economic importance of the disease across multiple crops, only a few of Fop induced genes have been analyzed in legumes. Therefore, our goal was to identify transcriptionally regulated genes during an incompatible interaction between common bean and the Fop pathogen using the cDNA amplified fragment length polymorphism (cDNA-AFLP technique. We generated a total of 8,730 transcript-derived fragments (TDFs with 768 primer pairs based on the comparison of a moderately resistant and a susceptible genotype. In total, 423 TDFs (4.9% displayed altered expression patterns after inoculation with Fop inoculum. We obtained full amplicon sequences for 122 selected TDFs, of which 98 were identified as annotated known genes in different functional categories based on their putative functions, 10 were predicted but non-annotated genes and 14 were not homologous to any known genes. The 98 TDFs encoding genes of known putative function were classified as related to metabolism (22, signal transduction (21, protein synthesis and processing (20, development and cytoskeletal organization (12, transport of proteins (7, gene expression and RNA metabolism (4, redox reactions (4, defense and stress responses (3, energy metabolism (3, and hormone responses (2. Based on the analyses of homology, 19 TDFs from different functional categories were chosen for expression analysis using quantitative RT-PCR. The genes found to be important here were implicated at various steps of pathogen infection and will allow a better understanding of the mechanisms of defense and resistance to Fop and similar pathogens. The differential response genes discovered here could also be used as
International Nuclear Information System (INIS)
Mendes, Nathalia S.R.; Silva, Yasmini P.A.; Tiraboschi, Paula C.A.; Takeuchi, Katiucha P.; Souza, Adriana R.M.; Arthur, Valter
2011-01-01
The bean is a staple food of the population, being one of the main products in the diet of the economically less privileged social strata. All these factors mean that beans occupy a prominent space in both the social and economic environment in Brazil [1]. In this social and economic importance of beans, adds to the growing demand, both consumers and producers, of food products that have a quality nutritional and technological properties desirable in order to obtain good quality products, which would have greater capacity competitive in the market. The quality of the beans processed depends on the growth conditions, maturity stage at harvest, processing and storage. During processing, there may be biochemical and chemical changes that affect the texture of the product [2]. Given this need, the irradiation of foods has been increasing in recent years as a preservation method that can guarantee the level of product safety, without causing major changes in nutritional and sensory characteristics of products [3].In this context, this work had the objective to evaluate the effects of irradiation on the texture of commercial beans (Phaseolus vulgaris L.) variety Carioca. The raw material (raw beans) was acquired in trade from the city of Goiania (GO) in plastic containers containing 1 kg of product. It has purchased three packs of different brands, widely accepted by local people, making a total of 3 kg of beans from each brand. It was noted the date of filling the grain, so that all the samples had approximately the same age. Thus eliminated is the age factor as a possible responsible for differences that could be observed between the samples after the time of analysis. The beans were then taken to the Laboratory of Physical Chemistry where they were removed from original containers, homogenized and packaged in polypropylene properly identified and sealed, containing 100g of product, then separated into lots. The different batches of raw beans were sent for irradiation
Energy Technology Data Exchange (ETDEWEB)
Mendes, Nathalia S.R.; Silva, Yasmini P.A.; Tiraboschi, Paula C.A.; Takeuchi, Katiucha P.; Souza, Adriana R.M., E-mail: adriana.souza@pesquisador.cnpq.br [Escola de Agronomia e Engenharia de Alimentos. Universidade Federal de Goias - UFG, Goiania, GO (Brazil); Arthur, Valter, E-mail: arthur@cena.usp.br [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)
2011-07-01
The bean is a staple food of the population, being one of the main products in the diet of the economically less privileged social strata. All these factors mean that beans occupy a prominent space in both the social and economic environment in Brazil [1]. In this social and economic importance of beans, adds to the growing demand, both consumers and producers, of food products that have a quality nutritional and technological properties desirable in order to obtain good quality products, which would have greater capacity competitive in the market. The quality of the beans processed depends on the growth conditions, maturity stage at harvest, processing and storage. During processing, there may be biochemical and chemical changes that affect the texture of the product [2]. Given this need, the irradiation of foods has been increasing in recent years as a preservation method that can guarantee the level of product safety, without causing major changes in nutritional and sensory characteristics of products [3].In this context, this work had the objective to evaluate the effects of irradiation on the texture of commercial beans (Phaseolus vulgaris L.) variety Carioca. The raw material (raw beans) was acquired in trade from the city of Goiania (GO) in plastic containers containing 1 kg of product. It has purchased three packs of different brands, widely accepted by local people, making a total of 3 kg of beans from each brand. It was noted the date of filling the grain, so that all the samples had approximately the same age. Thus eliminated is the age factor as a possible responsible for differences that could be observed between the samples after the time of analysis. The beans were then taken to the Laboratory of Physical Chemistry where they were removed from original containers, homogenized and packaged in polypropylene properly identified and sealed, containing 100g of product, then separated into lots. The different batches of raw beans were sent for irradiation
Directory of Open Access Journals (Sweden)
Eliane Divina de Tolêdo Souza
2007-09-01
Full Text Available
Arcelin is a seed protein only found in wild beans which gives resistance to bean weevil (Zabrotes subfasciatus Bohemann, 1833. In this study the non preference for oviposition and feeding of the bean weevil was evaluated on a series of near isogenic bean lines: Arc 1, Arc 2, Arc 3 and Arc 4. The bean cultivars Porrillo 70 and Goiano Precoce were utilized as susceptible checks. There wasn’t oviposition preference among the six genotypes studied. The near isogenic lines that contain Arcelin 1 and Arcelin 2 were the last in preference for feeding.
KEY-WORDS: Resistance; non preference.
A arcelina é uma proteína encontrada somente em feijões silvestres e é o fator que confere resistência ao caruncho Zabrotes subfasciatus (Bohemann, 1833. Procurou-se verificar a não-preferência para oviposição e alimentação de Z. subfasciatus em uma série de linhagens de feijão quase isogênicas contendo diferentes alelos de arcelina: Arc 1, Arc 2, Arc 3 e Arc 4. Os controles suscetíveis utilizados foram Porrillo 70 e Goiano Precoce. Não houve preferência para oviposição entre os seis genótipos estudados. As linhagens quase isogênicas contendo Arcelina 1 e Arcelina 2 foram as menos preferidas para alimentação.
PALAVRAS-CHAVE: Resistência; Phaseolus; Zabrotes; não-preferência.
Directory of Open Access Journals (Sweden)
Gronwald John W
2010-05-01
Full Text Available Abstract Background Common bean (Phaseolus vulgaris L. and soybean (Glycine max both belong to the Phaseoleae tribe and share significant coding sequence homology. This suggests that the GeneChip® Soybean Genome Array (soybean GeneChip may be used for gene expression studies using common bean. Results To evaluate the utility of the soybean GeneChip for transcript profiling of common bean, we hybridized cRNAs purified from nodule, leaf, and root of common bean and soybean in triplicate to the soybean GeneChip. Initial data analysis showed a decreased sensitivity and accuracy of measuring differential gene expression in common bean cross-species hybridization (CSH GeneChip data compared to that of soybean. We employed a method that masked putative probes targeting inter-species variable (ISV regions between common bean and soybean. A masking signal intensity threshold was selected that optimized both sensitivity and accuracy of measuring differential gene expression. After masking for ISV regions, the number of differentially-expressed genes identified in common bean was increased by 2.8-fold reflecting increased sensitivity. Quantitative RT-PCR (qRT-PCR analysis of 20 randomly selected genes and purine-ureide pathway genes demonstrated an increased accuracy of measuring differential gene expression after masking for ISV regions. We also evaluated masked probe frequency per probe set to gain insight into the sequence divergence pattern between common bean and soybean. The sequence divergence pattern analysis suggested that the genes for basic cellular functions and metabolism were highly conserved between soybean and common bean. Additionally, our results show that some classes of genes, particularly those associated with environmental adaptation, are highly divergent. Conclusions The soybean GeneChip is a suitable cross-species platform for transcript profiling in common bean when used in combination with the masking protocol described. In
International Nuclear Information System (INIS)
Hanyu, H.; Shoji, K.
2000-01-01
Increasing blue light and decreasing R: FR with supplementary far-red light affect morphogenesis, dry matter production and dry matter partitioning to leaves, stems and roots. In this study, the combined effects of the two spectral treatments were examined in kidney bean (Phaseolus vulgaris L.) grown under the mixture of four different narrow-band light sources. In addition, because the leaf and stem growth are accelerated by increasing red light (600-700 nm) in proportion to far-red light (700-800 nm) while keeping R : FR constant, this study was conducted to determine whether red light or far-red light causes the acceleration of growth. Increasing blue light (400-500 nm) and decreasing R : FR only interacted on stem extension. The results illustrated with figures suggest that blue light amplifies or attenuates the acceleration of stem extension caused by decreasing R : FR. On the other hand, increasing red light with constant far-red light had no influence on leaf expansion or stem extension while R : FR increased. Because the acceleration of leaf and stem growth is caused by increasing either far-red light or both red and far-red light in our environmental conditions, the stimulative effects on leaves and stems seem to require increases in far-red light rather than red light
Directory of Open Access Journals (Sweden)
Sri Moerniati
2010-06-01
: Microfiltration, membrane, Hydrolyzed Vegetable Protein (HVP, fermented red bean (Phaseolus vulgaris L..
DEFF Research Database (Denmark)
Stafford, Gary Ivan; Birer, C.; Brodin, Birger
2013-01-01
The alkaloid rich extracts from an acid/base extraction of bulb material of Haemanthus coccineus L., H. montanus Baker and H. sanguineus Jacq. revealed that two montanine type Amaryllidaceae alkaloids, montanine (1) and coccinine (2) were the major alkaloid constituents. Together these two...... to the relative proportions of coccinine and montanine in the extracts and thus are likely to be due to more potent unidentified minor constituents. Both alkaloids exhibited low binding affinity to P-glycoprotein (P-gp) as demonstrated by low inhibition of calcein-AM efflux in the MDCK-MDR1 cell line....... This indicates that P-gp efflux will not be limiting for blood-brain-barrier passage of the alkaloids....
Energy Technology Data Exchange (ETDEWEB)
Henner, P. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)]. E-mail: pascale.henner@irsn.fr; Colle, C. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France); Morello, M. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)
2005-07-01
Foliar transfer of {sup 241}Am, {sup 239,240}Pu, {sup 137}Cs and {sup 85}Sr was evaluated after contamination of bean plants (Phaseolus vulgaris) at the flowering development stage, by soaking their first two trifoliate leaves into contaminated solutions. Initial retentions of {sup 241}Am (27%) and {sup 239,240}Pu (37%) were higher than those of {sup 137}Cs and {sup 85}Sr (10-15%). Mean fraction of retained activity redistributed among bean organs was higher for {sup 137}Cs (20.3%) than for {sup 239,240}Pu (2.2%), {sup 241}Am (1%) or {sup 85}Sr (0.1%). Mean leaf-to-pod translocation factors (Bq kg{sup -1}dry weight pod/Bq kg{sup -1}dry weight contaminated leaves) were 5.0 x 10{sup -4} for {sup 241}Am, 2.7 x 10{sup -6} for {sup 239,240}Pu, 5.4 x 10{sup -2} for {sup 137}Cs and 3.6 x 10{sup -4} for {sup 85}Sr. Caesium was mainly recovered in pods (12.8%). Americium and strontium were uniformly redistributed among leaves, stems and pods. Plutonium showed preferential redistribution in oldest bean organs, leaves and stems, and very little redistribution in forming pods. Results for americium and plutonium were compared to those of strontium and caesium to evaluate the consistency of the attribution of behaviour of strontium to transuranium elements towards foliar transfer, based on translocation factors, as stated in two radioecological models, ECOSYS-87 and ASTRAL.
Directory of Open Access Journals (Sweden)
Maria Lucia França Teixeira
2007-12-01
Full Text Available A vaquinha Cerotoma arcuata ataca folhas de leguminosas e suas larvas alimentam-se de raízes e também de nódulos, onde a fixação de nitrogênio (FBN ocorre. O ataque das larvas aos nódulos pode causar mais danos à cultura do feijoeiro do que o consumo das folhas pelas formas adultas. Este estudo foi conduzido em condições de campo para avaliar os efeitos da infestação de C. arcuata no cultivo do feijoeiro com ou sem cobertura morta ou consorciado com caupi ou com milho. A nodulação, o crescimento e a produção de grãos de feijoeiro quando consorciado com caupi não diferiram do controle. A barreira aos insetos formada pelo milho adensado falhou, provavelmente devido à infestação precoce de C. arcuata e ao sombreamento causado pelo milho, com redução na produtividade de feijoeiro. O consumo dos nódulos pelas larvas na cultura de feijão solteiro e nos consórcios foi superior ao do tratamento com cobertura morta. A barreira física imposta pela cobertura morta agiu provavelmente através da redução da oviposição diretamente no solo e do ressecamento dos ovos sobre a palha e resultou em menor porcentagem de nódulos furados, com conseqüente aumento no número e peso de nódulos, no peso de raiz e na produção de grãos. Os consórcios com milho ou com caupi não reduziram a infestação de feijoeiro por C. arcuata, mas a aplicação da cobertura morta antes da infestação reduziu os danos causados pelas larvas aos nódulos e favoreceu a FBN e a produtividade.The bean leaf beetle Cerotoma arcuata is a legume leaf eater and its larvae feed on roots and also nodules where nitrogen fixation occurs. The attack of larvae to nodule may result in more damage to the bean crop than the consumption of leaves by adults. This study was conducted under field conditions to test the effects of C. arcuata infestation on Phaseolus bean with or without straw mulching or intercropped with maize or cowpea. Nodulation, growth and grain
International Nuclear Information System (INIS)
Elagoez, Vahram; Han, Susan S.; Manning, William J.
2006-01-01
Bush bean (Phaseolus vulgaris L.) lines 'S156' (O 3 -sensitive)/'R123' (O 3 -tolerant) and cultivars 'BBL 290' (O 3 -sensitive)/'BBL 274' (O 3 -tolerant) were used to study the effects of O 3 on stomatal conductance (g s ), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O 3 and plasticity of stomatal properties in response to O 3 . Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O 3 sensitivity and g s : while 'S156' had higher g s rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G s rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O 3 -tolerant counterparts. Exposure to O 3 in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O 3 -sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O 3 concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O 3 concentrations (30 ppb). Exposure to O 3 eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O 3 and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O 3 has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This appeared to be more evident in O 3 -sensitive cultivars. - O 3 has the potential to affect stomatal development and the presence of different control mechanisms on each leaf surface is confirmed
International Nuclear Information System (INIS)
Marcos Filho, Julio
1971-01-01
Seeds of the field bean variety 'Goiano Precoce' (Phaseolus vulgaris L.) subjected to various radiation doses ( 60 Co) ( Co) were used in a series of experiments with the objective of studying the different aspects of seed behavior thus treated. The radiation doses, comprising six treatments, varied from 0,0 to 6,4 krad of gamma radiation. Effect on seed germination and seedling dry weight was studied by means of a factorial experiment conducted under laboratory controlled conditions. The factors used were the radiation doses and nine increasing lengths of time from date of seed irradiation. Seed vigor was determined by the rate of seedling emergence when planted in small field plots. A factorial design was used. The variables were the radiation dosages and six lengths of time elapsed since date of seed irradiation. The effect of seed irradiation on yield was evaluated by means of two randomized block design field experiments. After the seed vigor experiment was conducted infestation by the bean weevil, Acanthoscelidcs obtectus Say , was observed in irradiated seeds stored under normal conditions, indicating a relationship between radiation dosage and insect damage. An analysis was made of this effect at fourteen increasing time intervals. The analysis was made according to a factorial scheme considering as factors radiation dosage and time interval. The following conclusions could be drawn from the analysis and discussion of the results obtained: a) Seed germination was adversely affected by all radiation doses in relation to the check treatment. This effect however decreased significantly with storing time. b) Seed vigor was higher for those treated with 0,4 , 0,8 and 1,6 krad when compared with those that were not irradiated. c) Pod and seed weight were lowered by the 1,6 and 6,4 krad radiation doses in relation to the check treatment. d) Infestation by the bean weevil was significantly checked by all radiation treatments in relation to the check treatment. e
Directory of Open Access Journals (Sweden)
Cileide Maria Medeiros Coelho
2007-10-01
Full Text Available Os recursos genéticos devem ser devidamente caracterizados para permitir ganhos genéticos mais promissores no melhoramento e para o uso destes recursos pelo próprio agricultor. O objetivo deste trabalho foi caracterizar a diversidade genética de acessos de feijão comum do germoplasma existente na Universidade do Estado de Santa Catarina, através de inter-relações entre os descritores agronômicos. O experimento foi conduzido a partir de outubro de 2005, constituído por 20 acessos de feijão comum, utilizando-se o delineamento experimental em blocos casualizados com 3 repetições. Foi utilizada a técnica de análise multivariada para medir a divergência genética representada pela distância generalizada de Mahalanobis. Com base na matriz de dissimilaridade genética gerada, foi construído o dendrograma pelo método de agrupamento da distância média. Das 12 variáveis envolvidas no estudo, o peso de 100 sementes teve a maior contribuição na separação dos genótipos, seguido pela espessura do legume, pelo comprimento do legume e pelo rendimento de grãos. Os acessos BAF 42, BAF 46, BAF 47 e BAF 57 se destacaram quanto ao nível de produtividade (3.500 a 5.000kg ha-1 e devem ser mais bem caracterizados para serem incorporados nos programas de melhoramento da cultura e/ou indicado para os agricultores.The correct characterization of genetic resources allows to identify sources of variability, a genetic profit during the plant breeding and use of these resources in the crop science. This research was aimed at evaluating genetic divergence in bean accessions of a germplasm of Santa Catarina, through interrelation among the agronomic character descriptor. Twenty bean (Phaseolus vulgaris L. accessions were evaluated carried out in October 2005, using the randomized block design with three replications. The genotypes were studied using multivariable techniques to measure genetic divergence represented by the generalized distance of
Energy Technology Data Exchange (ETDEWEB)
Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)
2005-08-15
Responses of bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive) and 'R123' (O{sub 3}-tolerant), and cultivars 'BBL 290' (O{sub 3}-sensitive) and 'BBL 274' (O{sub 3}-tolerant) to ambient ozone (O{sub 3}) were investigated during the 2001 and 2002 growing seasons. Seedlings were grown in pots inside open-top chambers (OTCs), with charcoal filtered (CF) and non-filtered (NF) ambient air, and in non-chambered ambient air (AA) plots. Growth parameters from individual plants were evaluated after harvests at the end of vegetative (V{sub 4}) and reproductive (R{sub 10}) growth phases. Results at V{sub 4} indicated that CF did not provide additional benefits over NF in 'S156' in 2001 and 2002. In contrast, exposure to CF significantly impaired the growth of 'R123'. At the end of R{sub 10}, 'S156' produced more pods, most of which remained immature, and contained fewer seeds or were more frequently aborted, whereas pods produced in 'R123' reached pod maturation and senescence more consistently. Despite increased seed weights inside the OTCs, as observed in 'S156', differences between the two lines were insignificant when grown outside OTCs. Results from the 'BBL 290'/'BBL 274' pair, especially at V{sub 4} phase, remained inconclusive. Plant morphological characteristics, variabilities in environmental conditions, and 'chamber effects' inside OTCs were influential in determining plant response to ambient O{sub 3}. - Phenotypic differences, morphological characteristics, and 'chamber effects' inside OTCs are equally influential in determining the responses of beans to O{sub 3}.
Directory of Open Access Journals (Sweden)
André Luiz Rodrigues Magalhães
2008-03-01
Full Text Available Este trabalho foi conduzido com o objetivo de avaliar o efeito da substituição do farelo de soja pelo resíduo de feijão comum (Phaseolus vulgaris L. em rações para vacas em lactação sobre as seguintes variáveis: consumos e digestibilidades totais aparentes dos nutrientes, produção e composição do leite e eficiência alimentar. Foram utilizadas 12 vacas da raça holandesa, distribuídas em três quadrados latinos 4 ´ 4, balanceados. Os animais receberam rações completas ofertadas ad libitum, contendo 0; 13; 26 e 39% de resíduo de feijão cru no concentrado, em substituição ao farelo de soja. Os consumos de matéria seca (MS, matéria orgânica (MO, carboidratos não-fibrosos (CNF e de nutrientes digestíveis totais (NDT diminuíram linearmente com o aumento dos níveis de feijão no concentrado. Os consumos de fibra em detergente neutro (FDN e de fibra em detergente neutro indigestível (FDNi não foram afetados pelas dietas e os consumos de proteína bruta (PB e extrato etéreo (EE apresentaram comportamento cúbico. Os coeficientes de digestibilidades (CD de MS, MO, EE e FDN não foram afetados pelas dietas, enquanto os de PB e CNF apresentaram comportamento linear decrescente e crescente, respectivamente. A produção e a composição do leite (gordura, proteína, lactose, extratos secos desengordurado e total, quando expressas em kg/dia, apresentaram redução linear para os níveis crescentes de substituição. Não houve diferença entre os tratamentos para as eficiências de alimentação. A inclusão do resíduo de feijão às dietas ocasionou redução no desempenho dos animais.This work was carried out with the objective to evaluate the effect of replacement of soybean meal by common bean (Phaseolus vulgaris L. residue in rations for milking cows on the following variables: intakes and total apparent digestibilities of nutrients, milk production and composition and feeding efficiency. Twelve Holstein cows were
International Nuclear Information System (INIS)
Crocomo, O.J.; Sharp, W.R.
1973-01-01
Progress in the field of plant tissue culture at the Plant Biochemistry Sector, Centro de Energia na Agricultura (CENA), Piracicaba, S.P., Brazil, pertains to the simplification of development in 'Phaseolus vulgaris' by dividing the organism into its component organs, tissues, and cells and the maintenance of these components on defined culture media 'in vitro'. This achievement has set the stage for probing the basis for the stability of the differentiated states and/or the reentry of mature differentiated cells into the mitotic cell cycle and their subsequent redifferentiation. Data from such studies at the cytological and biochemical level have been invaluable in the elucidation of the control mechanisms responsible for expression of the cellular phenotype. Unlimited possibilities exist for the application of tissue culture in the vegetative propagation of 'Phaseolus' and other important cultivars in providing genocopies or a large scale and/or readily obtaining plantlets from haploid cell lines or from protoplast (wall-less cells) hybridization products following genetic manipulation. These tools are being applied in this laboratory for the development and selection of high protein synthesizing 'Phaseolus' cultivars
African Journals Online (AJOL)
2014-03-01
Mar 1, 2014 ... After sown seed containers were incubated at temperature of 25 ºC, first and final .... and subsequent contact of seeds with ambient room air) [27]. ... pot which keep lower seed moisture content relative to the original were ...
African Journals Online (AJOL)
Mimi
and other legumes is long cooking time. Ready-to-use ... Basic qualitative screening for common beans has shown that alkaloids, anthraquinone, .... consumption of red meat, refined grains, sweets, French fries, and high fat desserts had.
African Journals Online (AJOL)
Mimi
significant macronutrient in common beans and though the seed is limited in methionine (a sulphur ... The objective in this paper is to review the major biological activities of common beans .... against the development of obesity [32]. Research ...
Blair, Matthew W; Knewtson, Sharon Jb; Astudillo, Carolina; Li, Chee-Ming; Fernandez, Andrea C; Grusak, Michael A
2010-10-05
Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L.) take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 x G19833), to identify quantitative trait loci (QTL) for this trait, and to assess possible associations with seed iron levels. The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III)-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient) were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe) on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe) on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO) homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity under iron limited conditions may be useful in
Directory of Open Access Journals (Sweden)
Fernandez Andrea C
2010-10-01
Full Text Available Abstract Background Iron deficiency anemia is a global problem which often affects women and children of developing countries. Strategy I plants, such as common bean (Phaseolus vulgaris L. take up iron through a process that involves an iron reduction mechanism in their roots; this reduction is required to convert ferric iron to ferrous iron. Root absorbed iron is critical for the iron nutrition of the plant, and for the delivery of iron to the shoot and ultimately the seeds. The objectives of this study were to determine the variability and inheritance for iron reductase activity in a range of genotypes and in a low × high seed iron cross (DOR364 × G19833, to identify quantitative trait loci (QTL for this trait, and to assess possible associations with seed iron levels. Results The experiments were carried out with hydroponically grown plants provided different amounts of iron varying between 0 and 20 μM Fe(III-EDDHA. The parents, DOR364 and G19833, plus 13 other cultivated or wild beans, were found to differ in iron reductase activity. Based on these initial experiments, two growth conditions (iron limited and iron sufficient were selected as treatments for evaluating the DOR364 × G19833 recombinant inbred lines. A single major QTL was found for iron reductase activity under iron-limited conditions (1 μM Fe on linkage group b02 and another major QTL was found under iron sufficient conditions (15 μM Fe on linkage group b11. Associations between the b11 QTL were found with several QTL for seed iron. Conclusions Genes conditioning iron reductase activity in iron sufficient bean plants appear to be associated with genes contributing to seed iron accumulation. Markers for bean iron reductase (FRO homologues were found with in silico mapping based on common bean synteny with soybean and Medicago truncatula on b06 and b07; however, neither locus aligned with the QTL for iron reductase activity. In summary, the QTL for iron reductase activity
Response of plants to high concentrations of uranium stress and the screening of remediation plants
International Nuclear Information System (INIS)
Tang Yongjin; Luo Xuegang; Zeng Feng; Jiang Shijie
2013-01-01
Studies of the resistance and accumulation ability of different plant species to uranium (U) has important influence on the bioremediation of U contaminated soil. The resistance and enrichment ability of high concentrations of U (500 mg · kg"-"1 soil) in fourteen plant species were investigated and evaluated in this study in order to screen remediation plants for governance soil U contamination. The results showed that: (1) high concentrations of U stress had different effects on the emergence and survival of the different plants. The seed emergence of Hibiscus esculentus was reduced by 2/3, but the seed emergence of Gynura cusimbua (D. Don) S. Moore, Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not reduced. Under the contaminated soil, all the sesamum indicum died within a month after the emergence and the survival number of Amaranth and Iresine herbstii 'Aureo-reticulata' reduced by about 80%. But the survival number of Alternanthera philoxeroides (Mart.) Griseb., Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not influenced. (2) The biomass of the plants would be reduced by 8-99% in the uranium-contaminated soil. The anti-stress ability of Phaseolus vulgaris var. humilis Alef was the strongest in the fourteen plants, and Cucurbita pepo L., Sorghumbicolor (L.) Moench, Ipomoea aquatica Forsk, Helianthus annuus, Chenopodium album L. and Alternanthera philoxeroides (Mart.) Griseb. showed some the anti-stress ability. (3) Significant differences were found in the capacity of plants to absorb uranium between under high-uranium contaminated soil and under the non-uranium contaminated soil were. The plants with higher uranium content in thenon-contaminated soil were Gomphrena globosa, and Cucurbita pepo L., which were 2.249 mg · kg"-"1 DW and 1.620 mg · kg"-"1 DW, respectively. But the plants with higher uranium content in the high uranium contaminated soil were Cichorium intybus L., Amaranth and Ipomoea aquatica Forsk, which
Directory of Open Access Journals (Sweden)
A.A.M. Barroso
2012-03-01
Full Text Available O objetivo deste trabalho foi avaliar a interferência causada pelo caruru-demancha (Amaranthus viridis e amendoim-bravo (Euphorbia heterophylla, em função das densidades e distâncias, no feijoeiro (Phaseolus vulgaris cultivar Pérola. Como recipientes, foram utilizadas caixas de cimento-amianto, com capacidade para 50 litros, preenchidas com LatossoloVermelho-Escuro. As mudas foram formadas em bandejas de 128 células preenchidas com substrato hortícola; quando as plântulas atingiram o estádio V2, foram transplantadas para as caixas, sendo as de feijoeiro numa linha central, reproduzindo a semeadura em campo, e as das plantas daninhas nas densidades de 8, 16 e 32 plantas m-2, distanciadas de 0, 12 e 24 cm das plantas de feijão e igualmente entre si. O experimento foi conduzido no delineamento experimental de blocos casualizados, com os tratamentos dispostos em esquema fatorial 3x3+2T, com quatro repetições, constituindo as parcelas experimentais. Foram avaliadas características de crescimento e de produtividade da cultura e das plantas daninhas. Os dados obtidos foram submetidos à análise de variância pelo teste F, e as médias, comparadas pelo teste de Tukey. Observou-se que as plantas daninhas obtiveram maior desenvolvimento quando em maior distância da cultura. O caruru-de-mancha causou reduções no número de vagens e na produtividade estimada do feijoeiro. Para o caruru-de-mancha, o aumento da densidade só causou redução na produtividade da cultura quando as plantas estavam distanciadas em pelo menos 12 cm. A 0 cm, o feijoeiro tornou-se mais competitivo e não sofreu interferência das plantas daninhas, independentemente da densidade destas.The aim of this study was to evaluate the interference caused by Slender amaranth (Amaranthus viridis and Milkweed (Euphorbia heterophylla at different densities and distances in the common bean (Phaseolus vulgaris cv. Pérola. The experiment was carried out using asbestos cement boxes
International Nuclear Information System (INIS)
Kayitare, Joseph Sibomana
1993-04-01
Cultural practices as management strategy for bean fly control were examined over four cropping seasons in 1991 and 1992 under farmer’s developed field conditions at Oyugis, in Homa Bay District of Western Kenya. In many parts of East and Central Africa, the bean fly is a major constraint to the production of the bean crop (Phaseolus vulgaris), its incidence causes yield losses averaging 47-87%, Control methods used against the pest are mostly insecticides based. Cultural control as a pest management strategy is a less considered area of research which needs to be studied, since it is the first line of defence against pest populations and results in little or no added cost. For this reason studies on five cultural practices (soil fertility, inter cropping, weeding regimes, plant spacing and planting time) on bean fly infestation were undertaken as possible control methods, Increase in nitrogen levels increased bean fly infestation by 12-66%. Phosphorus served as catalyst for nitrogen assimilation. The fertilized plants were more succulent, tender and had more nutrients and therefore offered better conditions for bean fly penetration into bean stems, fecundity and development. However, the infested plants in fertilized soils were able to compensate for the damage caused to them and grew quickly to pass the critical stages. Thus the bean fly infestation had little effect on grain yield. The effect of bean fly infestation on yield when no nitrogen and phosphorus were applied, was a 48% reduction in yield, Therefore, the use of nitrogen and phosphorus fertilizers reduced the effect of bean fly damage and increased grain yield. Inter cropping increased bean fly infestation compared to pure stands of beans. The micro climatic conditions (light intensity, temperature and relative humidity) created by inter cropping of beans with maize increased bean fly infestation compared to that in the bean mono crop. Weeding regimes had no effect on bean fly infestation, however
Bianco, Giuliana; Pascale, Raffaella; Carbone, Cecilia F; Acquavia, Maria A; Cataldi, Tommaso R I; Schmitt-Kopplin, Philippe; Buchicchio, Alessandro; Russo, Daniela; Milella, Luigi
2018-02-01
Soyasaponins are oleanene-type triterpenoid saponins, naturally occurring in many edible plants that have attracted a great deal of attention for their role in preventing chronic diseases. The aim of this study was to establish the distribution and the content of soyasaponins in 21 ecotypes of Fagioli di Sarconi beans (Phaseolus vulgaris, Leguminosae). High-performance reversed-phase liquid chromatography (RPLC) with positive electrospray ionization (ESI(+)) and Fourier transform ion cyclotron resonance (FTICR) mass spectrometry (MS) in conjunction with infrared multiphoton dissociation (IRMPD) was applied for the unambiguous identification of soyasaponins Ba (m/z 959.5213, [C 48 H 79 O 19 ] + ), Bb (m/z 943.5273, [C 48 H 79 O 18 ] + ), Bd (m/z 957.5122, [C 48 H 77 O 19 ] + ), and Be (m/z 941.5166, [C 48 H 77 O 18 ] + ), which are the only commercially available reference standards. In addition, the several diagnostic product ions generated by IRMPD in the ICR-MS cell allowed us the putative identification of soyasaponins Bb' (m/z 797.4680, [C 42 H 69 O 14 ] + ), αg (m/z 1085.5544, [C 54 H 85 O 22 ] + ), βg (m/z 1069.5600, [C 54 H 85 O 21 ] + ), and γg (m/z 923.5009, [C 48 H 75 O 17 ] + ), establishing thus their membership in the soyasaponin group. Quantitative and semiquantitative analysis of identified soyasaponins were also performed by RPLC-ESI(+) FTICR-MS; the total concentration levels were found ranging from 83.6 ± 9.3 to 767 ± 37 mg/kg. In vitro hypoglycemic outcomes of four soyasaponin standards were evaluated; significant inhibitory activities were obtained with IC 50 values ranging from 1.5 ± 0.1 to 2.3 ± 0.2 μg/mL and 12.0 ± 1.1 to 29.4 ± 1.4 μg/mL for α-glucosidase and α-amylase, respectively. This study represents the first detailed investigation on the antidiabetic activity of bioactive constituents found in Fagioli di Sarconi beans. Graphical abstract The first detailed RPLC-ESI(+) FTICR-MS investigation of
Energy Technology Data Exchange (ETDEWEB)
Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Han, Susan S. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)
2006-04-15
Bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive)/'R123' (O{sub 3}-tolerant) and cultivars 'BBL 290' (O{sub 3}-sensitive)/'BBL 274' (O{sub 3}-tolerant) were used to study the effects of O{sub 3} on stomatal conductance (g {sub s}), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O{sub 3} and plasticity of stomatal properties in response to O{sub 3}. Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O{sub 3} sensitivity and g {sub s}: while 'S156' had higher g {sub s} rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G {sub s} rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O{sub 3}-tolerant counterparts. Exposure to O{sub 3} in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O{sub 3}-sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O{sub 3} concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O{sub 3} concentrations (30 ppb). Exposure to O{sub 3} eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O{sub 3} and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O{sub 3} has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This
Energy Technology Data Exchange (ETDEWEB)
Brito, Marciano de Medeiros Pereira; Muraoka, Takashi; Silva, Edson Cabral da [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba SP (Brazil)], e-mail: marcianobrito@hotmail.com, e-mail: muraoka@cena.usp.br, e-mail: ecsilva@cena.usp.br
2009-07-15
Common bean (Phaseolus vulgaris L.) and cowpea (Vigna unguiculata (L.) Walp.) are among the main sources of plant protein for a large part of the world population, mainly that of low income, and nitrogen is the main constituent of these proteins. The objectives of this study were to evaluate, through the {sup 15}N-dilution technique and using rice and non-nodulating soybean as control plants, the relative contributions of nitrogen sources (symbiotically fixed N, soil native N and fertilizer N) on the growth of common bean and cowpea and to compare the isotopic technique (ID) with the difference methods (DM) for the evaluation of symbiotic N{sub 2} fixation. The study was carried out in a greenhouse of the Center for Nuclear Energy in Agriculture - CENA/USP, Sao Paulo State, Brazil, using 5 kg pots with a Typic Haplustox (Dystrophic Red-Yellow Latosol). The experiment was arranged in completely randomized blocks, with 16 treatments and three replications, in an 8 x 2 factorial design. The treatments were eight sampling times: 7, 24, 31, 38, 47, 58, 68 and 78 days after sowing (DAS) and two crops: common bean and cowpea. An N rate of 10 mg kg{sup -1} soil was used, as urea, enriched with an excess of 10 % of {sup 15}N atoms. Symbiotic N fixation supplied the bean and cowpea plants with the greatest amount of accumulated N, followed, in decreasing order, by soil and fertilizer. The highest rate of N symbiotic fixation was observed at the pre-flowering growth stage of the bean and cowpea plants. After the initial growth stage, 24 DAS, rice and non nodulating soybean were appropriate control plants to evaluate symbiotic N fixation. There was a good agreement between ID and DM, except in the initial growth stage of the crops. (author)
Directory of Open Access Journals (Sweden)
Yarmilla eReinprecht
2013-09-01
Full Text Available Legumes contain a variety of phytochemicals derived from the phenylpropanoid pathway that have important effects on human health as well as seed coat color, plant disease resistance and nodulation. However, the information about the genes involved in this important pathway is fragmentary in common bean (Phaseolus vulgaris L.. The objectives of this research were to isolate genes that function in and control the phenylpropanoid pathway in common bean, determine their genomic locations in silico in common bean and soybean, and analyze sequences of the 4CL gene family in two common bean genotypes. Sequences of phenylpropanoid pathway genes available for common bean or other plant species were aligned, and the conserved regions were used to design sequence-specific primers. The PCR products were cloned and sequenced and the gene sequences along with common bean gene-based (g markers were BLASTed against the Glycine max v.1.0 genome and the P. vulgaris v.1.0 (Andean early release genome. In addition, gene sequences were BLASTed against the OAC Rex (Mesoamerican genome sequence assembly. In total, fragments of 46 structural and regulatory phenylpropanoid pathway genes were characterized in this way and placed in silico on common bean and soybean sequence maps. The maps contain over 250 common bean g and SSR (simple sequence repeat markers and identify the positions of more than 60 additional phenylpropanoid pathway gene sequences, plus the putative locations of seed coat color genes. The majority of cloned phenylpropanoid pathway gene sequences were mapped to one location in the common bean genome but had two positions in soybean. The comparison of the genomic maps confirmed previous studies, which show that common bean and soybean share genomic regions, including those containing phenylpropanoid pathway gene sequences, with conserved synteny. Indels identified in the comparison of Andean and Mesoamerican common bean sequences might be used to develop
Directory of Open Access Journals (Sweden)
Daniel Barrantes
2008-09-01
Full Text Available Plant populations may experience local extinction and at the same time new populations may appear in nearby suitable locations. Species may also colonize the same site on multiple occasions. Here, we examined the impact of local extinction and recolonization on the genetic structure of wild populations of lima beans (Phaseolus lunatus in the Central valley of Costa Rica. We compared genetic diversity from the samples taken from the populations before and after extinction at 13 locations using microsatellite markers. Locations were classified according to the occurrence of extinction episodes during the previous five years into three groups: 1 populations that experienced extinction for more than one year, and were later recolonized (recolonized, 2 populations that did not experience local extinction (control, and 3 populations that did not experience local extinction during the study, but were cut to experimentally simulate extinction (experimental. Our data did not show a clear tendency in variation in allele frequencies, expected heterozygosity, and effective number of alleles within and between groups of populations. However, we found that the level of genetic differentiation between samples collected at different times at the same location was different in the three groups of populations. Recolonized locations showed the highest level of genetic differentiation (mean Fst= 0.2769, followed by control locations (mean Fst= 0.0576 and experimental locations (mean Fst= 0.0189. Similar findings were observed for Nei’s genetic distance between samples (di,j= 0.1786, 0.0400, and 0.0037, respectively. Our results indicate that genetic change in lima beans depends on the duration and frequency of local extinction episodes. These findings also showed that control populations are not in equilibrium. Implications of these results for the establishment of conservation strategies of genetic resources of lima beans are discussed. Rev. Biol. Trop. 56 (3
Protein (Viridiplantae): 888289 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 0727 3803:10727 ... 3814:10727 ... 163735:2506 ... 3883:1736 ... 3885:1736 ... hypothetical protein PHAVU_009G116600g Phaseolus vulgaris MKKNRMMIM...ICSVGVVWMLLVGGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQC
Directory of Open Access Journals (Sweden)
R Amini
2016-02-01
Full Text Available Introduction Water use in agricultural production as one of the most important environmental factors affecting plant growth and development, especially in arid and semi-arid climatic conditions of Iran is of special importance (21. One of the ways of alleviating water scarcity is by enhancing its use efficiency or productivity. Improving water use efficiency in arid and semi-arid areas depends on effective conservation of moisture and efficient use of limited water. Mulching is one of the management practices for increasing water use efficiency (WUE . Straw mulch is commonly used as mulch. Straw mulching has potential for increasing soil water storage (16. Mulches modify the microclimate and growing conditions of crops (16, conserve more water and increase water use efficiency (34. Red kidney bean (Phaseolus vulgaris L. is the most important food legume (25 and is an important source of proteins and minerals (28. The majority of red kidney bean production is under drought conditions, and thus yield reductions due to drought are very common (29. This research was carried out to evaluate the effect of wheat straw mulch and water stress on physiological traits, yield components and grain yield of red kidney bean cultivars. Materials and Methods A field experiment was conducted in 2012 at the Research Farm of the Faculty of Agriculture, University of Tabriz, Iran (latitude 38°05_N, longitude 46°17_E, altitude 1360 m above sea level. In order to investigate the effect of mulch on grain yield and yield components of red kidney bean (Phaseolus vulgaris L. cultivars at different water stress treatments, a factorial experiment was conducted based on RCB design with three replications. The factors were including water stress treatment (I1 and I2, irrigation after 60 and 120 mm evaporation from class A pan, respectively; mulch application at two levels (M1: (no mulch and M2: 2 ton ha-1 wheat straw mulch and red kidney bean cultivars including Akhtar and
Bioactivity of flours of seeds of leguminous crops Pisum sativum ...
African Journals Online (AJOL)
Bioactivity of flours of seeds of leguminous crops Pisum sativum, Phaseolus vulgaris and Glycine max used as botanical insecticides against Sitophilus oryzae Linnaeus (Coleoptera: Curculionidae) on sorghum grains.
Directory of Open Access Journals (Sweden)
José A Polanía
2012-07-01
Full Text Available El desarrollo de variedades adaptadas es una de las estrategias que contribuye a garantizar la seguridad alimentaria en zonas productoras de frijol con estrés por sequía. En los invernaderos de cristal del Centro Internacional de Agricultura Tropical (CIAT, Palmira, Colombia, se evaluaron las características morfológicas y fisiológicas de raíces de 21 líneas de frijol (Phaseolus vulgaris L. en condiciones de estrés por sequía e irrigación, utilizando un sistema de tubos plásticos desarrollado por el CIAT. Las características evaluadas fueron profundización visual, longitud total de raíces y distribución de raíces a través del perfil del suelo. En campo, utilizando los mismos genotipos de frijol, se evaluaron características relacionadas con la eficiencia de uso de agua mediante la técnica de discriminación de isótopo de carbono y producción de grano. Los resultados en invernadero mostraron que la profundización visual y longitud de raíces entre 60 y 75 cm tienen una correlación significativa (r = 0.56 y 0.50 respectivamente, P < 0.001 con la biomasa aérea de la planta en condiciones de estrés por sequía. En campo, la discriminación del isótopo de carbono en grano se correlacionó (r = 0.32, P < 0.01 con la producción de grano en condiciones igualmente de estrés por sequía. Las líneas de frijol NCB 226, SER 16, SEN 56 y SEA 15 presentaron una mayor longitud de raíces bajo estrés por sequía (28, 24, 29 y 27 m/planta respectivamente en comparación con las demás líneas evaluadas, lo que les permite mayor transpiración y movilización de fotoasimilados, que favorecen una alta producción de granos. Se estima que la profundización visual, la longitud de raíces entre 60 y 75 cm y la discriminación de isótopo de carbono en grano, son características valiosas como criterios de selección en mejoramiento por tolerancia a estrés por sequía en frijol común.
(Phaseolus vulgaris L) Genotypes
African Journals Online (AJOL)
accumulate biomass, remobilization of stored biomass to reproductive organs and ... In several plant species subjected to drought stress, leaf starch and .... Among the yield attributes, the number of pods per plant destined for final harvest to.
International Nuclear Information System (INIS)
Brito, Marciano de Medeiros Pereira; Muraoka, Takashi; Silva, Edson Cabral da
2009-01-01
Common bean (Phaseolus vulgaris L.) and cowpea (Vigna unguiculata (L.) Walp.) are among the main sources of plant protein for a large part of the world population, mainly that of low income, and nitrogen is the main constituent of these proteins. The objectives of this study were to evaluate, through the 15 N-dilution technique and using rice and non-nodulating soybean as control plants, the relative contributions of nitrogen sources (symbiotically fixed N, soil native N and fertilizer N) on the growth of common bean and cowpea and to compare the isotopic technique (ID) with the difference methods (DM) for the evaluation of symbiotic N 2 fixation. The study was carried out in a greenhouse of the Center for Nuclear Energy in Agriculture - CENA/USP, Sao Paulo State, Brazil, using 5 kg pots with a Typic Haplustox (Dystrophic Red-Yellow Latosol). The experiment was arranged in completely randomized blocks, with 16 treatments and three replications, in an 8 x 2 factorial design. The treatments were eight sampling times: 7, 24, 31, 38, 47, 58, 68 and 78 days after sowing (DAS) and two crops: common bean and cowpea. An N rate of 10 mg kg -1 soil was used, as urea, enriched with an excess of 10 % of 15 N atoms. Symbiotic N fixation supplied the bean and cowpea plants with the greatest amount of accumulated N, followed, in decreasing order, by soil and fertilizer. The highest rate of N symbiotic fixation was observed at the pre-flowering growth stage of the bean and cowpea plants. After the initial growth stage, 24 DAS, rice and non nodulating soybean were appropriate control plants to evaluate symbiotic N fixation. There was a good agreement between ID and DM, except in the initial growth stage of the crops. (author)
Directory of Open Access Journals (Sweden)
Edwin J Fl
2017-10-01
Full Text Available Objetivo: evaluar de manera fisicoquímica, microbiológica y sensorial una salsa y una bebida funcional a base de extracto de fríjol rojo (phaseolus vulgaris con pulpa de guayaba. Metodología: el trabajo se desarrolló en una planta piloto, donde se tuvieron en cuenta la pulpa de la fruta y granos de frijoles rojos comercializados en los diferentes supermercados de la ciudad de Valledupar donde se tomaron muestras representativas de 5 kilos de guayaba y 5 kilos de fríjol para la obtención de la bebida y, con base en la NTC 659, se aplicó un diseño factorial de 22. Resultados: La consistencia de la salsa de extracto de fríjol rojo con mayor contenido de proteína (11,3 % fue el atributo de mayor aceptación por parte de los evaluadores no entrenados con 67,3 %, y el color fue el de menor aceptación con 53,3 %. Sin embargo, en forma general, el producto tuvo una preferencia de 61 %. El sabor de la bebida tipo néctar con mayor contenido de proteína (11% a base de extracto de fríjol rojo y extracto de guayaba fue el atributo que tuvo el mayor porcentaje de aceptación por parte de los evaluadores no entrenados, con 70,6%, y la consistencia fue el atributo con menor porcentaje de aceptación con 61,3. Sin embargo, otra vez en forma general, considerados todos los atributos, la bebida tuvo una preferencia de 64,5%. Conclusiones: la composición mineral (Fe, Na, K, Ca y Mg tanto de la salsa de extracto de fríjol como de la bebida a base de extracto de fríjol rojo y extracto de guayaba fueron aportes valiosos, sobre todo en el contenido del potasio y del calcio, que contribuyen a mantener la estabilidad muscular y gástrica del ser humano.
Directory of Open Access Journals (Sweden)
Ormeño-Orrillo Ernesto
2012-12-01
Full Text Available Abstract Background Rhizobium tropici CIAT 899 and Rhizobium sp. PRF 81 are α-Proteobacteria that establish nitrogen-fixing symbioses with a range of legume hosts. These strains are broadly used in commercial inoculants for application to common bean (Phaseolus vulgaris in South America and Africa. Both strains display intrinsic resistance to several abiotic stressful conditions such as low soil pH and high temperatures, which are common in tropical environments, and to several antimicrobials, including pesticides. The genetic determinants of these interesting characteristics remain largely unknown. Results Genome sequencing revealed that CIAT 899 and PRF 81 share a highly-conserved symbiotic plasmid (pSym that is present also in Rhizobium leucaenae CFN 299, a rhizobium displaying a similar host range. This pSym seems to have arisen by a co-integration event between two replicons. Remarkably, three distinct nodA genes were found in the pSym, a characteristic that may contribute to the broad host range of these rhizobia. Genes for biosynthesis and modulation of plant-hormone levels were also identified in the pSym. Analysis of genes involved in stress response showed that CIAT 899 and PRF 81 are well equipped to cope with low pH, high temperatures and also with oxidative and osmotic stresses. Interestingly, the genomes of CIAT 899 and PRF 81 had large numbers of genes encoding drug-efflux systems, which may explain their high resistance to antimicrobials. Genome analysis also revealed a wide array of traits that may allow these strains to be successful rhizosphere colonizers, including surface polysaccharides, uptake transporters and catabolic enzymes for nutrients, diverse iron-acquisition systems, cell wall-degrading enzymes, type I and IV pili, and novel T1SS and T5SS secreted adhesins. Conclusions Availability of the complete genome sequences of CIAT 899 and PRF 81 may be exploited in further efforts to understand the interaction of tropical
Dhyani, A; Arora, N; Jain, V K; Sridhara, S; Singh, B P
2007-09-01
Immunoglobulin E (IgE)-mediated food allergy often develops as a consequence of allergic sensitization to pollen proteins. Mesquite (Prosopis juliflora) tree pollen is reported to be cross-reactive with other pollen species, but little has been reported on its cross-reactivity with plant-derived foods belonging to the same/different families. The present study investigates the in vitro cross-reactivity of mesquite pollen and lima bean (Phaseolus lunatus), an edible seed belonging to the Leguminosae family. Of 110 patients (asthma, rhinitis or both) tested intradermally, 20 showed marked positive reactions with Prosopis pollen extract. Of these, 12 patients showed elevated specific IgE to Prosopis pollen extract alone and four to both Phaseolus and pollen extract. In vitro cross-reactivity was investigated using inhibition assays [enzyme-linked immunosorbent assay (ELISA) inhibition, immunoblot inhibition], histamine release and lymphoproliferation. P. lunatus extract could inhibit IgE binding to P. juliflora in a dose-dependent manner, requiring 400 ng of protein for 50% inhibition in ELISA assay. Immunoblot and immunoblot inhibition demonstrated the presence of 20, 26, 35, 66 and 72 kDa as shared IgE binding components between the two extracts. Histamine release, peripheral blood mononuclear cells proliferation and interleukin (IL)-4 levels also suggested allergenic cross-reactivity. In conclusion, there is humoral and cellular cross-reactivity between Prosopis pollen and Phaseolus seed allergens.
Severity of angular leaf spot and rust diseases on common beans in ...
African Journals Online (AJOL)
ACSS
5.3, respectively. Key words: Common beans, disease management, Phaseolus vulgaris, Pseudocercospora griseola, .... Pearson product- moment ..... SAS Institute. 1989. SAS/STAT User's. Guide (version 6, vol. 1, 4th ed.), Cary: SAS Institute ...
Directory of Open Access Journals (Sweden)
Glahn Raymond P
2011-10-01
Full Text Available Abstract Background Our objective was to compare the capacities of biofortified and standard colored beans to deliver iron (Fe for hemoglobin synthesis. Two isolines of large-seeded, red mottled Andean beans (Phaseolus vulgaris L., one standard ("Low Fe" and the other biofortified ("High Fe" in Fe (49 and 71 μg Fe/g, respectively were used. This commercial class of red mottled beans is the preferred varietal type for most of the Caribbean and Eastern and Southern Africa where almost three quarters of a million hectares are grown. Therefore it is important to know the affect of biofortification of these beans on diets that simulate human feeding studies. Methods Maize-based diets containing the beans were formulated to meet the nutrient requirements for broiler except for Fe (Fe concentrations in the 2 diets were 42.9 ± 1.2 and 54.6 ± 0.9 mg/kg. One day old chicks (Gallus gallus were allocated to the experimental diets (n = 12. For 4 wk, hemoglobin, feed-consumption and body-weights were measured. Results Hemoglobin maintenance efficiencies (HME (means ± SEM were different between groups on days 14 and 21 of the experiment (P In-vitro analysis showed lower iron bioavailability in cells exposed to standard ("Low Fe" bean based diet. Conclusions We conclude that the in-vivo results support the in-vitro observations; biofortified colored beans contain more bioavailable-iron than standard colored beans. In addition, biofortified beans seems to be a promising vehicle for increasing intakes of bioavailable Fe in human populations that consume these beans as a dietary staple. This justifies further work on the large-seeded Andean beans which are the staple of a large-region of Africa where iron-deficiency anemia is a primary cause of infant death and poor health status.
Can a fake fir tell the truth about Swiss needle cast? (paper)
A key question in dendrochronology to reconstruct forest disturbance history is how to distinguish between the effects of Swiss needle cast (SNC) and other forest disturbance agents (e.g., Arceuthobium spp., Armillaria, Phaseolus schweinitzii, Dendroctonus ponderosae, Dendroctonu...
Journal of Agriculture, Forestry and the Social Sciences - Vol 6, No 1 ...
African Journals Online (AJOL)
... Of Pig Manure On The Growth And Yield Of Phaseolus vulgaris (Green Beans) ... Of Rabbits Fed Diets Supplemented With Copper Sulphate · EMAIL FULL TEXT ... E Supplimentation On Fat Composition And Keeping Quality Of Broiler Meat ...
Luiten, P.G.M.; Wouterlood, F.G.; Matsuyama, T.; Strosberg, A.D.; Buwalda, B.; Gaykema, R.P.A.
1988-01-01
In the present paper we review immunocytochemical methods for anterograde tracing with the lectin Phaseolus vulgaris-leucoagglutinin (PHA-L), combined PHA-L tracing - neurotransmitter immunocytochemistry, and the immunocytochemical localization of receptor proteins. These methods will be mainly
Directory of Open Access Journals (Sweden)
López Jesús Edgardo
2006-12-01
Full Text Available
El fríjol común (Phaseolus vulgaris L. es un alimento básico en la región Andina por ser una fuente rica en proteína y de bajo costo. La investigación para incrementar rendimientos en esta leguminosa es una opción para mejorar la competitividad en el mercado mundial. El objetivo principal de este trabajo fue evaluar por rendimiento los genotipos promisorios de fríjol voluble, tipos Bola roja y Reventón, para las zonas frías de Colombia mediante el análisis de sendero. Se realizó un diseño de bloques completos al azar con tres réplicas para evaluar 10 genotipos promisorios de fríjol voluble. El análisis de sendero para el rendimiento por planta y las correlaciones entre el rendimiento y sus componentes mostraron que el carácter número de vainas por planta es el de mayor importancia sobre la determinación del rendimiento, en comparación con los caracteres peso de 100 semillas y número de semillas por vaina, tanto en los genotipos de fríjol voluble tipo Bola roja como tipo Reventón.
Antioxidant activity of commonly consumed cereals, millets, pulses and legumes in India.
Sreeramulu, D; Reddy, C Vijaya Kumar; Raghunath, M
2009-02-01
Plant foods are important due to their antioxidant activity (AOA) attributed to the phenolics which are known to protect organisms against harmful effects of oxygen radicals. However, information on antioxidant activity of Indian plant foods is scanty. Therefore, the present study evaluated the AOA of cereals, millets, pulses and legumes, commonly consumed in India and assessed the relationship with their total phenolic content (TPC). AOA was assessed by DPPH (2,2-Diphenyl-1-picryl hydrazyl) radical scavenging assay, ferric reducing antioxidant power (FRAP) assay and reducing power. DPPH scavenging activity ranged from 0.24 and 1.73 mg/g, whereas FRAP ranged from 16.21 to 471.71 micromoles/g. Finger millet (Eleusine cora cana) and Rajmah (Phaseolus vulgaris) had the highest FRAP 471.71, 372.76 and DPPH scavenging activity 1.73, 1.07. Similar trends were observed with reducing power. Among cereals and legumes, Finger millet (Ragi) and black gram dhal (Phaseolus mungo Roxb) had the highest TPC, the values being 373 and 418 mg/100 g respectively, while rice (Oryza sativa) and green gram dhal (Phaseolus aureus Roxb) showed the least (47.6 and 62.4 mg/100 g). In the present study, FRAP (r = 0.91) and reducing power (r = 0.90) showed significant correlation with TPC in cereals and millets, but not in pulses and legumes. The results suggest that TPC contributes significantly to the AOA of Indian cereals and millets.
Maize-common bean/lupine intercrop productivity and profitability in ...
African Journals Online (AJOL)
Phaseolus vulgaris L.), narrow-leaf lupine (Lupinus angustifolius L.), and white lupine (Lupinus albus L.) with maize (Zea mays L.) were conducted under two intercrop planting arrangements (IPA), single row of legume in between maize rows and ...
The Effect of Processing Method of Dolichos Bean (Lablob Growing ...
African Journals Online (AJOL)
Four diets were formulated to contain the control diet with 0.09 soybean meal or ... nutrient availability and overall utilisation of dolichos bean meal for pigs. ..... quick-cooking moth bean (Phaseolus aconitifolius Jacq.). The Indian Journal of Nu-.
DEFF Research Database (Denmark)
Larsen, P J; Hay-Schmidt, Anders; Mikkelsen, J D
1994-01-01
, iontophoretic injections of the anterograde tracer Phaseolus vulgaris-leucoagglutinin were delivered into distinct areas of the lateral hypothalamic region. Neurons of the intermediate hypothalamic area projected mainly to the PVN subnuclei, which contained parvicellular neuroendocrine cells. In contrast...
Directory of Open Access Journals (Sweden)
R. O. Calheiros
2001-12-01
Full Text Available Estudou-se o efeito de três manejos do lençol freático na indução de adaptações fisiomorfológicas do cultivar Bat 477 de feijão (Phaseolus vulgaris, L. à hipoxia, com vistas em caracterizar a influência relativa dos principais fatores físicos, químicos e biológicos interferentes. O experimento foi realizado em campo, na ESALQ/USP, Piracicaba (SP, de março a junho de 1999, utilizando-se caixas de cimento amianto de 1.000 L como unidade experimental no delineamento de parcelas inteiramente ao acaso, com quatro tratamentos e cinco repetições. As caixas receberam estrutura própria de manejo e controle do lençol freático. Simulou-se ao máximo um meio físico/condição natural de uma várzea. Após a indução no período vegetativo, a eficiência dos manejos foi testada pela inundação temporária do solo no fim do florescimento/formação de vagens. Houve um efetivo processo de nodulação das raízes, a despeito da condição de alta saturação do solo. As características biométricas de crescimento, embora acusando prejuízo da hipoxia, evidenciaram a utilização pela planta de mecanismos adaptativos morfológicos (raízes adventícias e lenticelas, biológicos (fixação de N e fisiomorfológicos (resistividade estomática e transpiração. Já as características biométricas de colheita evidenciaram que tanto o manejo do lençol mantido a 15 cm como o de elevação gradativa, embora com rendimento de grãos sem vantagem estatística sobre o manejo não-indutivo, foram efetivos, permitindo a planta completar seu ciclo, além de menor comprometimento na qualidade de grãos. A alternância de vantagens relativas biométricas entre os dois manejos não acarretou diferença estatística no rendimento de grãos, levando-se a inferir ser vantajoso o uso de cultivares de ciclo mais longo nesse tipo de condição.
Directory of Open Access Journals (Sweden)
Carlos A. da S. Braga
2005-12-01
Full Text Available Um secador com aquecimento solar, tipo barcaça, com sistema mecânico de descarregamento, foi testado na secagem de grãos de feijão (Phaseolus vulgaris, L.. Em comparação com o sistema tradicional (secagem em terreiro, foram alcançadas reduções de: 83%, no tempo de secagem; 76% na área necessária à operação e 95% no tempo de descarregamento do secador e enchimento do silo respectivo.A batch-type, solar-heated air drier with mechanical system of unloading was tested in drying edible beans (Phaseolus vulgaris, L.. Reductions in drying time and area, reached 83 and 76%, respectively, as compared with the natural drying process. A hand-driven mechanical unloading system incorporated allows 95% reduction in unloading time.
Directory of Open Access Journals (Sweden)
Gutierrez J. A.
2004-04-01
Full Text Available Se cuantificó la variabilidad genética de una muestra de 116 accesiones de habichuela P. vulgaris, cultivadas en centros primarios y secundarios de domesticación. Se evaluaron 18 descriptores morfo-agronómicos asociados con características de la planta, vaina y semilla. Mediante el análisis de las faseolinas utilizando SDS-PAGE se encontraron patrones de bandas de origen andino (T, C y H1 y mesoamericano [S, Sb, CH y H(S+I]. También se evaluaron ocho sistemas isoenzimáticos polimórficos. En el germoplasma de habichuela hay importante contribución del acervo mesoamericano y las accesiones en algunos centros secundarios de domesticación tuvieron origen y procesos de dispersión diferentes de los del fríjol común en tales zonas. La mayor variabilidad morfológica y el mayor número de accesiones con características deseables para el mercado fresco se encontró en el grupo mesoamericano. Se detectó mayor número de genotipos híbridos entre acervos cuando se utilizaron simultáneamente los tres descriptores, lo cual indica una estructura genética compleja que podría deberse al efecto de los factores ambientales propios de la zona templada sobre sus patrones reproductivos. La diversidad total medida con los tres descriptores fue similar a la registrada en fríjol común. Sin embargo, la estructura poblacional encontrada por otros autores en el fríjol común es diferente de la observada en este estudio. Palabras claves: Variabilidad, descriptores morfológicos, isoenzimas, proteínas de semilla, acervos genéticos. ABSTRACT Genetic variability of 116 accesions of Phaseolus vulgaris showing snap beans characteristics coming from primary and secondary centers of domestication, were studied using eighteen morphological descriptors to characterize pods and seeds, SDS-PAGE analysis of seed phaseolins and eight isozyme systems. Higher morphological diversity and best pod marketing characteristics were found at Andean accessions
DEFF Research Database (Denmark)
Ullah, Mohammad Shaef; Haque, Md. Ahsanul; Nachman, Gösta
2012-01-01
Development and reproductive traits of Tetranychus macfarlanei Baker & Pritchard (Acari: Tetranychidae) were investigated on kidney bean, Phaseolus vulgaris L., at eleven constant temperatures. Tetranychus macfarlanei was able to develop and complete its life cycle at temperatures ranging from 17...
Circumscription of the anthracnose pathogens Colletotrichum lindemuthianum and C. nigrum
Liu, F.; Cai, L.; Crous, P.W.; Damm, U.
2013-01-01
The anthracnose pathogen of common bean (Phaseolus vulgaris) is usually identified as Colletotrichum lindemuthianum, while anthracnose of potato (Solanum tuberosum), peppers (Capsicum annuum), tomato (S. lycopersicum) and several other crop plants is often attributed to C. coccodes. In order to
Czech Academy of Sciences Publication Activity Database
Groscurth, S.; Mueller, B.; Schwan, S.; Menzel, M.; Diekstall, F.; Senft, M.; Kendall, A.; Kommor, B.; Neumann, U.; Kalischuk, M.; Kawchuk, L. M.; Krzyžánek, Vladislav; Heilmann, A.; Stubbs, G.; Twyman, R. M.; Pruefer, D.; Noll, G. A.
2012-01-01
Roč. 13, č. 10 (2012), s. 3076-3086 ISSN 1525-7797 Institutional support: RVO:68081731 Keywords : protein aggregates forisomes * bean phaseolus-multiflorus * crystalline P-protein * electron-microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 5.371, year: 2012
CSIR Research Space (South Africa)
Berger, DK
2000-07-01
Full Text Available Stenocarpella maydis, a fungal pathogen of maize, produced polygalacturonases (PGs) when grown on pectin or maize cell walls. An extract from bean (Phaseolus vulgaris L.) which contained an active inhibitor of Aspergillus niger PG, also inhibited S...
Ethylene: a regulator of root architectural responses to soil phosphorus availability
Borch, K.; Bouma, T.J.; Lynch, J.P.; Brown, K.M.
1999-01-01
The involvement of ethylene in root architectural responses to phosphorus availability was investigated in common bean (Phaseolus vulgaris L,) plants grown with sufficient and deficient phosphorus. Although phosphorus deficiency reduced root mass and lateral root number, main root length was
Significance and value of non.traded ecosystem services on farmland
DEFF Research Database (Denmark)
Sandhu, Harpinder; Wratten, Steve; Costanza, Robert
2015-01-01
peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...
Variation in accumulation of isoflavonoids in Phaseoleae seedlings elicited by Rhizopus
Aisyah, Siti; Gruppen, Harry; Andini, Silvia; Bettonvil, Monique; Severing, Eduard; Vincken, Jean Paul
2016-01-01
Seeds from seven species of tribe Phaseoleae, i.e. Phaseolus, Vigna, Lablab and Psophocarpus, were investigated for inducibility of isoflavonoids by germination with or without subsequent elicitation with Rhizopus oryzae. Germination alone poorly induced isoflavonoid production (in the range of
(Phaseolus vulgaris L.): Rhizobia symbiosis
African Journals Online (AJOL)
Yomi
2012-03-06
Mar 6, 2012 ... especially in acidic and basic soils, where it is greatly combined with Al, Fe and Ca ions hydroxide. In ... factors for plants (CIAT, 1992) including common bean .... estimated based on the Foline-Ciocalteu method adapted from.
Chitinase from phaseolus vulgaris leaves
International Nuclear Information System (INIS)
Boller, T.; Gehri, A.; Mauch, F.; Vogeli, V.
1988-01-01
This paper examines the effect of ethylene on chitinase activity in bean leaves. The authors have purified the enzyme in the course of their work. The purification method is detailed and the colorimetric and radiochemical assays are compared
Directory of Open Access Journals (Sweden)
Rogério de Araújo Almeida
2007-09-01
Full Text Available
Em um experimento realizado na Escola de Agronomia da Universidade Federal de Goiás, em Goiânia (GO, no ano de 1997, fez-se a avaliação de desempenho de uma semeadora-adubadora a tração animal, no plantio direto do feijoeiro (Phaseolus vulgaris L.. O ensaio foi conduzido em um latossolo vermelho-escuro distrófico, textura média, num delineamento experimental de blocos ao acaso, com quatro repetições, num fatorial 2 x 2 x 3 (dois tipos de cobertura morta, duas regulagens para o disco de corte e três sistemas de sulcador. A semeadora-adubadora avaliada não atendeu plenamente às exigências agronômicas para a semeadura direta do feijão. Massa e densidade de cobertura menores propiciaram melhor distribuição de sementes e maior população de plantas. O sistema de regulagem do disco de corte, com encaixe na roda limitadora de profundidade, propiciou maior profundidade de adubação e menor percentual de sementes descobertas. O sistema sulcador do tipo disco duplo defasado proporcionou menor profundidade de adubação, maior percentual de sementes descobertas e menor população de plantas que os sistemas providos de sulcador do tipo facão.
PALAVRAS-CHAVE: Plantio direto; semeadora; tração animal.
In an essay, carried out in 1997, the performance of an animal traction planter for direct drilling of black beans (Phaseolus vulgaris L. was evaluated. The experiment was carried out in a distrofic dark red oxisol in the experimental field of the Agronomy School of the Federal University of
Metreveli, Eka; Kachlishvili, Eva; Singer, Steven W; Elisashvili, Vladimir
2017-10-01
Mono and dual cultures of four white-rot basidiomycete species were evaluated for cellulase and xylanase activity under submerged fermentation conditions. Co-cultivation of Pycnoporus coccineus or Trametes hirsuta with Schizophyllum commune displayed antagonistic interactions resulting in the decrease of endoglucanase and total cellulase activities. In contrast, increases in cellulase and xylanase activity were revealed through the compatible interactions of Irpex lacteus with S. commune. Co-cultivation conditions were optimized for maximum enzyme production by I. lacteus and S. commune, the best producers of cellulase/xylanase and β-glucosidase, respectively. An optimized medium for the target enzyme production by the mixed culture was established in a laboratory fermenter yielding 7U/mL total cellulase, 142U/mL endoglucanase, 104U/mL xylanase, and 5.2U/mL β-glucosidase. The dual culture approach resulted in an enzymatic mixture with 11% improved lignocellulose saccharification potential compared to enzymes from a monoculture of I. lacteus. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Cecília Lomônaco
1994-12-01
Full Text Available Estudou-se a predação de sementes em Bauhinia pulchella Benth. (Caesalpiniaceae, Mimosa acutistipula Benth. var. nigra Hub., Mimosa somnians H.B. ex Willd. (Mimosaceae e Phaseolus linearis H.B.K. (Fabaceae para investigar a taxa de predação e a existência de defesas contra a ação de predadores. Foi constatada a preferência por sementes de maior tamanho pelo bruquídeo de Bauhinia pulchella, o que pode significar uma adaptação das plantas em ter sementes pequenas que escapem da predação. Em Mimosa somnians, a imprevisibilidade do número de sementes viáveis produzidas poderia consistir num mecanismo de defesa, por impedir a otimização da quantidade de ovos deixados pelo predador em cada fruto. O formato extremamente achatado das sementes de Mimosa acutistipula parece limitar a ação de predadores. A alta resistência da casca dos frutos de Phaseolus linearis e o aspecto compacto e duro de suas sementes podem ser considerados defesas mecânicas. Existe relação entre o tamanho de sementes e o tamanho de predadores para as espécies estudadas.Seed damage in Bauhinia pulchella Benth. (Caesalpiniaceae, Mimosa acutistipula Benth var. nigra Hub., Mimosa somnians H.B. ex Willd. (Mimosaceae and Phaseolus linearis H.B.K. (Fabaceae, was studied to investigate defense against predators. The preference for larger seeds of Bauhinia pulchella by bruchids is a selection pressure for the plant to product smaller seeds, as a survival mechanism to scape predation. The impredictability of the number of viable seeds per pod in Mimosa somnians could represent a defense mechanism because it does not permit the optimization of the number of eggs laid in each fruit. The flattened seeds of Mimosa acutistipula limit the attack sucess of predator beetles. The high resistance of the pod skin and the hard compact seeds in Phaseolus linearis may be considered mechanical defenses. There is a con-elation between seed size and predator size in the species
characterisation of common bean genotypes based on storage
African Journals Online (AJOL)
ACSS
of pliers and then ground to fine powder with a ... segregation of genotypes were Rm 23.75, 32.50,. 33.75, 22.50 ... Figure 1. Positions of Phaseolus vulgarisL. genotypes on the first and second correspondence scores based on storage protein.
Response of different common bean lines to Phaeoisariopsis griseola in Puerto Rico
Angular leaf spot (ALS), caused by Phaeoisariopsis griseola (Sacc.) Ferraris sin. Pseudocercospora griseola (Sacc.) Crous & U. Braun., is an important disease in common bean Phaseolus vulgaris L. in the Caribbean and Central America. The wide pathogen variability makes it necessary to continuously m...
Background: Clinical and animal studies have suggested efficacies of common bean (Phaseolus vulgaris) consumption on weight loss. Fermentation of common bean-derived dietary fiber by gut microbiota is proposed to modulate obesity; however, the mechanism by which the adipogenesis is inhibited is uncl...
Journal of Applied Sciences and Environmental Management - Vol ...
African Journals Online (AJOL)
Journal of Applied Sciences and Environmental Management. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING ... Journal of Applied Sciences and Environmental Management - Vol 22, No 5 (2018) .... Growth Performance of Five Bean (Phaseolus spp) Varieties as Influenced by Organic ...
Hoe roofmijten hun prooi vinden met behulp van plantengeuren
Boer, de J.G.; Dicke, M.
2005-01-01
Plantengeuren die de planten afgeven na vraat door een herbivoor insect worden door hun natuurlijke vijanden gebruikt om hun prooi te vinden. Hierover is al meer dan 25 jaar onderzoek gedaan. Recent onderzoek in het tritrofe systeem van limaboonplanten (Phaseolus lunatus), spintmijten (Tetranychus
Streefland, C; Jansen, K
1999-01-01
The efferent connections of the rostral nucleus of the solitary tract (NTS) in the rat were studied by anterograde transport of Phaseolus vulgaris leucoagglutinin. Rostral to the injection site, fibers travel through the rostral parvocellular reticular formation and deflect medially or laterally
effect of temporary drought at different growth stages on snap bean
African Journals Online (AJOL)
ACSS
Based on a work at www.ajol.info/ ... of this study was to evaluate the effect of drought stress at different growth stages on pod physical quality and .... pots on a digital balance, and adding the deficit ...... (Phaseolus vulgaris L.) postharvest life at.
Common bean (Phaseolus vulgaris L.) is able to fix atmospheric nitrogen (N2) through symbiotic nitrogen fixation (SNF). Effective utilization of existing variability for SNF in common bean for genetic improvement requires an understanding of underlying genes and molecular mechanisms. The utility of ...
Directory of Open Access Journals (Sweden)
N. Armand
2016-02-01
, each experimental unit was a pot of 1 kg and 5 seeds were planted in each pot and after emergence decreased to 3 seedlings per pot. They were placed in a growth chamber with day and night temperatures as 25 °C and 15°C, respectively. Drought stress treatment based on soil moisture percentage was adjusted by measuring the weight percent of soil moisture and adding water consumed daily by each pot. Foliar application was done 3 times during the growing season and at intervals of 10 days. The first foliar application was performed during the seedling stage within 4 weeks after planting and other foliar application, respectively in early flowering and early podding. The foliar application was performed in such a way that solution droplets were present at all parts of the bean. Trait measurement was carried out 35 days after planting. Results and Discussion Results showed that there was significant difference (P 0.01 between methanol and drought stress regarding the plant height, number of branches, leaf number per pod, root and shoot dry weight, tap root length, root area, root diameter, root volume, and number of pod (P 0.05. All of the morphological traits were mainly affected by severe drought stress. The results of the comparing mean data in the interactions of methanol and drought stress showed that 20% methanol level in non-drought stress significantly increased in plant height, number of branches, root dry weight, root diameter and number of pod compared with control. 20% methanol level in temperate drought stress condition significantly increased the number of pod compared with non-applied methanol foliar application. Severe drought conditions in other traits except plant height difference between the levels of methanol and the methanol was observed. Conclusions Present study showed that the use of methanol at 20% by volume of methanol without the stress could be effective but failed to reduce the negative effects of drought stress on bean (Phaseolus vulgaris L
Hemalatha, Sreeramaiah; Platel, Kalpana; Srinivasan, Krishnapura
2007-01-01
Influence of heat processing on the bioaccessibility of zinc and iron from food grains consumed in India was evaluated. Cereals - rice (Oryza sativa), finger millet (Eleusine coracana), sorghum (Sorghum vulgare), wheat (Triticum aestivum), and maize (Zea mays), and pulses - chickpea (Cicer arietinum) - whole and decorticated, green gram (Phaseolus aureus) - whole and decorticated, decorticated black gram (Phaseolus mungo), decorticated red gram (Cajanus cajan), cowpea (Vigna catjang), and French bean (Phaseolus vulgaris) were examined for zinc and iron bioaccessibility by employing an in vitro dialysability procedure. Both pressure-cooking and microwave heating were tested for their influence on mineral bioaccessibility. Zinc bioaccessibility from food grains was considerably reduced upon pressure-cooking, especially in pulses. Among cereals, pressure-cooking decreased zinc bioaccessibility by 63% and 57% in finger millet and rice, respectively. All the pressure-cooked cereals showed similar percent zinc bioaccessibility with the exception of finger millet. Bioaccessibility of zinc from pulses was generally lower as a result of pressure-cooking or microwave heating. The decrease in bioaccessibility of zinc caused by microwave heating ranged from 11.4% in chickpea (whole) to 63% in cowpea. Decrease in zinc bioaccessibility was 48% in pressure-cooked whole chickpea, 45% and 55% in pressure-cooked or microwave-heated whole green gram, 32% and 22% in pressure-cooked or microwave-heated decorticated green gram, and 45% in microwave-heated black gram. Iron bioaccessibility, on the other hand, was significantly enhanced generally from all the food grains studied upon heat treatment. Thus, heat treatment of grains produced contrasting effect on zinc and iron bioaccessibility.
Reaction of the BASE 120 lines to angular leaf spot in Puerto Rico
Common bean (Phaseolus vulgaris L.) is limited by diseases such as Angular leaf spot (ALS), caused by Phaeoisariopsis griseola (Sacc.) Ferraris sin. Pseudocercospora griseola (Sacc.) Crous & U. Braun. The virulence of Phaeoisariopis griseola isolate ALS-9029-JD2 from Juana Diaz, PR was determined by...
Agronomie Africaine - Vol 26, No 3 (2014)
African Journals Online (AJOL)
Les hybridations interspecifiques dans le genre Phaseolus : selection des genotypes compatibles et caracterisation des hybrides interspecifiques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Silue, IJ Fofana, N Diarrassouba, A Toussaint, G Mergeai, JP Baudoin ...
LOCUS-COERULEUS PROJECTIONS TO THE DORSAL MOTOR VAGUS NUCLEUS IN THE RAT
TERHORST, GJ; TOES, GJ; VANWILLIGEN, JD
1991-01-01
The origin of the noradrenergic innervation of the preganglionic autonomic nuclei in the medulla oblongata and spinal cord is still controversial. In this investigation descending connections of the locus coeruleus to the dorsal motor vagus nucleus in the rat are studied with Phaseolus vulgaris
Application of nuclear energy to agriculture. Progress report, April 1, 1974--March 31, 1975
International Nuclear Information System (INIS)
Moh, C.C.
1975-01-01
Progress is reported on the following research projects: mutation breeding in cassava (Manihot esculenta) and beans (Phaseolus vulgaris) using gamma radiation; photosynthesis in the cassava leaf; translocation of 14 C after assimilation of 14 CO 2 ; and metabolic fate of translocated photosynthetic carbon. (U.S.)
DEFF Research Database (Denmark)
Ortiz-Gonzalo, Daniel; de Neergaard, Andreas; Vaast, Philippe
2018-01-01
the three main cropping systems found in the area: 1) coffee (Coffea arabica L.); 2) Napier grass (Pennisetum purpureum); and 3) maize intercropped with beans (Zea mays and Phaseolus vulgaris). Within these fields, chambers were allocated on fertilised and unfertilised locations to capture spatial...
Réponse de fertilisant organique liquide (DIGROW)
African Journals Online (AJOL)
SARAH
30 juin 2016 ... sur le Rendement graine de haricot –commun (Phaseolus vulgaris L.) À forte teneur en fer et zinc à Ngandajika. 9680. Réponse de .... importante source protéique, de calcium, du fer, zinc et de la ..... Détermination du moment.
We tested the hypothesis that Lima bean Phaseolus lunatus L. (Henderson cultivar) trichome density affects the survival of the acariphagous lady beetle Stethorus punctillum Weise. When isolated throughout larval development, 10% or less of S. punctillum larvae reared on two-spotted spider mite Tetr...
Evaluation of common bean lines for adaptation to high temperatures in Honduras
As in other regions worldwide, common bean (Phaseolus vulgaris L.) production in Central America and the Caribbean (CA/C) region is threatened by effects of climate change including increasing temperatures and drought due to variable rainfall patterns. One of the main alternatives for increasing ada...
Directory of Open Access Journals (Sweden)
F. BROETTO
1997-09-01
crude extract of the different bean cultivars analysed showed different reations to salt concentration in the cultivation procedures as well as a high increasing of peroxidase activity in cv. IAC and JALO.Uma das utilizações da técnica de cultura de tecidos para o melhoramento vegetal é a identificação de linhas de células que apresentem tolerância ao estresse salino. Para se estudar os mecanismos bioquímicos envolvidos na expressão genética da tolerância a salinidade, calos oriundos de eixos embrionários de quatro cultivares de feijão (Phaseolus vulgaris L.; cultivares IAC - carioca, IAPAR 14, JALO-EEP 558, BAT - 93, foram cultivados em meio sólido Murashige & Skoog (1962, suplementado com NaCl nas concentrações de 0, 20, 40, 60 e 80 mM. Após 14 dias de incubação, os calos foram coletados e analisados quanto aos padrões isoenzimáticos e de atividade das peroxidases. Os cultivares BAT e IAPAR apresentaram duas zonas de atividade em comum na região anódica e apenas uma zona enzimática específica a cada um deles (migração mais rápida.Possivelmente as duas zonas anódicas intermediárias sejam produtos do mesmo loco enzimático, porém com alelos diferentes, consequentemente diferentes mobilidades eletroforéticas. O cv. JALO apresentou duas zonas anódicas de atividade em comum com os cultivares IAC e IAPAR com uma zona anódica exclusiva de migração mais lenta, a qual apresentou atividade mais intensa de todos os cultivares analisados. Este cultivar revelou ainda uma zona catódica provavelmente dimérica e heterozigota nos indivíduos de todos os tratamentos aplicados. Provavelmente, esta é a mesma zona que ocorre em homozigose com fixação do alelo lento para os indivíduos de todos os tratamentos efetuados nos cultivares BAT e IAPAR. O cv. IAC apresentou duas bandas anódicas em comum com os cv. IAPAR e JALO. Apresentou também a banda anódica mais rápida em comum com o cv. IAPAR e uma banda anódica exclusiva de migração mais
Feng, Xue; Orellana, Gardenia; Myers, James; Karasev, Alexander V
2018-04-12
Recessive resistance to Bean common mosaic virus (BCMV) in common bean (Phaseolus vulgaris L.) is governed by four genes that include one strain-nonspecific helper gene bc-u, and three strain-specific genes bc-1, bc-2, and bc-3. The bc-3 gene was identified as an eIF4E translation initiation factor gene mediating resistance through disruption of the interaction between this protein and the VPg protein of the virus. The mode of action of bc-1 and bc-2 in expression of BCMV resistance is unknown, although bc-1 gene was found to affect systemic spread of a related potyvirus, Bean common mosaic necrosis virus. To investigate the possible role of both bc-1 and bc-2 genes in replication, cell-to-cell, and long distance movement of BCMV in P. vulgaris, we tested virus spread of eight BCMV isolates representing pathogroups I, IV, VI, VII, and VIII, in a set of bean differentials expressing different combinations of six resistance alleles including bc-u, bc-1, bc-1 2 , bc-2, bc-2 2 , and bc-3. All studied BCMV isolates were able to replicate and spread in inoculated leaves of bean cultivars harboring bc-u, bc-1, bc-1 2 , bc-2, and bc-2 2 alleles and their combinations, while no BCMV replication was found in inoculated leaves of 'IVT7214' carrying the bc-u, bc-2 and bc-3 genes, except for isolate 1755a capable of overcoming the resistance conferred by bc-2 and bc-3. In contrast, the systemic spread of all BCMV isolates from pathogroups I, IV,VI, VII, and VIII was impaired in common bean cultivars carrying bc-1, bc-1 2 , bc-2, and bc-2 2 alleles. The data suggest that bc-1 and bc-2 recessive resistance genes have no effect on the replication and cell-to-cell movement of BCMV, but affect systemic spread of BCMV in common bean. The BCMV resistance conferred by bc-1 and bc-2 and affecting systemic spread was found only partially effective when these two genes were expressed singly. The efficiency of the restriction of the systemic spread of the virus was greatly enhanced when
Directory of Open Access Journals (Sweden)
Cantillo Stella H. de
1993-12-01
Full Text Available
Performance of the snap bean (Phaseolus vulgaris L. with traditional fertilizations vs. technical fertilization. The experiment was made in the farm called "El Ancon" - Pradera, (Cauca, Valle, with 1100 mm of precipitation, 940 m.a.s.l. 73.5% R.H. and a temperature of 24°C. In order to get basic information, a completely randomized block design was installed with three replications and eight treatments (control, T-traditional, T-10B-Urea, T-10B-S ammonium, T-05B-Urea, T-05B-S.Anunonium, T-10B-U.SA, T-05B-U.SA. Variables measured were dry matter weight (DNV (at 15-30-45 leaf area (L.A (at 15-30-45 and production (50-70d. Treatments with best productions mean values were: T-I0B-Urea, T-IOB-U.SA, T10B-S. Anunonium, T-05B-S.Anunonium with 8067.0, 6928.4 and 6194.4/ha respe., all of them above the average of the trial. High investment T-traditional do not have a similar answer in relation to their productions, but the T-I0B-Urea treatment has a lower cost and rentability of 84.46%.
En el ensayo se utilizó un diseño de bloques completamente al azar con tres repeticiones y ocho tratamientos (dos dosis de Boro, dos fuentes y tres dosis de Nitrógenos y las combinaciones de estas, los cuales se basaron en una encuesta que se preparó para los agricultores de la zona y en los análisis del suelo, que en términos generales mostraron deficiencias de Boro y Nitrógeno. Las variables de respuesta fueron peso de materia seca, área foliar medidas a los 15-30-45 días y producción de la planta. Para peso de materia seca y área foliar en las diferentes épocas, el ANDEVA mostró diferencias significativas. Los tratamientos de mejor producción fueron T-10B-Urea, T-10B U. Samonio, T-10B-S. Amonio con promedios de 8067.0, 7139.8, 6928. 4 y 6194.4 g/ha respectivamente, siendo ellos superiores al promedio general del experimento (5604.5. A pesar de la alta inversión del T- convencional el cultivo no respondió a ella. El caso contrario sucedió con
Journal of Agriculture, Science and Technology - Vol 10, No 2 (2008)
African Journals Online (AJOL)
The effect of liming an acid nitisol with with either calcite of dolomite on two common bean ( Phaseolus vulgaris L.) varieties differing in aluminium tolerance · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EN Mugai, SG Agong, H Matsumoto ...
The impact of linamarin and lotaustralin content in the leaves of Phaseolus lunatus L. on the second and third trophic levels was studied in Tetranychus urticae (Koch) and its predator Phytoseiulus persimilis Athias-Henriot. Chemical analyzes showed that the content of linamarin was higher in termin...
Genome-wide association study of anthracnose resistance in Andean beans
Anthracnose is a seed-borne disease of common bean (Phaseolus vulgaris L.) caused by the fungus Colletotrichum lindemuthianum, and the pathogen is cosmopolitan in distribution. The objectives of this study were to identify new sources of anthracnose resistance in a diverse panel of 230 Andean beans ...
Iron bioavailability studies of the first generation of iron-biofortified beans released in Rwanda
This paper represents a series of in vitro Fe bioavailability experiments, Fe content analysis and polyphenolic profile of the first generation of Fe biofortified beans (Phaseolus vulgaris) selected for human trials in Rwanda and released to farmers of that region. The objective of the present stud...
Nodulation of leguminous plants as affected by root secretions and red light
Lie, T.A.
1964-01-01
Nodulation of bean plants, Phaseolus vulgaris L., in water culture was poor during hot sunny weather in the greenhouse. It did not improve when indoleacetic acid, kinetin, gibberellic acid, purines and pyrimidines, yeast and soil extract were added. Nodulation was enhanced by adding used
Effect of industrial wastewater ontotal protein and the peroxidase ...
African Journals Online (AJOL)
The aim of this study is to investigate the effects of industrial wastewaters on protein and the peroxidase activity in Lycopersicon esculentum Mill., Capsicum annuum L., Phaseolus vulgaris L. and Vicia faba L. Industrial wastewaters were taken from Dardanel Fisheries Company, Tekel alcoholic drinks companies' ...
DEFF Research Database (Denmark)
Hastwell, April H; de Bang, Thomas Christian; Gresshoff, Peter M
2017-01-01
these complete CLE peptide-encoding gene families with those of fellow legumes, Glycine max and Phaseolus vulgaris, in addition to the model plant Arabidopsis thaliana. This approach provided insight into the evolution of CLE peptide families and enabled us to establish putative M. truncatula and L. japonicus...
Identification of an electron transfer locus in plastocyanin by chromium(II) affinity labeling
DEFF Research Database (Denmark)
Farver, O; Pecht, I
1981-01-01
Cu(II)--plastocyanin from French beans (Phaseolus vulgaris) is reduced quantitatively by Cr(II)aq ions to give a substitution-inert Cr(III) adduct of Cu(I)--plastocyanin. Enzymatic proteolysis of this derivative by thermolysin led to the identification of the Cr(III) binding peptide. This contains...
Induction of indirect defence against spider-mites in uninfested lima bean leaves.
Takabayashi, J.; Dicke, M.; Posthumus, M.A.
1991-01-01
Headspace analyses of uninfested Lima bean (Phaseolus lunatus) leaves show an absence of or only trace amounts of the terpenoids (E)--ocimene and (E)-4,8-dimethyl-1,3,7-nonatriene. Upon infestation by two-spotted spider-mites (Tetranychus urticae), Lima bean leaves produce (E)--ocimene and
Aims Fusarium root rot (FRR) is a soil-borne disease that constrains common bean (Phaseolus vulgaris L.) production. FRR causal pathogens include clade 2 members of the Fusarium solani species complex. Here we characterize common bean reaction to four Fusarium species and identify genomic regions as...
Genome-wide association analysis of symbiotic nitrogen fixation in common bean
A genome-wide association study (GWAS) was conducted to explore the genetic basis of variation for symbiotic nitrogen fixation (SNF) and related traits in the Andean diversity panel (ADP) comprised of 259 common bean (Phaseolus vulgaris) genotypes. The ADP was evaluated for SNF and related traits in...
Common bean (Phaseolus vulgaris) productivity in Sub-Saharan Africa is far below yield potential, while climate change and access to inputs are persistent challenges. In addition, the market and human nutrition needs for common bean continue to expand in the African continent, which has the highest ...
Zinc and selenium accumulation and their effect on iron bioavailability in common bean seeds
Common bean (Phaseolus vulgaris) is the most important legume crop. It represents a major source of micronutrients and has been targeted for essential trace mineral enhancement (i.e. biofortification). The aim of the study was to investigate whether it is possible to biofortify seeds with multi-micr...
Tako, Elad; Reed, Spenser; Anandaraman, Amrutha; Beebe, Steve E; Hart, Jonathan J; Glahn, Raymond P
2015-01-01
Iron (Fe) deficiency is a highly prevalent micronutrient insufficiency predominantly caused by a lack of bioavailable Fe from the diet. The consumption of beans as a major food crop in some populations suffering from Fe deficiency is relatively high. Therefore, our objective was to determine whether a biofortified variety of cream seeded carioca bean (Phaseolus vulgaris L.) could provide more bioavailable-Fe than a standard variety using in-vivo (broiler chicken, Gallus gallus) and in-vitro (Caco-2 cell) models. Studies were conducted under conditions designed to mimic the actual human feeding protocol. Two carioca-beans, a standard (G4825; 58 μg Fe/g) and a biofortified (SMC; 106 μg Fe/g), were utilized. Diets were formulated to meet the nutrient requirements of Gallus gallus except for Fe (33.7 and 48.7 μg Fe/g, standard and biofortified diets, respectively). In-vitro observations indicated that more bioavailable-Fe was present in the biofortified beans and diet (Pbean treatment, as indicated by the increased total-body-Hemoglobin-Fe, and hepatic Fe-concentration (Pbean treatment (Pbeans provided more bioavailable Fe; however, the in vitro results revealed that ferritin formation values were relatively low. Such observations are indicative of the presence of high levels of polyphenols and phytate that inhibit Fe absorption. Indeed, we identified higher levels of phytate and quercetin 3-glucoside in the Fe biofortified bean variety. Our results indicate that the biofortified bean line was able to moderately improve Fe-status, and that concurrent increase in the concentration of phytate and polyphenols in beans may limit the benefit of increased Fe-concentration. Therefore, specific targeting of such compounds during the breeding process may yield improved dietary Fe-bioavailability. Our findings are in agreement with the human efficacy trial that demonstrated that the biofortified carioca beans improved the Fe-status of Rwandan women. We suggest the utilization
Directory of Open Access Journals (Sweden)
Maldonado Gustavo
1993-12-01
Full Text Available Inthe vegetative phase of growth in bean (Phaseolus vulgaris L., the dry matter gain depends on the physiological behavior and growth habit of the bean plant. The Growth process in relation to growth type were evaluated in the present study. The purpose of the study was to establish growth type and growth index relations in ICA-Cerinza (growth type 1 and
ICA -Tundama (growth type 11 wich are both bush bean varieties. The plants were sown in 40.5 m2 plots, in rows spaced 0.5 m. and 0.12 m. between plants in a randomized completely block design with 4 replications; samples of 3 plants per plotwere taken 7 days each starting 15 to 78 days after emergence. Total dryweight (TOW Stem dryweight (SOW, leaf dry weight (LOW and total leaf area (TLA were
determined. Relative growth rate (RGR, net assimilation rate (NAR, leaf area ratio (LAR, leaf weight ratio (LWR, and specific leaf area (SLA, were determined by the classical aproach. Significant differences in TDW, SDW, LDW, and TLA between varieties were detected in the 15 and 78 days
evaluations. Similar results were obtained for RGR, NAR, LAR, LWR, and SLA. The mean RGR was 0.0455 g. g-1 .day-1 in Cerinza and 0.0437 g.g-1.day -1 in Tundama but these were no statistically different. NAR and RGR had similar trends and were positive and significantly correlated. LAR decreced
linearly in Cerinza, but it was cuadratic in Tundama with the highest values in the initial and the last evaluations. The LWR show that Tundama variety translocated more dry matter to assimilatory tissue formation. SLA was similar for the two varieties, but it was higher in the indeterminate (type 11, showing that Tundama had moretinny leaves. Growth analysis
utilizing fixed time periods did not allow to detect differences between varieties. Apparently, these were similar in physiological behavior during the vegetative phase independently of growth type.
La fase de crecimiento vegetativo de la planta de
Effect of gamma irradiation on germination and Vitamin-C content of green gram and moth beans
International Nuclear Information System (INIS)
Mohan, Priya; Marathe, S.A.; Rao, V.S.; Bongirwar, D.R.
2001-01-01
Insect disinfestation of prepacked legumes by using low dose gamma irradiation is well known. Changes in sprout length, water uptake and Vitamin C contents of radiation processed legumes were studied. Gamma irradiation (0.25 kGy) of green gram (Phaseolus aureus) and moth bean (Phaseolus aconitifolius) reduced the sprout length on germination by 6-18% at 0.25 kGy and 20-32% at 0.75 kGy, compared to control. Water uptake was not affected in both the legumes by radiation treatment. Vitamin C content increased significantly on germination in both the legumes for 24 and 48 hrs. Further on cooking of the seeds, Vitamin C contents were decreased in both the legumes significantly, more so in pressure cooked and shallow fried samples, compared to boiled (simple cooking). As such radiation treatment did not show any significant change in Vitamin C content of both the legumes either on germination and/or on cooking compared to control. (author)
Directory of Open Access Journals (Sweden)
Jamie A. O'Rourke
2013-06-01
Full Text Available A small fast neutron mutant population has been established from Phaseolus vulgaris cv. Red Hawk. We leveraged the available P. vulgaris genome sequence and high throughput next generation DNA sequencing to examine the genomic structure of five Phaseolus vulgaris cv. Red Hawk fast neutron mutants with striking visual phenotypes. Analysis of these genomes identified three classes of structural variation; between cultivar variation, natural variation within the fast neutron mutant population, and fast neutron induced mutagenesis. Our analyses focused on the latter two classes. We identified 23 large deletions (>40 bp common to multiple individuals, illustrating residual heterogeneity and regions of structural variation within the common bean cv. Red Hawk. An additional 18 large deletions were identified in individual mutant plants. These deletions, ranging in size from 40 bp to 43,000 bp, are potentially the result of fast neutron mutagenesis. Six of the 18 deletions lie near or within gene coding regions, identifying potential candidate genes causing the mutant phenotype.
Effect of Weed Management on Weeds and Grain Yield of Haricot ...
African Journals Online (AJOL)
Weeds are one of the major constraints limiting haricot bean productivity and production. Field experiments were conducted on the effect of weed managements on weeds and grain yield of haricot bean (Phaseolus Vulgaris L.) at Melkassa Agricultural Research Center from 2011 - 2013. The objective was to determine the ...
Effect of weed management on weeds and grain yield of haricot bean
African Journals Online (AJOL)
Weeds are one of the major constraints limiting haricot bean productivity and production. Field experiments were conducted on the effect of weed managements on weeds and grain yield of haricot bean (Phaseolus Vulgaris L.) at Melkassa Agricultural Research Center from 2011 - 2013. The objective was to determine the ...
Dicke, M.; Beek, van T.A.; Posthumus, M.A.; Dom, Ben N.; Bokhoven, van H.; Groot, de Ae.
1990-01-01
A volatile kairomone emitted from lima bean plants (Phaseolus lunatus) infested with the spider miteTetranychus urticae, was collected on Tenax-TA and analyzed with GC-MS. Two components were identified as the methylene monoterpene (3E)-4,8-dimethyl-1,3,7-nonatriene and the methylene sesquiterpene
Effect of phosphorus limiting on phytase activity, proton efflux and ...
African Journals Online (AJOL)
This work intended to measure the nodulated-roots oxygen consumption, proton efflux and phytase activity in 2 lines of common bean (Phaseolus vulgaris) (115, 147) at 2 levels of P supply. Rooted seedlings were inoculated with Rhizobium tropici CIAT 899 in hydroaeroponic cultivation under glasshouse. Phosphorus was ...
A differential nursery for testing nodulation effectiveness of rhizobium strains in common beans
Most common beans (Phaseolus vulgaris L.) in Central America are produced on soils having low nitrogen (N) and phosphorous content. The small-scale farmers do not have resources to use fertilizers or implement soil management practices. Strategies to improve the adaptation of beans to low N soils in...
Czech Academy of Sciences Publication Activity Database
Pospíšilová, Jana; Baťková, P.
2004-01-01
Roč. 48, č. 3 (2004), s. 395-399 ISSN 0006-3134 R&D Projects: GA ČR GA522/02/1099 Institutional research plan: CEZ:AV0Z5038910 Keywords : Beta vulgaris * net photosynthetic rate * Phaseolus vulgaris Subject RIV: ED - Physiology Impact factor: 0.744, year: 2004
Registration of ‘Alpena' navy bean
‘Alpena’ navy bean (Phaseolus vulgaris L.) (Reg. no. CV- , PI -), developed by Michigan State University AgBioResearch was released in 2014 as an upright, midseason cultivar with uniform dry down and excellent canning quality. Alpena was developed using pedigree breeding method to the F3 generation ...
Bean nodulation patterns in soils of different texture at Morogoro ...
African Journals Online (AJOL)
Thus, nodulation success by the inoculum was total in the clay but only dismal in the sandy soil. The unexpected discrepancy between inoculum success on the one hand and nodulation plus plant growth response on the other, is discussed. Keywords: Bean nodulation, ELISA typing of nodules, phaseolus vulgaris
Migration, trapping and local dynamics of whiteflies (Homoptera: Aleyrodidae)
DEFF Research Database (Denmark)
Riis, Lisbeth; Nachman, Gösta
2006-01-01
to population growth. 4 A model for changes in whitefly density during an entire bean (Phaseolus vulgaris L.) crop cycle, including an immigration parameter, was also developed. 5 Non-attractant window traps surrounding an annual field crop were assumed to intercept whiteflies immigrating into and emigrating...
DEFF Research Database (Denmark)
Kroghsbo, Stine; Madsen, Charlotte Bernhard; Poulsen, Morten
2008-01-01
As part of the SAFOTEST project the immunmodulating effect of Cry1Ab protein from Bacillus thuringiensis (Bt) and PHA-E lectin from kidney bean (Phaseolus vulgaris erythroagglutinin) was examined in 28- and 90-day feeding studies in Wistar rats. PHA-E lectin was chosen as positive control. Rats...
QTL analysis of symbiotic nitrogen fixation in a black bean RIL population
Dry bean (Phaseolus vulgaris L) acquires nitrogen (N) from the atmosphere through symbiotic nitrogen fixation (SNF) but it has a low efficiency to fix nitrogen. The objective of this study is to map the genes controlling nitrogen fixation in common bean. A mapping population consisting of 122 recomb...
Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...
African Journals Online (AJOL)
Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.
Registration of ‘Long’s Peak’ Pinto Bean
Methods to harvest dry edible bean (Phaseolus vulgaris L.) have changed dramatically in the past 20 years to accommodate direct harvest systems that eliminate the need to undercut and windrow the crop before it can be threshed. Direct harvest systems cut the bean plant with a sickle bar on the comb...
Muller, H.R.A.
1927-01-01
From diseased pods of Phaseolus vulgaris, 4 strains were isolated of Colletotrichum lindemuthianum: Z I and Z II from Zeeland; E from Enkhuizen; W from Westland. The strains differed from the American strainsβandγ. Tests on bean varieties used by Leach suggested that Z strains were related to form
Carry-over effect of Thidiazuron on banana in vitro proliferation at ...
African Journals Online (AJOL)
Thidiazuron (TDZ) is an active cytokinin that was shown to induce increased shoot proliferation and habituation in black walnut, Phaseolus lunatus and evergreen azalea, which are tree species but has not been widely investigated in bananas. Unlike other cytokines commonly in use that are adeninebased, TDZ is a urea ...
African Journal of Biotechnology - Vol 7, No 18 (2008)
African Journals Online (AJOL)
AFLP analysis among Ethiopian arabica coffee genotypes · EMAIL FREE FULL TEXT ... Quantitative trait loci (QTLs) for resistance to gray leaf spot and common rust diseases ... Response of common bean (Phaseolus vulgaris L.) cultivars to foliar and soil ... Effect of ultraviolet B irradiation on accumulation of catechins in tea ...
Sustainable restitution/recultivation
African Journals Online (AJOL)
RECHERCHE02
the effects of combined mineral and organic fertilizers on maize (Zea mays L.) and beans (Phaseolus vulgaris L.) and ... Farms were selected based on key socio-economic status (land size, livestock ownership, type of house, .... and the predominant animals are cattle, goats, pigs and chicken. Those animals are sources of ...
Evaluating Genetic Association between Fusarium and Pythium ...
African Journals Online (AJOL)
Resistance to Fusarium root rot (Fusarium solani f.s.p phaseoli) has been reported in common bean (Phaseolus vulgaris L.) sources and is usually associated with Pythium root rot resistance. Pythium root rot (Pythium ultimum var ultimum) resistance is controlled by a single dominant gene, marked by a SCAR marker ...
Sensory analysis of beans (Phaseolus vulgaris
Directory of Open Access Journals (Sweden)
Sanz-Calvo M.
1999-01-01
Full Text Available The methodology of sensory profiling constitutes the basis of a descriptive quantitative analysis, defining a product with the minimum number of words and with maximum efficiency, using a precise tasting sheet, which can be reproduced and is understood by all. In this work, the texture profiling for different bean varieties that are characteristic of the Spanish market was carried out. Optimum conditions for samples and a tasting card were established, and a panel was trained. The texture profile results show significant differences amongst varieties and even amongst different origins for the same variety.
Genetic variation for drought resistance in small red seeded ...
African Journals Online (AJOL)
Common bean (Phaseolus vulgaris L.) productivity is low in major growing regions of Ethiopia mainly due to drought, caused by low and erratic rainfall. A field experiment was carried out at Gofa in Southern Ethiopia, to assess genetic variability for drought resistance in forty-nine small red seeded common bean genotypes ...
Application of molecular markers in breeding for bean common ...
African Journals Online (AJOL)
Sequence characterised amplified region (SCAR) markers, linked to four independent quantitative trait loci (QTL) in XAN 159 and GN #1 Nebr. sel. 27, are available for indirect selection of resistance to common bacterial blight in Phaseolus vulgaris. Existing SCAR-markers, SU91, BC420, BC409 and SAP6, were evaluated ...
Czech Academy of Sciences Publication Activity Database
Mok, M. C.; Martin, R. C.; Dobrev, Petre; Vaňková, Radomíra; Yonekura-Sakakibara, K.; Sakakibara, H.; Mok, D. W. S.
2005-01-01
Roč. 137, č. 3 (2005), s. 1057-1066 ISSN 0032-0889 R&D Projects: GA ČR GA522/04/0549; GA MŠk ME 406 Institutional research plan: CEZ:AV0Z50380511 Keywords : ARABIDOPSIS-THALIANA * AROMATIC CYTOKININS * PHASEOLUS-VULGARIS Subject RIV: EF - Botanics Impact factor: 6.114, year: 2005
Characterisation of bacterial brown spot pathogen from dry bean ...
African Journals Online (AJOL)
Pseudomonas syringae pv. syringae (Pss) causes bacterial brown spot (BBS) of beans (Phaseolus vulgaris L.), with yield losses of up to 55% in South Africa. Pss has a wide host range and for many of these, the pathogen has been biochemically and genetically characterised. However, few studies have been conducted on ...
Micronutrient (provitamin A and iron/zinc) retention in biofortified crops
African Journals Online (AJOL)
Degradation also occurs during the storage of dried products (e.g. from sweet potato, maize, cassava) at ambient temperature, and a short shelf life is a constraint that should be considered when foods are biofortified for provitamin A. Iron and zinc retention were high for common beans (Phaseolus vulgaris) and cowpeas ...
Factors influencing smallholder farmers' bean production and supply ...
African Journals Online (AJOL)
Common bean (Phaseolus vulgaris L) is a major staple food in Burundi; thus increasing its production and marketing has the potential for raising incomes of the farming households. In the country, bean outputs have been declining for decades, yet demand for the crop in East Africa has surged considerably. This study was ...
Directory of Open Access Journals (Sweden)
JAVIERA GONZÁLEZ
2001-12-01
diferencias en la magnitud de los cambios observados en las diferentes variedades de poroto, en todos ellos se aprecia la tendencia a modificar la estructura de los centros PSII, de manera de favorecer una menor sobreexcitación de los centros de reacción de dichos complejos, en las situaciones de estrés estudiadasHigher plants have developed multiple mechanisms of photoprotection in order to efficiently use the absorbed energy, as well as protecting the photosynthetic apparatus against oxidative damage. Particularly, under environmental conditions, restrictive for the photochemical use of the absorbed energy, such as high light, water stress and high temperatures. PSII complexes are able to change their location and structure as in PSIIß and state transitions, but not exclusively upon light intensity. In the present study, the effect of different environmental stresses on PSII heterogeneity in four bean cultivar (Phaseolus vulgaris L.: Arroz Tuscola (AT, Orfeo INIA (OI, Bayos Titán (BT and Hallado Dorado (HD, has been assessed. In chamber grown plants, the proportion of the PSIIb centers increases up to a 100 % as the temperature rises. A stronger response was observed, upon water stress. Under field conditions, light stress induced by fixing leaves to horizontal position, further increased the water stress dependent effect on PSIIb centers, from 27 % in free leaves from watered plants up to a 63 % in horizontal leaves from water stressed plants. As for state transitions, an increase was observed in 20 ºC grown plants when exposed to 15 ºC. Also, temperatures from 25 to 35 ºC induced increases in state transitions. Such increases were lowered by water stress, in cultivars AT and OI, maintained in HD and further increased in BT. Even though differences were observed in the extent of the changes on PSIIß and state transitions among varieties, a clear trend to modify the PSII structure in order to decrease its excitation pressure under the stress conditions studied were
Separation of abscission zone cells in detached Azolla roots depends on apoplastic pH.
Fukuda, Kazuma; Yamada, Yoshiya; Miyamoto, Kensuke; Ueda, Junichi; Uheda, Eiji
2013-01-01
In studies on the mechanism of cell separation during abscission, little attention has been paid to the apoplastic environment. We found that the apoplastic pH surrounding abscission zone cells in detached roots of the water fern Azolla plays a major role in cell separation. Abscission zone cells of detached Azolla roots were separated rapidly in a buffer at neutral pH and slowly in a buffer at pH below 4.0. However, cell separation rarely occurred at pH 5.0-5.5. Light and electron microscopy revealed that cell separation was caused by a degradation of the middle lamella between abscission zone cells at both pH values, neutral and below 4.0. Low temperature and papain treatment inhibited cell separation. Enzyme(s) in the cell wall of the abscission zone cells might be involved in the degradation of the pectin of the middle lamella and the resultant, pH-dependent cell separation. By contrast, in Phaseolus leaf petioles, unlike Azolla roots, cell separation was slow and increased only at acidic pH. The rapid cell separation, as observed in Azolla roots at neutral pH, did not occur. Indirect immunofluorescence microscopy, using anti-pectin monoclonal antibodies, revealed that the cell wall pectins of the abscission zone cells of Azolla roots and Phaseolus leaf petioles looked similar and changed similarly during cell separation. Thus, the pH-related differences in cell separation mechanisms of Azolla and Phaseolus might not be due to differences in cell wall pectin, but to differences in cell wall-located enzymatic activities responsible for the degradation of pectic substances. A possible enzyme system is discussed. Copyright © 2012 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Varón de Agudelo Francia
1988-06-01
Full Text Available Se dividió la parte plana del Valle del Cauca en tres zonas (norte, centro y sur, habiéndose visitado 33 fincas. En la zona norte las malezas con mayor porcentaje de frecuencia y distribución en los cultivos de soya fueron Digitaria horizontalis, Echinochloa colonum y Leptochloa filiformis; en la zona centro Ipomoea hirta, Amaranthus dubius y Echinochloa colonum y en la zona sur predominaron Ipomoea hirta, Portulaca oleracea Cyperus rotundus. Los análisis de muestras de suelo y raíces indicaron que H. glycines se encuentra distribuido en todo el Valle del Cauca, presentando la zona sur (Candelaria, Palmira y Puerto Tejada las mayores poblaciones. Entre las especies evaluadas (malezas, cultivos, leguminosas forrajeras y silvestres, solamente Glycine max y Phaseolus vulgaris se consideraron como susceptibles a H. glycines raza 3. y P. angularis y P. multiflora permitieron muy poca infección y multiplicación del nemátodo.A nematode recognition of Heterodera glycines was focused on crops of soybean. Valle del Cauca was divided in three zones (northen, central and southern and 33 farms were visited. The results of the analysis on samples of soils and roots showe that Heterodera glycines is scattered throughout Valle del Cauca, being the southern zone (Palmira, Candelaria and Puerto Tejada the one having the highest standards in nematode population. Weeds showing a greater frequency percentage were : Digitaria horizontalis, Echinochloa colonum and Leptochloa filiformis, in the northen zone; Ipomoea hirta, Amaranthus dubius and Echinochloa colonum, in the central zone, and Ipomoea hirta, Portulaca oleracea and Cyperus rotundus, in the southern zone , From among the whole species evaluated (weeds, crops, leguminous a n d fodder plants, Glycine max and Phaseolus vulgaris were considered to be susceptible to H. Glycines race 3. Phaseolus angularis y P. multiflora let low population levels.
Directory of Open Access Journals (Sweden)
Renata Matraszek
2013-12-01
Full Text Available The sensitivity of six vegetable plants on nickel at early stages of their growth was investigated by index of tolerance. Besides the possibility of nickel fitostabilization by additional application of iron or calcium was tested. The experiment was conducted on Petri dishes. Different concentrations of nickel (0; 0,03; 0,06mM Ni as nickel sulphate, iron (0,05; O,OlmM Fe as Fe2+ citrate and calcium (0,50; 0,75; lmM Ca as calcium carbonate were added. Taking into consideration the sensitivity, investigated vegetables can be ordered in the following way: Cucurbita pepo conv. giromontiina L.>Lactuca sativa L.>Sinapis alba L.>Spinacia oleracea L.=Zea mays var. saccharata Kcke.>Phaseolus vulgaris L. Positive, statistically significant effect ofnickel fitostabilization (0,03 or 0,06mM Ni on elongative growth by the iron application (0,10mM Fe was shown for Zea mays var. saccharata Kcke independently of Ni concentration in the nutrient medium as well as for Sinapis alba L. and Phaseolus vulgaris L. in 0,06mM Ni. Addition as much as 0,75mM Ca in the presence 0,03mM Ni had positive result on Sinapis alba L and Phaseolus vulgaris L. seedlings as well as on Zea mays var. saccharata Kcke and Lactuca sativa L. roots and Cucurbita pepo convar. giromontiina L. shoots. Addition of 0,75mM Ca in the presence 0,06mM Ni promoted elongative growth of Zea mays var. saccharata Kcke seedlings. Application lmM Ca resulted in the promotion of elongative growth of Zea mays var. saccharata Kcke. roots (0,03mM Ni as well as Spinacia oleracea L. roots (0,06mM Ni.
Improvement of resistance to Fusarium root rot through gene ...
African Journals Online (AJOL)
Fusarium root rot (FRR), caused by Fusarium solani f.sp. , is one of the most serious root rot diseases of common bean (Phaseolus vulgaris L.) throughout the world. Yield losses of up to 84% have been attributed to the disease. Development and deployment of resistant materials is the most feasible approach to managing ...
relative performance of staking techniques on yield of climbing bean
African Journals Online (AJOL)
ACSS
Common bean (Phaseolus vulgaris L.) is an important staple grain legume in the Great Lakes Region of Africa. In addition, it is a major source of proteins, energy and micro-nutrients (e.g. Fe and Zn), especially for smallholder farmers. The climbing bean is particularly more productive, an efficient land user and tolerant to ...
Effect of temporary drought at different growth stages on snap bean ...
African Journals Online (AJOL)
High quality snap bean (Phaseolus vulgaris L.) can be produced under rain-fed conditions, provided that adequate moisture is available. However, drought may occur at any stage of growth of snap bean. The objective of this study was to evaluate the effect of drought stress at different growth stages on pod physical quality ...
clustering common bean mutants based on heterotic groupings
African Journals Online (AJOL)
ACSS
2015-02-19
Feb 19, 2015 ... Blair, W.M., Porch, T., Cichy, K., Galeano, H. C,. Lariguet, P., Pankhurst, C. and Broughton, W. 2007a. Induced mutants in common bean. (Phaseolus vulgaris) and their potential use in nutrition quality, breeding and gene discovery. Israel Journal of Plant Sciences. 55:191 - 200. Blair, W.M., Fregene, A.M., ...
Insect disinfestation of pulses by irradiation
International Nuclear Information System (INIS)
Bhuiya, A.D.; Ahmed, M.; Rezaur, R.; Seal, D.R.; Nahar, G.; Islam, M.M.; Islam, M.S.
1985-01-01
Studies were carried out on four varieties of pulses, namely, mosur or lentil (Lens esculenta), mung (Phaseolus aureus), chola or gram (Cirecer aricitinum), and mashkalai (Phaseolus radiatus). Two major burchid betles, Callosobruchus chinensis (L.) and Callosobruchus analis (Fab.), were found to infest different varieties of pulses. Radiation sensitivity of the two pulse beetles was determined at different developmental stages (i.e., eggs, larvae, and pupae). Emergence of adults from eggs totally stopped at a dose of 0.04 kGy. Doses of 0.28 and 0.32 kGy, respectively, were required for complete inhibition of adult emergence from irradiated fourth instar larvae of C. analis and C. chinensis. Studies revealed that the experimental gram was heavily infested (65-91 percent) as compared to other pulses after 8 months of storage in all packaging materials used (gunny bag, gunny bag lined with polyethylene, polyethylene and polyvinyl chloride bags). Mashkalai showed insignificant damage (2-5 percent) by the insects. Reinfestation in the treated products was observed in polyethylene and gunny bags
Directory of Open Access Journals (Sweden)
Maira Oliveira SILVA
2013-11-01
Full Text Available O feijão (Phaseolus vulgaris L. é uma leguminosa rica em nutrientes, que ocupa a posição de segunda classe de leguminosa mais importante do mundo, perdendo apenas para a soja sendo, o feijão, utilizado por muito tempo no Brasil como o alimento básico para a população. Pensando nisso, a pesquisa teve por objetivo avaliar a composição centesimal de grãos de feijões cru e cozido comuns e biofortificados e os teores de minerais (P, K, Ca, Mg, S, Na, Cu, Fe, Mn e Zn das cultivares de feijão (Phaseolus vulgaris L. carioca biofortificado (Pontal e comum (comercial. Os resultados obtidos mostraram que a cultivar Pontal apresentou maior teor de nutrientes quando comparada à comercial. Os teores de minerais não se diferenciaram entre as cultivares e seus tratamentos, sendo a disponibilidade de minerais mais afetada em feijões crus do que em cozidos, provavelmente, devido à presença de fatores antinutricionais em maiores teores.
African Journals Online (AJOL)
P.O.Box 33381 , e-mail: shimelisemire@yahoc.com. Fax: (+251-1) .... The seeds of eight Phaseolus vulgaris L varieties were used in this study and were .... Approximately 20 g of cooked beans were loaded on the specimen holder of the. LLOYD>K (Fig. 1) in a single layer and compressed with a compressing plate to the. 6 ...
Application of nuclear energy to agriculture. Triennial report, July 1, 1972--June 30, 1975
International Nuclear Information System (INIS)
Moh, C.C.
1975-01-01
Progress is reported on the following research projects: mutation breeding in cassava (Manihot esculenta) using gamma radiation; mutation breeding in beans (Phaseolus vulgaris); 14 C tracer studies on photosynthesis in the cassava leaf, translocations of 14 C after assimilation of 14 CO 2 , and metabolic fate of translocated photosynthetic carbon; and collection of rainfall for fallout analysis. (U.S.)
1990-08-01
2.2 2.2 SOIL CHARACTERIZATION AND SAMPLING ............................................. 2.7 2.3 PLANT CULTIVATION ...cycle. 2.3 Plant Cultivation and Samoling The chemical fate of RDX in plants was evaluated using bush beans K (Phaseolus vulgaris), wheat (Triticum...particularly in light of the high tissue concentrations observed, may be important from the standpoint of food-chain transfer and ecotoxicology
Safety testing of GM-rice expressing PHA-E lectin using a new animal test design
DEFF Research Database (Denmark)
Poulsen, Morten; Schrøder, Malene; Wilcks, Andrea
2007-01-01
The 90-day animal study is the core study for the safety assessment of genetically modified foods in the SAFOTEST project. The model compound tested in the 90-day study was a rice variety expressing the kidney bean Phaseolus vulgaris lectin agglutinin E-form (PHA-E lectin). Female Wistar rats were...... safety testing of genetically modified foods....