WorldWideScience

Sample records for pbi

  1. Ultrathin metallized PBI paper

    Science.gov (United States)

    Chenevey, E. C.

    1978-01-01

    A study to determine the feasibility of preparing ultrathin papers with a target weight of 3.5 g/m squared from polybenzimidazole (PBI) fibrids was undertaken. Small hand sheets of target weight were fabricated. They were light brown, low density materials with sufficient strength to be readily handleable. Characterization of these sheets included strength, fold endurance, thermal gravimetric analysis in air and nitrogen and photomicrographs. Two different batches of PBI fibrids were studied and differences in fabrication performance were noted. In neither case could target weight papers be prepared using conventional paper making techniques.

  2. Ultrafine PBI fibers and yarns

    Science.gov (United States)

    Leal, J. R.; Tan, M.

    1979-01-01

    Gentle precisely controlled process is used to draw polybenzimidazole (PBI) fibers to denier as low as 0.17 per fiber. Yarns of lightweight fibers could be useful in applications where lightweight textiles must withstand high temperatures, corrosion, or radiation.

  3. Ultralow denier polybenzimidazole (PBI) yarns

    Science.gov (United States)

    Tan, M.; Leal, J. R.

    1977-01-01

    A study to determine the feasibility of preparing ultralow denier polybenzimidazole (PBI) yarns was undertaken. Conditions that presently yield multifilament yarns with bundle deniers ranging from 75 to 15,000 were used as a baseline. From this starting point, process parameters were identified that give five filament yarns with yarn densiers as low as 0.80. Physical properties from such ultralow denier yarns were at levels that would permit subsequent fabrication into fabrics.

  4. Thermoactivation processes in PbI2:Zr and PbI2 crystals

    International Nuclear Information System (INIS)

    Panasyuk, M.R.; Kapustyanik, V.B.; Tsibul's'kij, V.S.; Dubov, Yu.G.; Pasternak, R.M.

    2007-01-01

    The X-ray luminescence, thermal emission and thermally stimulated depolarisation spectra as well as the influence of IR-illumination on the thermal emission and thermally stimulated depolarisation spectra of the PbI 2 :Zr and PbI 2 crystals have been studied. There were found the hole traps in the PbI 2 :Zr crystals that are absent in PbI 2 . For the observed traps the activation energy has been calculated. The mechanisms describing the traps' nature and that of thermally stimulated depolarisation currents have been proposed

  5. meta-PBI/methylated PBI-OO blend membranes for acid doped HT PEMFC

    DEFF Research Database (Denmark)

    Cho, Hyeongrae; Hur, Eun; Henkensmeier, Dirk

    2014-01-01

    Methylation of polybenzimidazole leads to positively charged polymer backbones, and moveable anions. Ion exchange of methylated PBI-OO in phosphoric acid (PA) shows that the resulting polymers dissolve. meta-PBI, however, absorbs about 400wt% PA while remaining a self supported membrane. We inves...

  6. Training Bilingual Educators at a PBI

    Science.gov (United States)

    Montes, Amanda Lira Gordenstein; Valenciano, Cynthia Kay; Fernandez, Miguel

    2018-01-01

    While Bilingual Education has traditionally been associated with linguistic diversity, the rise of the number of African-American teacher candidates in a Bilingual Education program at a mid-west Predominantly Black Institution (PBI) is causing the authors to reevaluate the input of this program's curriculum and the output of the candidates'…

  7. Flame retardant treatments of PBI fabric.

    Science.gov (United States)

    Temin, S. C.

    1972-01-01

    Fabrics knitted or woven from polybenzimidazole (PBI) fibers were treated to reduce flammability in oxygen atmospheres, particularly that of 5 psia oxygen. Bromination to approximately 15% weight gain of such fabrics led to markedly lower burning rates; samples brominated to over 80% weight gain were self-extinguishing in 5 psia oxygen. The loss in tensile strength of fabrics due to bromination was negligible although shrinkage was observed. Free fibers showed negligible losses on bromination. Treatment of PBI fabric with organophosphorus compounds also achieved self-extinguishing character in 5 psia oxygen but the enhanced flameproofing was largely lost on leaching. Reaction with POCl3 in pyridine led to a permanent reduction in flammability.

  8. Mathematical model of a PEMFC using a PBI membrane

    International Nuclear Information System (INIS)

    Cheddie, Denver; Munroe, Norman

    2006-01-01

    Proton exchange membrane fuel cells (PEMFC) operating with Nafion[reg] membranes have encountered numerous problems associated with water management and CO poisoning because of their low temperature of operation. Alternative high temperature membranes have been investigated, one such membrane being polybenzimidazole (PBI). This paper presents a one dimensional mathematical model, which predicts the polarization performance of a PEMFC using a PBI membrane. Peak power densities in the same order as Nafion[reg] are predicted. Results indicate that the greatest scope for improving PBI PEMFC performance is increasing the membrane conductivity and improving the catalyst performance as it interfaces with the PBI membrane

  9. Proton Conductivity and Operational Features Of PBI-Based Membranes

    DEFF Research Database (Denmark)

    Qingfeng, Li; Jensen, Jens Oluf; Precht Noyé, Pernille

    2005-01-01

    As an approach to high temperature operation of PEMFCs, acid-doped PBI membranes are under active development. The membrane exhibits high proton conductivity under low water contents at temperatures up to 200°C. Mechanisms of proton conduction for the membranes have been proposed. Based on the me...... on the membranes fuel cell tests have been demonstrated. Operating features of the PBI cell include no humidification, high CO tolerance, better heat utilization and possible integration with fuel processing units. Issues for further development are also discussed....

  10. Fabrication and characterization of solid PbI2 nanocrystals

    International Nuclear Information System (INIS)

    Kasi, Gopi K; Dollahon, Norman R; Ahmadi, Temer S

    2007-01-01

    Lead iodide nanoparticles are synthesized in reverse micelle solution of AOT/H 2 O/n-heptane. Optical absorption spectra and TEM analysis indicated the formation of crystalline particles with an average radius of 1.5 nm, which is less than the Bohr radius of the exciton (1.9 nm) in bulk PbI 2 . Using theoretical models and optical spectra of quantum confined PbI 2 nanoparticles, a radius of 1.5 nm and a thickness of 1.7 nm was calculated, which are in full agreement with the TEM results. Particles were isolated from the dispersed medium and were analysed by powder XRD and Raman spectroscopy, indicating the formation of a predominantly 2H-PbI 2 polytype. This work presents the first case of fully isolated, fully characterized solid nanoparticles of PbI 2 . It also presents XRD and Raman spectrum for the first time for PbI 2 nanoparticles of intermediate quantum confinement

  11. Fabrication of radiation detector using PbI2 crystals

    International Nuclear Information System (INIS)

    Shoji, T.; Ohba, K.; Suehiro, T.; Hiratate, Y.

    1995-01-01

    Radiation detectors have been fabricated from lead iodide (PbI 2 ) crystals grown by two methods: zone melting and Bridgman methods. In response characteristics of the detector fabricated from crystals grown by the zone melting method, a photopeak for γ-rays from an 241 Am source (59.5 KeV) has been clearly observed with applied detector bias of 500 V at room temperature. The hole drift mobility is estimated to be about 5.5 cm 2 /Vs from measurement of pulse rise time for 5.48 MeV α-rays from 241 Am. By comparing the detector bias versus saturated peak position of the PbI 2 detector with that of CdTe detector, the average energy for producing electron-hole pairs is estimated to be about 8.4 eV for the PbI 2 crystal. A radiation detector fabricated from PbI 2 crystals grown by the Bridgman method, however, exhibited no response for γ-rays

  12. Investigation on thermal evaporated CH3NH3PbI3 thin films

    Directory of Open Access Journals (Sweden)

    Youzhen Li

    2015-09-01

    Full Text Available CH3NH3I, PbI2 and CH3NH3PbI3 films were fabricated by evaporation and characterized with X-ray Photoelectron Spectroscopy (XPS and X-ray diffraction (XRD. The XPS results indicate that the PbI2 and CH3NH3PbI3 films are more uniform and stable than the CH3NH3I film. The atomic ratio of the CH3NH3I, PbI2 and CH3NH3PbI3 films are C:N:I=1.00:1.01:0.70, Pb:I= 1.00:1.91 and C: N: Pb: I = 1.29:1.07:1.00:2.94, respectively. The atomic ratio of CH3NH3PbI3 is very close to that of the ideal perovskite. Small angle x-ray diffraction results demonstrate that the as evaporated CH3NH3PbI3 film is crystalline. The valence band maximum (VBM and work function (WF of the CH3NH3PbI3 film are about 0.85eV and 4.86eV, respectively.

  13. Luminescence and photosensitivity of PbI2 crystals

    International Nuclear Information System (INIS)

    Novosad, S.S.; Novosad, I.S.; Matviishin, I.M.

    2002-01-01

    One studied effect of temperature treatment and storage conditions on spectra features of PbI 2 crystals grown by the Bridgman-Stockbarger method from salt additionally purified by directed crystallization. Spectra of X-ray luminescence, photoluminescence and thermostimulated luminescence were investigated within 85-295 K temperature range under stationary X-ray excitation and emission of N 2 -laser. One studied photoelectret properties of those crystals under 85 K. Luminescence of PbI 2 crystals with maximum within 595 nm region observed following their thermal annealing under 475-495 K temperature and typical for near-the-surface section of specimens may be caused by oxygen-containing centres [ru

  14. [Partial breast irradiation (PBI): the therapy of the future?].

    Science.gov (United States)

    Koning, Caro C E; Bijker, Nina; van Tienhoven, Geertjan

    2010-01-01

    Breast-conserving therapy with radiation therapy of 50 Gy over 5 weeks to the entire breast plus a tumour bed boost is the standard treatment for patients with early stage breast cancer. Several attempts have been made to lower the treatment burden, such as omitting either all radiotherapy or the tumour bed boost, without success. Phase III trials are now being carried out to evaluate the treatment of the primary tumour area only (PBI). Various methods for selection of patient groups and of delivering the radiation dose have been employed. Vaidya et al. report the same favourable local recurrence rates following PBI with single dose intraoperative radiotherapy as with whole-breast irradiation. As the follow-up period so far has been short, long-time results should be awaited.

  15. Phosphoric acid doped AB-PBI membranes and its applications in high temperature PEMFC

    DEFF Research Database (Denmark)

    He, Ronghuan; Qingfeng, Li; Bjerrum, Niels

    2005-01-01

    Poly(2,5-benzimidazole) (ab-PBI) was prepared from 3,4-diaminobenzoic acid via a polymerisation reaction. The obtained polymer exhibits excellent thermal stability in a temperature range ….. The membrane of ab-PBI when doped with phosphoric acid at room temperaturepresents high proton conductivity...

  16. Systems of Rb2I2-CdI2-PbI2 and Cs2I2-CdI2-PbI2

    International Nuclear Information System (INIS)

    Volchanskaya, V.V.; Il'yasov, I.I.

    1979-01-01

    The Rb 2 I 2 -CdI 2 -PbI 2 and Cs 2 I 2 -CdI 2 -PbI 2 triple systems have been studied, using the visual-polythermal method. The liquidus of the systems researched consists of the components and compounds crystallization fields: 2RbIxCdI 2 , 2RbIxRbI 2 , RbIxPbI 2 and 2CsIxCdI 2 , 4CsIxPbI 2 , CsIxPbI 2 , respectively. The crystallization fields converge in four non-variant points at 360, 280, 205 and 192 deg C in the Rb 2 I 2 -CdI 2 -PbI 2 system and at 375, 368, 208 and 190 deg C in the CsI 2 -CdI 2 -PbI 2 system

  17. Parametric investigation to enhance the performance of a PBI-based high-temperature PEMFC

    International Nuclear Information System (INIS)

    Ferng, Y.M.; Su, A.; Hou, J.

    2014-01-01

    Highlights: • A in-house PBI PEMFC is prepared by the Fuel Cell Center of Yuan Ze University. • Parametric effects to enhance the PBI based PEMFC performance are investigated. • Experiments and simulations are performed to study these parametric effects. • Cell performance is enhanced with the lower PBI loading and higher temperature. • Thinner CL thickness and higher acid doping benefit to the cell performance also. - Abstract: With the advantages of simpler heat and water management, lower CO poisoning, and higher reaction kinetics, the high-temperature polybenzimidazole (PBI)-based proton exchange membrane fuel cell (PEMFC) can be considered as one of the commercialized energy generators in the near future. This paper experimentally and analytically investigates different design and operating parameters to enhance the performance of a PBI-based PEMFC, an in-house cell prepared in the Fuel Cell Center of Yuan Ze University. These parameters studied include PBI loading, operating temperature, gas flowrate, electrode thickness and porosity, and acid doping level. Experiments are performed to study the effects of PBI loading, operating temperature, and gas flowrate on the cell performance. Validated against the measured data of polarization and power curves, a simplified two-dimensional model for this PBI-based PEMFC is also developed to help the experiments to investigate other parameters. Based on the experimental data and the model predictions, the cell performance can be enhanced as the PBI loading is reduced, the operating temperature is elevated. Thinner electrode thickness, smaller porosity, and higher acid doping level are also predicted to benefit to the performance of the PBI-based PEMFC

  18. Controlling Photoconductivity in PBI Films by Supramolecular Assembly.

    Science.gov (United States)

    Draper, Emily R; Archibald, Lewis J; Nolan, Michael C; Schweins, Ralf; Zwijnenburg, Martijn A; Sproules, Stephen; Adams, Dave J

    2018-03-15

    Perylene bisimides (PBIs) self-assemble in solution. The solubility of the PBIs is commonly changed through the choice of substituents at the imide positions. It is generally assumed this substitution does not affect the electronic properties of the PBI, and that the properties of the self-assembled aggregate are essentially that of the isolated molecule. However, substituents do affect the self-assembly, resulting in potentially different packing in the formed aggregates. Here, we show that the photoconductivity of films formed from a library of substituted PBIs varies strongly with the substituent and demonstrate that this is due to the different ways in which they pack. Our results open the possibility for tuning the optoelectronic properties of self-assembled PBIs by controlling the aggregate structure through careful choice of substituent, as demonstrated by us here optimising the photoconductivity of PBI films in this way. © 2018 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

  19. Mechanical Stability of H3PO4-Doped PBI/Hydrophilic-Pretreated PTFE Membranes for High Temperature PEMFCs

    International Nuclear Information System (INIS)

    Park, Jaehyung; Wang, Liang; Advani, Suresh G.; Prasad, Ajay K.

    2014-01-01

    Graphical abstract: - Highlights: • PBI/PTFE membrane was prepared by porous PTFE with hydrophilic surface pretreatment. • The durability of the prepared PBI/PTFE membrane was compared with pure PBI, PBI with untreated PTFE, and PBI-Nafion with untreated PTFE membranes. • Accelerated durability tests and SEM showed improved durability based the PBI/PTFE membrane with pretreated PTFE. - Abstract: A novel polybenzimidazole (PBI)/poly(tetrafluoroethylene) (PTFE) composite membrane doped with phosphoric acid was fabricated for high temperature operation in a polymer electrolyte membrane (PEM) fuel cell. A hydrophilic surface pretreatment was applied to the porous PTFE matrix film to improve its interfacial adhesion to the PBI polymer, thereby avoiding the introduction of Nafion ionomer which is traditionally used as a coupling agent. The pretreated PTFE film was embedded within the composite membrane during solution-casting using 5wt% PBI/DMAc solution. The mechanical stability and durability of three types of MEAs assembled with PBI only, PBI with pretreated PTFE, and PBI-Nafion with untreated PTFE membranes were evaluated under an accelerated degradation testing protocol employing extreme temperature cycling. Degradation was characterized by recording polarization curves, hydrogen crossover, and proton resistance. Cross-sections of the membranes were examined before and after thermal cycling by scanning electron microscope. Energy-dispersive X-ray spectroscopy verified that the PBI is dispersed homogeneously in the porous PTFE matrix. Results show that the PBI composite membrane with pretreated PTFE has a lower degradation rate than the Nafion/PBI membrane with untreated PTFE. Thus, the hydrophilic pretreatment employed here greatly improved the mechanical stability of the composite membrane, which resulted in improved durability under an extreme thermal cycling regime

  20. Enhancement of Th1 type cytokine production and primary T cell activation by PBI-1393.

    Science.gov (United States)

    Allam, Mustapha; Julien, Nathalie; Zacharie, Boulos; Penney, Christopher; Gagnon, Lyne

    2007-12-01

    In previous reports, we have shown that PBI-1393 (formerly BCH-1393), N,N-Dimethylaminopurine pentoxycarbonyl D-arginine, stimulates cytotoxic T-lymphocyte (CTL) responses both in vitro and in vivo in normal immune status and immunosuppressed mice. Additionally, PBI-1393 was tested for anticancer activity in syngeneic mouse experimental tumor models and it displayed significant inhibition of tumor outgrowths when given in combination with sub-therapeutic doses of cytotoxic drugs (cyclophosphamide, 5-fluorouracil, doxorubicin and cis-platinum). However, the mechanism of action of PBI-1393 was still unknown. Here, we report that PBI-1393 enhances IL-2 and IFN-gamma production in human activated T cells by 51% and 46% respectively. PBI-1393 increases also IL-2 and IFN-gamma mRNA expression as shown by RT-PCR. The physiological relevance of IL-2 and IFN-gamma gene modulation by PBI-1393 is illustrated by the advantageous increase of T cell proliferation (39+/-0.3% above control) and human CTL response against prostate (PC-3) cancer cells (42+/-0.03%). The enhancement of human T cell proliferation and CTL activation by PBI-1393 demonstrates that this compound potentiates the immune response and in this regard, it could be used as an alternative approach to IL-2 and/or IFN-gamma therapy against cancer.

  1. Thermal curing of PBI membranes for high temperature PEM fuel cells

    DEFF Research Database (Denmark)

    Aili, David; Cleemann, Lars N.; Li, Qingfeng

    2012-01-01

    (MEAs) is currently hampering the commercial viability of the technology. In the present study, thermoset PBI membranes were prepared by curing the membranes under inert atmosphere at temperatures of up to 350 °C prior to the acid doping. The systematic membrane characterizations with respect...... to solubility, phosphoric acid doping, radical-oxidative resistance and mechanical strength indicated that the PBI membranes were irreversibly cured by the thermal treatment. After curing, the PBI membranes demonstrated features that are fundamental characteristics of a thermoset resin including complete...

  2. CH3NH3PbI3 based solar cell: Modified by antisolvent treatment

    Science.gov (United States)

    Nandi, Pronoy; Giri, Chandan; Bansode, Umesh; Topwal, D.

    2017-05-01

    Solar cells based on new class of organic inorganic hybrid perovskite CH3NH3PbI3 were prepared by Ethyl acetate (EA); antisolvent treatment for the first time. This treatment results in new morphology for CH3NH3PbI3 thin film. FESEM image shows microrod type structures of CH3NH3PbI3 after EA antisolvent treatment. Energy band diagram was constructed using photoluminescence and photoemission studies. A better power conversion efficiency was achieved in EA treated film compare to without EA treated film.

  3. Partially fluorinated aarylene polyethers and their ternary blends with PBI and H3PO4

    DEFF Research Database (Denmark)

    Li, Qingfeng; Jensen, Jens Oluf; Pan, Chao

    2008-01-01

    Ternary blend membranes based on sulphonated partially fluorinated arylene polyether, polybenzimidazole (PBI) and phosphoric acid were prepared and characterised as electrolyte for high temperature proton exchange membrane fuel cells. Partially fluorinated arylene polyether was first prepared from...

  4. Roll-to-roll coated PBI membranes for high temperature PEM fuel cells

    DEFF Research Database (Denmark)

    Steenberg, Thomas; Hjuler, Hans Aage; Terkelsen, Carina

    2012-01-01

    We employed roll-to-roll coating in the preparation of 40 μm thick poly[2,2′(m-phenylene)-5,5′bibenzimidazole] (PBI) films for fuel cells using both knife-coating (KC) and slot-die (SD) coating. The films were coated directly from a 9% (w/w) solution of PBI in dimethylacetamide onto a sacrificial...

  5. Optical monitoring of CH3NH3PbI3 thin films upon atmospheric exposure

    International Nuclear Information System (INIS)

    Ghimire, Kiran; Zhao, Dewei; Cimaroli, Alex; Ke, Weijun; Yan, Yanfa; Podraza, Nikolas J

    2016-01-01

    CH 3 NH 3 PbI 3 perovskite films of interest for photovoltaic (PV) devices have been prepared by (i) vapor deposition and (ii) solution processing. Complex dielectric function ( ε   =   ε 1   +  i ε 2 ) spectra and structural parameters of the films have been extracted using near infrared to ultraviolet spectroscopic ellipsometry. In situ real time spectroscopic ellipsometry (RTSE) over a 48 h period has been performed on vapor deposited CH 3 NH 3 PbI 3 after the deposition in normal atmospheric laboratory ambient conditions. Analysis of RTSE data for vapor deposited CH 3 NH 3 PbI 3 film prepared under un-optimized conditions identifies phase segregated PbI 2 and CH 3 NH 3 I at the substrate/film interface and unreacted PbI 2 and CH 3 NH 3 I on the film surface. This analysis also provides the time dependence of the effective thicknesses of perovskite film, unreacted components, and phase segregated layers to track CH 3 NH 3 PbI 3 decomposition. (paper)

  6. CH3 NH3 PbI3 and HC(NH2 )2 PbI3 Powders Synthesized from Low-Grade PbI2 : Single Precursor for High-Efficiency Perovskite Solar Cells.

    Science.gov (United States)

    Zhang, Yong; Kim, Seul-Gi; Lee, Do-Kyoung; Park, Nam-Gyu

    2018-05-09

    High-efficiency perovskite solar cells are generally fabricated by using highly pure (>99.99 %) PbI 2 mixed with an organic iodide in polar aprotic solvents. However, the use of such an expensive chemical may impede progress toward large-scale industrial applications. Here, we report on the synthesis of perovskite powders by using inexpensive low-grade (99 %) PbI 2 and on the photovoltaic performance of perovskite solar cells prepared from a powder-based single precursor. Pure APbI 3 [A=methylammonium (MA) or formamidinium (FA)] perovskite powders were synthesized by treating low-grade PbI 2 with MAI or FAI in acetonitrile at ambient temperature. The structural phase purity was confirmed by X-ray diffraction. The solar cell with a MAPbI 3 film prepared from the synthesized perovskite powder demonstrated a power conversion efficiency (PCE) of 17.14 %, which is higher than the PCE of MAPbI 3 films prepared by using both MAI and PbI 2 as precursors (PCE=13.09 % for 99 % pure PbI 2 and PCE=16.39 % for 99.9985 % pure PbI 2 ). The synthesized powder showed better absorption and photoluminescence, which were responsible for the better photovoltaic performance. For the FAPbI 3 powder, a solution with a yellow non-perovskite δ-FAPbI 3 powder synthesized at room temperature was found to lead to a black perovskite film, whereas a solution with the black perovskite α-FAPbI 3 powder synthesized at 150 °C was not transformed into a black perovskite film. The α↔δ transition between the powder and film was assumed to correlate with the difference in the iodoplumbates in the powder-dissolved solution. An average PCE of 17.21 % along with a smaller hysteresis [ΔPCE=PCE reverse -PCE forward )=1.53 %] was demonstrated from the perovskite solar cell prepared by using δ-FAPbI 3 powder; this PCE is higher than the average PCE of 17.05 % with a larger hysteresis (ΔPCE=2.71 %) for a device based on a conventional precursor solution dissolving MAI with high

  7. Prediction on electronic structure of CH3NH3PbI3/Fe3O4 interfaces

    Science.gov (United States)

    Hou, Xueyao; Wang, Xiaocha; Mi, Wenbo; Du, Zunfeng

    2018-01-01

    The interfacial electronic structures of CH3NH3PbI3(MAPbI3)/Fe3O4 heterostructures are predicted by density functional theory. Four models (MAI/FeBO, PbI2/FeBO, MAI/FeA and PbI2/FeA) are included. Especially, a half-metal to semiconductor transition of Fe3O4 appears in PbI2/FeA model. A series of electric field is added to PbI2/FeA model, and a direct-indirect bandgap transition of Fe3O4 appears at a 500-kV/cm field. The electric field can control the bandgap of Fe3O4 in PbI2/FeA model by modulating the hybridization. The prediction of spin-related bandgap characteristic in MAPbI3/Fe3O4 is meaningful for further study.

  8. Thin-Film Transformation of NH4 PbI3 to CH3 NH3 PbI3 Perovskite: A Methylamine-Induced Conversion-Healing Process.

    Science.gov (United States)

    Zong, Yingxia; Zhou, Yuanyuan; Ju, Minggang; Garces, Hector F; Krause, Amanda R; Ji, Fuxiang; Cui, Guanglei; Zeng, Xiao Cheng; Padture, Nitin P; Pang, Shuping

    2016-11-14

    Methylamine-induced thin-film transformation at room-temperature is discovered, where a porous, rough, polycrystalline NH 4 PbI 3 non-perovskite thin film converts stepwise into a dense, ultrasmooth, textured CH 3 NH 3 PbI 3 perovskite thin film. Owing to the beneficial phase/structural development of the thin film, its photovoltaic properties undergo dramatic enhancement during this NH 4 PbI 3 -to-CH 3 NH 3 PbI 3 transformation process. The chemical origins of this transformation are studied at various length scales. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Fabrication of CH3NH3PbI3/PVP Composite Fibers via Electrospinning and Deposition

    Science.gov (United States)

    Chao, Li-Min; Tai, Ting-Yu; Chen, Yueh-Ying; Lin, Pei-Ying; Fu, Yaw-Shyan

    2015-01-01

    In our study, one-dimensional PbI2/polyvinylpyrrolidone (PVP) composition fibers have been prepared by using PbI2 and PVP as precursors dissolved in N,N-dimethylformamide via a electrospinning process. Dipping the fibers into CH3NH3I solution changed its color, indicating the formation of CH3NH3PbI3, to obtain CH3NH3PbI3/PVP composite fibers. The structure, morphology and composition of the all as-prepared fibers were characterized by using X-ray diffraction and scanning electron microscopy. PMID:28793517

  10. Fabrication of CH3NH3PbI3/PVP Composite Fibers via Electrospinning and Deposition

    Directory of Open Access Journals (Sweden)

    Li-Min Chao

    2015-08-01

    Full Text Available In our study, one-dimensional PbI2/polyvinylpyrrolidone (PVP composition fibers have been prepared by using PbI2 and PVP as precursors dissolved in N,N-dimethylformamide via a electrospinning process. Dipping the fibers into CH3NH3I solution changed its color, indicating the formation of CH3NH3PbI3, to obtain CH3NH3PbI3/PVP composite fibers. The structure, morphology and composition of the all as-prepared fibers were characterized by using X-ray diffraction and scanning electron microscopy.

  11. PBI creams: a spontaneously mutated mouse strain showing wild animal-type reactivity.

    Science.gov (United States)

    Hendrie, C A; Van Driel, K S; Talling, J C; Inglis, I R

    2001-01-01

    PBI creams are mice derived from warfarin-resistant wild stock that has been maintained under laboratory conditions since the 1970s. This study compares their behaviour to that of laboratory mice and wild house and wood mice. Animals were tested in a black/white box and a 2.64x1.4 m runway. In the black/white box, the behaviour of PBI creams was not significantly different from that of house mice and differed most from that of laboratory mice. Notably, the PBI creams showed the greatest activity and escape-orientated behaviours. When animals were approached by the experimenter in the open runway test, the PBI creams had higher flight speeds than both house and wood mice, whilst laboratory mice failed to respond. In the closed runway test where the animals could not escape, the PBI creams, house mice and wood mice all turned and attempted to run past the approaching experimenter, whilst the laboratory mice again failed to react. At the end of this test session, the time taken to catch each animal was recorded. It took less than 5 s to catch laboratory mice but significantly longer to catch the wild strains and the PBI creams (90-100 s for the latter). In these tests, the PBI creams showed wild animal-type reactivity, and as this behaviour has been retained in the laboratory colony for over 30 years, these animals may be useful in the study of the physiological and genetic basis of fear/anxiety in mice.

  12. The energy level alignment at the CH_3NH_3PbI_3/pentacene interface

    International Nuclear Information System (INIS)

    Ji, Gengwu; Zhao, Bin; Song, Fei; Zheng, Guanhaojie; Zhang, Xiaonan; Shen, Kongchao; Yang, Yingguo; Chen, Shi; Gao, Xingyu

    2017-01-01

    Highlights: • The Energy Level Alignment at the CH_3NH_3PbI_3/Pentacene Interface was resolved experimentally. • The downward band bending and the dipole found at the pentacene side would favorably drive holes away from the interface into pentacene. • A ∼0.7 eV offset between pentacene HOMO and CH_3NH_3PbI_3 VBM would be in favor of hole transfer whereas a ∼1.35 eV offset between pentacene LUMO and CH_3NH_3PbI_3 CBM should efficiently block the unwanted electron transfer from perovskite to pentacene. • Pentacene could be a viable hole transfer material candidate on perovskite to be explored in perovskite devices. - Abstract: Pentacene thin film on CH_3NH_3PbI_3 was studied by in-situ X-ray photoelectron spectroscopy and ultraviolet photoelectron spectroscopy to determine their interfacial energy level alignment. A 0.2 eV downward band bending together with a 0.1 eV interfacial dipole was found at the pentacene side, whereas there was no band bending found at the CH_3NH_3PbI_3 side. The offset between CH_3NH_3PbI_3 Valance Band Maximum (VBM) and pentacene Highest Occupied Molecular Orbital (HOMO) and that between CH_3NH_3PbI_3 Conduction Band Minimum (CBM) and pentacene Lowest Unoccupied Molecular Orbital (LUMO) was determined to be 0.7 and 1.35 eV, respectively. The band alignment at this interface is favor of efficient hole transfer, which suggests pentacene as a viable HTL candidate to be explored in perovskite solar cells.

  13. Photoelectric characteristics of CH3NH3PbI3/p-Si heterojunction

    Science.gov (United States)

    Yamei, Wu; Ruixia, Yang; Hanmin, Tian; Shuai, Chen

    2016-05-01

    Organic-inorganic hybrid perovskite CH3NH3PbI3 film is prepared on p-type silicon substrate using the one-step solution method to form a CH3NH3PbI3/p-Si heterojunction. The film morphology and structure are characterized by atomic force microscopy (AFM) and scanning electron microscopy (SEM). The photoelectric properties of the CH3NH3PbI3/p-Si heterojunction are studied by testing the current-voltage (I-V) with and without illumination and capacitance-voltage (C-V) characteristics. It turns out from the I-V curve without illumination that the CH3NH3PbI3/p-Si heterojunction has a rectifier feature with the rectification ratio over 70 at the bias of ±5 V. Also, there appears a photoelectric conversion phenomenon on this heterojunction with a short circuit current (Isc) of 0.16 μA and an open circuit voltage (Voc) of about 10 mV The high frequency C-V characteristic of the Ag/CH3NH3PbI3/p-Si heterojunction turns out to be similar to that of the metal-insulator-semiconductor (MIS) structure, and a parallel translation of the C-V curve along the forward voltage axis is found. This parallel translation means the existence of defects at the CH3NH3PbI3/p-Si interface and positive fixed charges in the CH3NH3PbI3 layer. The defects at the interface of the CH3NH3PbI3/p-Si heterojunction result in the dramatic decline of the Voc. Besides, the C-V test of CH3NH3PbI3 film shows a non-linear dielectric property and the dielectric value is about 4.64 as calculated. Project supported by the Hebei Province Natural Science Foundation of China (No. F2014202184) and the Tianjin Natural Science Foundation of China (No. 15JCZDJC37800).

  14. Novel composite Zr/PBI-O-PhT membranes for HT-PEFC applications.

    Science.gov (United States)

    Kondratenko, Mikhail S; Ponomarev, Igor I; Gallyamov, Marat O; Razorenov, Dmitry Yu; Volkova, Yulia A; Kharitonova, Elena P; Khokhlov, Alexei R

    2013-01-01

    Novel composite membranes for high temperature polymer-electrolyte fuel cells (HT-PEFC) based on a poly[oxy-3,3-bis(4'-benzimidazol-2″-ylphenyl)phtalide-5″(6″)-diyl] (PBI-O-PhT) polymer with small amounts of added Zr were prepared. It was shown in a model reaction between zirconium acetylacetonate (Zr(acac)4) and benzimidazole (BI) that Zr-atoms are capable to form chemical bonds with BI. Thus, Zr may be used as a crosslinking agent for PBI membranes. The obtained Zr/PBI-O-PhT composite membranes were examined by means of SAXS, thermomechanical analysis (TMA), and were tested in operating fuel cells by means of stationary voltammetry and impedance spectroscopy. The new membranes showed excellent stability in a 2000-hour fuel cell (FC) durability test. The modification of the PBI-O-PhT films with Zr facilitated an increase of the phosphoric acid (PA) uptake by the membranes, which resulted in an up to 2.5 times increased proton conductivity. The existence of an optimal amount of Zr content in the modified PBI-O-PhT film was shown. Larger amounts of Zr lead to a lower PA doping level and a reduced conductivity due to an excessively high degree of crosslinking.

  15. Exceptional durability enhancement of PA/PBI based polymer electrolyte membrane fuel cells for high temperature operation at 200°C

    DEFF Research Database (Denmark)

    Aili, David; Zhang, Jin; Jakobsen, Mark Tonny Dalsgaard

    2016-01-01

    The incorporation of phosphotungstic acid functionalized mesoporous silica in phosphoric acid doped polybenzimidazole (PA/PBI) substantially enhances the durability of PA/PBI based polymer electrolyte membrane fuel cells for high temperature operation at 200°C.......The incorporation of phosphotungstic acid functionalized mesoporous silica in phosphoric acid doped polybenzimidazole (PA/PBI) substantially enhances the durability of PA/PBI based polymer electrolyte membrane fuel cells for high temperature operation at 200°C....

  16. Structural study on cubic-tetragonal transition of CH3NH3PbI3

    International Nuclear Information System (INIS)

    Kawamura, Yukihiko; Mashiyama, Hiroyuki; Hasebe, Katsuhiko

    2002-01-01

    The cubic-tetragonal phase transition of CH 3 NH 3 PbI 3 was investigated by single crystal X-ray diffractometry. The crystal structure was refined at five temperatures in the tetragonal phase. The PbI 6 octahedron rotates around the c-axis alternatively to construct the SrTiO 3 -type tetragonal structure. A methylammonium ion is partially ordered; 24 disordered states in the cubic phase are reduced to 8. With decreasing temperature, the rotation angle of the octahedron increases monotonically, which indicates it is an order parameter of the cubic-tetragonal transition. (author)

  17. Recent advances in radiotherapy: Partial Breast Irradiation (PBI) in breast cancer patients after breast conserving surgery

    International Nuclear Information System (INIS)

    Niwinska, A.

    2003-01-01

    The interest in accelerated partial breast irradiation (PBI) after conservative surgery has increased over the past decade as a result of many factors, including clinical and pathological data questioning the efficacy of whole breast irradiation in highly selected patients, as well as factors related to patient's convenience. High dose rate and low dose rate brachytherapy, brachytherapy MammoSite, Electron Intraoperative Therapy - ELIOT and Targeted Intraoperative Radiotherapy - TARGIT are the subject of investigation. The tolerability and efficacy of the treatment are of special interest. In this review article, methods of accelerated PBI, eligibility criteria, techniques of radiotherapy, early results and side effects are reviewed. (author)

  18. Crystal growth and properties of PbI2 doped with Fe and Ni

    International Nuclear Information System (INIS)

    Rybak, O.V.; Lun', Yu.O.; Bordun, I.M.; Omelyan, M.F.

    2005-01-01

    A procedure is described for doping PbI 2 monocrystals with Fe and Ni during vapor-phase growth in a closed system in the presence of excess iodine. The rate of mass transfer in the system and the doping level of the crystals are shown to be governed by the dopant content in the source material and the source temperature. The effect of Fe and Ni doping on the low-temperature (5 K) exciton photoluminescence spectrum of PbI 2 is discussed [ru

  19. Using Low Temperature Photoluminescence Spectroscopy to Investigate CH3NH3PbI3 Hybrid Perovskite Degradation

    Directory of Open Access Journals (Sweden)

    Khaoula Jemli

    2016-07-01

    Full Text Available Investigating the stability and evaluating the quality of the CH3NH3PbI3 perovskite structures is quite critical both to the design and fabrication of high-performance perovskite devices and to fundamental studies of the photophysics of the excitons. In particular, it is known that, under ambient conditions, CH3NH3PbI3 degrades producing some PbI2. We show here that low temperature Photoluminescence (PL spectroscopy is a powerful tool to detect PbI2 traces in hybrid perovskite layers and single crystals. Because PL spectroscopy is a signal detection method on a black background, small PbI2 traces can be detected, when other methods currently used at room temperature fail. Our study highlights the extremely high stability of the single crystals compared to the thin layers and defects and grain boundaries are thought to play an important role in the degradation mechanism.

  20. Improved perovskite morphology and crystallinity using porous PbI2 layers for efficient planar heterojunction solar cells

    Science.gov (United States)

    Jia, Xianyu; Hu, Ziyang; Xu, Jie; Huang, Like; Zhang, Jing; Zhang, Jianjun; Zhu, Yuejin

    2017-12-01

    We demonstrate the flexible and facile use of porous PbI2 layers to fabricate high quality perovskite films with a dense surface and without residual PbI2. PbI2 precursor solutions by adding polystyrene pore-forming agents are first spin-coated to fabricate the wet film. A porous PbI2 layer is formed by washing off polystyrene using organic solvents. The porous PbI2 layer not only serves as a channel for transporting the CH3NH3I solution but also offers extremely enlarged contact areas, facilitating interfacial reaction with CH3NH3I. Shiny smooth perovskite films with excellent electronic quality and solar cells with an efficiency up to 17% are obtained.

  1. Effect of PbI2 deposition rate on two-step PVD/CVD all-vacuum prepared perovskite

    International Nuclear Information System (INIS)

    Ioakeimidis, Apostolos; Christodoulou, Christos; Lux-Steiner, Martha; Fostiropoulos, Konstantinos

    2016-01-01

    In this work we fabricate all-vacuum processed methyl ammonium lead halide perovskite by a sequence of physical vapour deposition of PbI 2 and chemical vapour deposition (CVD) of CH 3 NH 3 I under a static atmosphere. We demonstrate that for higher deposition rate the (001) planes of PbI 2 film show a higher degree of alignment parallel to the sample's surface. From X-ray diffraction data of the resulted perovskite film we derive that the intercalation rate of CH 3 NH 3 I is fostered for PbI 2 films with higher degree of (001) planes alignment. The stoichiometry of the produced perovskite film is also studied by Hard X-ray photoelectron spectroscopy measurements. Complete all-vacuum perovskite solar cells were fabricated on glass/ITO substrates coated by an ultra-thin (5 nm) Zn-phthalocyanine film as hole selective layer. A dependence of residual PbI 2 on the solar cells performance is displayed, while photovoltaic devices with efficiency up to η=11.6% were achieved. - Graphical abstract: A two-step PVD/CVD processed perovskite film with the CVD intercalation rate of CH 3 NCH 3 molecules been fostered by increasing the PVD rate of PbI 2 and prolonging the CVD time. - Highlights: • A simple PVD/CVD process for perovskite film production. • Increased PVD rate yields better alignment of the PbI 2 (001) crystallite planes. • CH 3 NH 3 I intercalation process fostered by increased PbI 2 PVD rate. • Stoichiometric CH 3 NH 3 PbI 3 suitable as absorber in photovoltaic applications • Reduced PbI 2 residue at the bottom of CH 3 NH 3 PbI 3 improves device performance.

  2. Automated Transportation Management System (ATMS) V2.0 logistics module PBI acceptance criteria

    International Nuclear Information System (INIS)

    Weidert, R.S.

    1995-01-01

    This document defines the acceptance criteria for the Automated Transportation Management System V2.0 Logistics Module Performance Based Incentive (PBI). This acceptance criteria will be the primary basis for the generation of acceptance test procedures. The purpose of this document is to define the minimum criteria that must be fulfilled to guarantee acceptance of the Logistics Module

  3. Electronic and optical properties of bilayer PbI2: a first-principles study

    Science.gov (United States)

    Shen, Chenhai; Wang, Guangtao

    2018-01-01

    By employing first-principles methods, we investigate the effects of stacking patterns and interlayer coupling on the electronic structures and optical properties of bilayer (BL) PbI2. For optical properties, excitonic effects are considered. The results show that crystal-type BL PbI2 stacking pattern is the most stable bilayer structures with the equilibrium interlayer distance of 3.27 Å and a direct band structure. Moreover, for all considered patterns, the interlayer coupling can induce the band structures to transform from indirect to direct and also the band gap values to vary from 2.56 eV to 2.62 eV. In addition, our calculations show that the exciton binding energy of the most stable pattern is 0.81 eV, and excitonic effects have obvious influences on optical responses of BL PbI2. These results may be useful to future experimental studies on optoelectronic properties of two-dimensional BL PbI2 nanosheets.

  4. Preparation of porous carbon nanofibers derived from PBI/PLLA for supercapacitor electrodes.

    Science.gov (United States)

    Jung, Kyung-Hye; Ferraris, John P

    2016-10-21

    Porous carbon nanofibers were prepared by electrospinning blend solutions of polybenzimidazole/poly-L-lactic acid (PBI/PLLA) and carbonization. During thermal treatment, PLLA was decomposed, resulting in the creation of pores in the carbon nanofibers. From SEM images, it is shown that carbon nanofibers had diameters in the range of 100-200 nm. The conversion of PBI to carbon was confirmed by Raman spectroscopy, and the surface area and pore volume of carbon nanofibers were determined using nitrogen adsorption/desorption analyses. To investigate electrochemical performances, coin-type cells were assembled using free-standing carbon nanofiber electrodes and ionic liquid electrolyte. cyclic voltammetry studies show that the PBI/PLLA-derived porous carbon nanofiber electrodes have higher capacitance due to lower electrochemical impedance compared to carbon nanofiber electrode from PBI only. These porous carbon nanofibers were activated using ammonia for further porosity improvement and annealed to remove the surface functional groups to better match the polarity of electrode and electrolyte. Ragone plots, correlating energy density with power density calculated from galvanostatic charge-discharge curves, reveal that activation/annealing further improves energy and power densities.

  5. Convergent validity of the dimensions underlying the parental bonding instrument (PBI) and the EMBU

    NARCIS (Netherlands)

    Arrindell, W.A.; Gerlsma, C.; Vandereycken, W.; Hageman, W.J J M; Daeseleire, T

    It has been suggested that the major dimensions of perceived parental rearing behaviour that underlie the EMBU (Emotional Warmth, Rejection and Protection) and the PBI (Care and Protection) may be considered parallel tests of the same constructs. Empirical findings however to back up this allegation

  6. Probing interfacial electronic properties of graphene/CH3NH3PbI3 heterojunctions: A theoretical study

    Science.gov (United States)

    Hu, Jisong; Ji, Gepeng; Ma, Xinguo; He, Hua; Huang, Chuyun

    2018-05-01

    Interfacial interactions and electronic properties of graphene/CH3NH3PbI3 heterojunctions were investigated by first-principles calculations incorporating semiempirical dispersion-correction scheme to describe van der Waals interactions. Two lattice match configurations between graphene and CH3NH3PbI3(0 0 1) slab were constructed in parallel contact and both of them were verified to form remarkable van der Waals heterojunctions with similar work functions. Our calculated energy band structures show that the Dirac-cone of graphene and the direct band gap of CH3NH3PbI3 are still preserved in the heterojunctions, thus graphene can be a promising candidate either as a capping or supporting layer for encapsulating CH3NH3PbI3 layer. It is identified that the Schottky barrier of graphene/CH3NH3PbI3 heterojunctions can be controlled by the interlayer distance and affected by the stacking pattern of graphene and CH3NH3PbI3. The 3D charge density differences present the build-in internal electric field from graphene to CH3NH3PbI3 after interface equilibrium and thus, a low n-type Schottky barrier is needed for high efficient charge transferring in the interface. The possible mechanism of the band edge modulations in the heterojunctions and corresponding photoinduced charge transfer processes are also described.

  7. Patient benefit index (PBI) in the treatment of psoriasis--results of the National Care Study "PsoHealth".

    Science.gov (United States)

    Radtke, Marc Alexander; Schäfer, Ines; Blome, Christine; Augustin, Matthias

    2013-04-01

    Psoriasis vulgaris is a common disease that follows a chronic course. So far, few studies have addressed outcome methods which evaluate the benefits of drugs and medical devices by measuring patient preferences. Assessment of patients' outcomes using the "Patient benefit index" (PBI), a validated goal attainment scaling tool, in the treatment of psoriasis. Data were obtained within an epidemiological study in 2,009 patients with psoriasis vulgaris and/or psoriatic arthritis. Cross-sectional study in 133 nationwide German dermatological practices and hospital departments. The following were recorded a) in the doctors' questionnaire--previous treatments and diseases, clinical characteristics and psoriasis area and severity index (PASI), b) in the patients' questionnaire--quality of life (LQ), patient-relevant therapeutic benefits and satisfaction with care. On average, patients achieved a total PBI of 2.5±1.1. 86.7% of patients showed a more than minimum benefit (PBI>1). Patients treated with biologicals had a higher benefit (mean PBI 3.0) than patients in other groups (e.g. PBI 2.6 in systemics). PBI values indicate that systemic agents and biologics are of high therapeutic benefit to the vast majority of patients. The development of the PBI has enabled a decisive step to be taken in the area of scientifically-based outcome assessments.

  8. CH3NH3PbI3 grain growth and interfacial properties in meso-structured perovskite solar cells fabricated by two-step deposition

    Science.gov (United States)

    Yao, Zhibo; Wang, Wenli; Shen, Heping; Zhang, Ye; Luo, Qiang; Yin, Xuewen; Dai, Xuezeng; Li, Jianbao; Lin, Hong

    2017-12-01

    Although the two-step deposition (TSD) method is widely adopted for the high performance perovskite solar cells (PSCs), the CH3NH3PbI3 perovskite crystal growth mechanism during the TSD process and the photo-generated charge recombination dynamics in the mesoporous-TiO2 (mp-TiO2)/CH3NH3PbI3/hole transporting material (HTM) system remains unexploited. Herein, we modified the concentration of PbI2 (C(PbI2)) solution to control the perovskite crystal properties, and observed an abnormal CH3NH3PbI3 grain growth phenomenon atop mesoporous TiO2 film. To illustrate this abnormal grain growth mechanism, we propose that a grain ripening process is taking place during the transformation from PbI2 to CH3NH3PbI3, and discuss the PbI2 nuclei morphology, perovskite grain growing stage, as well as Pb:I atomic ratio difference among CH3NH3PbI3 grains with different morphology. These C(PbI2)-dependent perovskite morphologies resulted in varied charge carrier transfer properties throughout the mp-TiO2/CH3NH3PbI3/HTM hybrid, as illustrated by photoluminescence measurement. Furthermore, the effect of CH3NH3PbI3 morphology on light absorption and interfacial properties is investigated and correlated with the photovoltaic performance of PSCs.

  9. Mesoscopic CH 3 NH 3 PbI 3 /TiO 2 Heterojunction Solar Cells

    KAUST Repository

    Etgar, Lioz

    2012-10-24

    We report for the first time on a hole conductor-free mesoscopic methylammonium lead iodide (CH 3NH 3PbI 3) perovskite/TiO 2 heterojunction solar cell, produced by deposition of perovskite nanoparticles from a solution of CH 3NH 3I and PbI 2 in γ-butyrolactone on a 400 nm thick film of TiO 2 (anatase) nanosheets exposing (001) facets. A gold film was evaporated on top of the CH 3NH 3PbI 3 as a back contact. Importantly, the CH 3NH 3PbI 3 nanoparticles assume here simultaneously the roles of both light harvester and hole conductor, rendering superfluous the use of an additional hole transporting material. The simple mesoscopic CH 3NH 3PbI 3/TiO 2 heterojunction solar cell shows impressive photovoltaic performance, with short-circuit photocurrent J sc= 16.1 mA/cm 2, open-circuit photovoltage V oc = 0.631 V, and a fill factor FF = 0.57, corresponding to a light to electric power conversion efficiency (PCE) of 5.5% under standard AM 1.5 solar light of 1000 W/m 2 intensity. At a lower light intensity of 100W/m 2, a PCE of 7.3% was measured. The advent of such simple solution-processed mesoscopic heterojunction solar cells paves the way to realize low-cost, high-efficiency solar cells. © 2012 American Chemical Society.

  10. Degradation mechanism of CH3NH3PbI3 perovskite materials upon exposure to humid air

    International Nuclear Information System (INIS)

    Shirayama, Masaki; Kato, Masato; Fujiseki, Takemasa; Hara, Shota; Kadowaki, Hideyuki; Murata, Daisuke; Fujiwara, Hiroyuki; Miyadera, Tetsuhiko; Sugita, Takeshi; Chikamatsu, Masayuki

    2016-01-01

    Low stability of organic-inorganic perovskite (CH 3 NH 3 PbI 3 ) solar cells in humid air environments is a serious drawback which could limit practical application of this material severely. In this study, from real-time spectroscopic ellipsometry characterization, the degradation mechanism of ultra-smooth CH 3 NH 3 PbI 3 layers prepared by a laser evaporation technique is studied. We present evidence that the CH 3 NH 3 PbI 3 degradation in humid air proceeds by two competing reactions of (i) the PbI 2 formation by the desorption of CH 3 NH 3 I species and (ii) the generation of a CH 3 NH 3 PbI 3 hydrate phase by H 2 O incorporation. In particular, rapid phase change occurs in the near-surface region and the CH 3 NH 3 PbI 3 layer thickness reduces rapidly in the initial 1 h air exposure even at a low relative humidity of 40%. After the prolonged air exposure, the CH 3 NH 3 PbI 3 layer is converted completely to hexagonal platelet PbI 2 /hydrate crystals that have a distinct atomic-scale multilayer structure with a period of 0.65 ± 0.05 nm. We find that conventional x-ray diffraction and optical characterization in the visible region, used commonly in earlier works, are quite insensitive to the surface phase change. Based on results obtained in this work, we discuss the degradation mechanism of CH 3 NH 3 PbI 3 in humid air.

  11. Study of the influence of the amount of PBI-H{sub 3}PO{sub 4} in the catalytic layer of a high temperature PEMFC

    Energy Technology Data Exchange (ETDEWEB)

    Lobato, Justo; Canizares, Pablo; Rodrigo, Manuel A.; Linares, Jose J.; Pinar, F. Javier [Chemical Engineering Department, Enrique Costa Building, University of Castilla-La Mancha, Av. Camilo Jose Cela, n 12, 13071, Ciudad Real (Spain)

    2010-02-15

    The influence of the amount of polybenzimidazole (PBI)-H{sub 3}PO{sub 4} (normalized with respect to the PBI loading, which expressed as C/PBI weight ratio) content in both the anode and cathode has been studied for a PBI-based high temperature proton exchange membrane (PEM) fuel cell. The electrodes prepared with different amounts of PBI have been characterized physically, by measuring the pore size distribution, and visualizing the surface microstructure. Afterwards, the electrochemical behaviour of the electrodes has been evaluated. The catalytic electrochemical activity has been measured by voltamperometry for each electrode prepared with a different PBI content, and the cell performance results have been studied, supported by the impedance spectra, in order to determine the influence of the PBI loading in each electrode. The best results have been achieved with a C/PBI weight ratio of 20, for both the anode and the cathode. A lower C/PBI weight ratio (larger amount of PBI in the catalytic layer) reduced the electrocatalytic activity, and impaired the mass transport processes, due to the large amount of polymer covering the catalyst particle, lowering the cell performance. A higher C/PBI weight ratio (lower amount of PBI in the catalytic layer) reduced the electrocatalytic activity, and slightly increased the ohmic resistance. The low amount of the polymeric ionic carrier PBI-H{sub 3}PO{sub 4} limited the proton mobility, despite of the presence of large amounts of ''free'' H{sub 3}PO{sub 4} in the catalytic layer. (author)

  12. Role of hydrogen-bonding and its interplay with octahedral tilting in CH3NH3PbI3

    OpenAIRE

    Lee, Paul David; Bristowe, Nicholas C; Bristowe, Paul D; Cheetham, Anthony Kevin

    2015-01-01

    First principles calculations on the hybrid perovskite CH3NH3PbI3 predict strong hydrogen-bonding which influences the structure and dynamics of the methylammonium cation and reveal its interaction with the tilting of the PbI6 octahedra. The calculated atomic coordinates are in excellent agreement with neutron diffraction results. [Image - see article] Funding from the Winton Programme for the Physics of Sustainability at the University of Cambridge is gratefully acknowledged. NCB acknowle...

  13. On the growth of CH3NH3PbI3-xClx single crystal and characterization

    Science.gov (United States)

    Su, J.; Wang, W. F.; Lei, Y.; Zhang, L.; Xu, L. H.; Wang, D.; Lu, D.; Bai, Y.

    2018-05-01

    In this paper, CH3NH3PbI3-xClx crystal was grown by solution cooling method with CH3NH3I and PbCl2 as raw materials. Lead compounds and CH3NH3PbI3-xClx crystal with size about 6 mm × 4 mm × 2 mm were obtained. The chemical reactions with different CH3NH3I/PbCl2 ratios were analyzed. XPS shows the content of chlorine in CH3NH3PbI3-xClx is about 0.91%. PXRD, FT-IR, Raman and absorbance spectra were used to study the structure and optical properties of CH3NH3PbI3-xClx by comparing with CH3NH3PbI3 crystal. The CH3NH3PbI3-xClx crystal grown is of tetragonal structure with the lattice constants a = b = 8.8165 Å, c = 12.7920 Å and the bandgap value of 1.57 eV.

  14. PBI/Nafion/SiO2 hybrid membrane for high-temperature low-humidity fuel cell applications

    International Nuclear Information System (INIS)

    Wang, Liang; Advani, Suresh G.; Prasad, Ajay K.

    2013-01-01

    A novel composite membrane for fuel cell applications was prepared by incorporating SiO 2 in PBI/Nafion resin by the sol–gel method. Polybenzimidazole (PBI) was blended with Nafion to improve the membrane stability. The presence of PBI also improves the dimensional stability of the composite membrane over a wide range of hydration conditions. Being highly hygroscopic, SiO 2 enhances water absorption and retention in the membrane which improves fuel cell performance under low relative humidity conditions. Scanning electron microscopy showed that the PBI and Nafion polymers can be blended uniformly. Energy dispersive X-ray spectroscopy confirmed the presence of SiO 2 in the composite membrane. Thermal gravimetric analysis confirmed the improved thermal stability of the SiO 2 /PBI/Nafion membrane. Tensile strength, water uptake and swelling of the composite membrane were also measured at 60 °C and compared with Nafion. The fuel cell performance of the novel SiO 2 /PBI/Nafion composite membrane at 120 °C and 35% relative humidity significantly improved over a pure Nafion membrane of the same thickness

  15. Trace impurities analysis determined by neutron activation in the PbI 2 crystal semiconductor

    Science.gov (United States)

    Hamada, M. M.; Oliveira, I. B.; Armelin, M. J.; Mesquita, C. H.

    2003-06-01

    In this work, a methodology for impurity analysis of PbI 2 was studied to investigate the effectiveness of the purification. Commercial salts were purified by the multi passes zone refining and grown by the Bridgman method. To evaluate the purification efficiency, samples from the bottom, middle and upper sections of the ZR ingot were analyzed after 200, 300 and 500 purification passes, by measurements of the impurity concentrations, using the neutron activation analysis (NAA) technique. There was a significant reduction of the impurities according to the purification numbers. The reduction efficiency was different for each element, namely: Au>Mn>Co˜Ag>K˜Br. The impurity concentration of the crystals grown after 200, 300 and 500 passes and the PbI 2 starting material were analyzed by NAA and plasma optical emission spectroscopy.

  16. Growth of semiconductor alloy InGaPBi on InP by molecular beam epitaxy

    International Nuclear Information System (INIS)

    Wang, K; Wang, P; Pan, W W; Wu, X Y; Yue, L; Gong, Q; Wang, S M

    2015-01-01

    We report the first successful growth of InGaPBi single crystals on InP substrate with Bi concentration far beyond the doping level by gas source molecular beam epitaxy. The InGaPBi thin films reveal excellent surface and structural qualities, making it a promising new III–V compound family member for heterostructures. The strain can be tuned between tensile and compressive by adjusting Ga and Bi compositions. The maximum achieved Bi concentration is 2.2 ± 0.4% confirmed by Rutherford backscattering spectroscopy. Room temperature photoluminescence shows strong and broad light emission at energy levels much smaller than the InP bandgap. (paper)

  17. Comparative study of PBI Cross Linked Utilizing Agents of Varying Steric Configurations

    DEFF Research Database (Denmark)

    Kirkebcek, Andreas; Aili, David; Li, Qingfeng

    2016-01-01

    ionic or covalent cross linking. When considering such, little attention is devoted to explore the effect of the sterical configuration of the cross linking agent. In this contribution three different cross linking agents are utilized to evaluate how these affects final membrane properties.......The high thermal and chemical stability of poly[2,2'-(m-phenylene)-5,5' bibenzimidazole] (PBI) accounts for its wise spread use in high temperature polymer electrolyte membrane fuel cells (HT- PEMFC). By doping the membrane with phosphoric acid (PA) ionic conductivity is obtained. Thus conductivity...... is dependent on the amount of PA present within the membrane. However mechanical properties are reduced are significantly reduced due to the plasticizing effect shown by PA [1]. This effect is due to PBI chain displacement. This effect can be lessened by use of cross linking [2-4]. This can be obtained using...

  18. Ultrafine polybenzimidazole (PBI) fibers. [separators for alkaline batteries and dfuel cells

    Science.gov (United States)

    Chenevey, E. C.

    1979-01-01

    Mats were made from ultrafine polybenzimidazole (PBI) fibers to provide an alternate to the use of asbestos as separators in fuel cells and alkaline batteries. To minimize distortion during mat drying, a process to provide a dry fibrid was developed. Two fibrid types were developed: one coarse, making mats for battery separators; the other fine, making low permeability matrices for fuel cells. Eventually, it was demonstrated that suitable mat fabrication techniques yielded fuel cell separators from the coarser alkaline battery fibrids. The stability of PBI mats to 45% KOH at 123 C can be increased by heat treatment at high temperatures. Weight loss data to 1000 hours exposure show the alkali resistance of the mats to be superior to that of asbestos.

  19. Photovoltaic performance and the energy landscape of CH3NH3PbI3.

    Science.gov (United States)

    Zhou, Yecheng; Huang, Fuzhi; Cheng, Yi-Bing; Gray-Weale, Angus

    2015-09-21

    Photovoltaic cells with absorbing layers of certain perovskites have power conversion efficiencies up to 20%. Among these materials, CH3NH3PbI3 is widely used. Here we use density-functional theory to calculate the energies and rotational energy barriers of a methylammonium ion in the α or β phase of CH3NH3PbI3 with differently oriented neighbouring methylammonium ions. Our results suggest the methylammonium ions in CH3NH3PbI3 prefer to rotate collectively, and to be parallel to their neighbours. Changes in polarization on rotation of methylammonium ions are two to three times larger than those on relaxation of the lead ion from the centre of its coordination shell. The preferences for parallel configuration and concerted rotation, with the polarisation changes, are consistent with ferroelectricity in the material, and indicate that this polarisation is governed by methylammonium orientational correlations. We show that the field due to this polarisation is strong enough to screen the field hindering charge transport, and find this screening field in agreement with experiment. We examine two possible mechanisms for the effect of methylammonium ion rotation on photovoltaic performance. One is that rearrangement of methylammoniums promotes the creation and transport of charge carriers. Some effective masses change greatly, but changes in band structure with methylammonium rotation are not large enough to explain current-voltage hysteresis behaviour. The second possible mechanism is that polarization screens the hindering electric field, which arises from charge accumulation in the transport layers. Polarization changes on methylammonium rotation favour this second mechanism, suggesting that collective reorientation of methylammonium ions in the bulk crystal are in significant part responsible for the hysteresis and power conversion characteristics of CH3NH3PbI3 photovoltaic cells.

  20. Crystal Structure Formation of CH3NH3PbI3-xClx Perovskite

    Directory of Open Access Journals (Sweden)

    Shiqiang Luo

    2016-02-01

    Full Text Available Inorganic-organic hydride perovskites bring the hope for fabricating low-cost and large-scale solar cells. At the beginning of the research, two open questions were raised: the hysteresis effect and the role of chloride. The presence of chloride significantly improves the crystallization and charge transfer property of the perovskite. However, though the long held debate over of the existence of chloride in the perovskite seems to have now come to a conclusion, no prior work has been carried out focusing on the role of chloride on the electronic performance and the crystallization of the perovskite. Furthermore, current reports on the crystal structure of the perovskite are rather confusing. This article analyzes the role of chloride in CH3NH3PbI3-xClx on the crystal orientation and provides a new explanation about the (110-oriented growth of CH3NH3PbI3 and CH3NH3PbI3-xClx.

  1. Control of PbI2 nucleation and crystallization: towards efficient perovskite solar cells based on vapor-assisted solution process

    Science.gov (United States)

    Yang, Chongqiu; Peng, Yanke; Simon, Terrence; Cui, Tianhong

    2018-04-01

    Perovskite solar cells (PSC) have outstanding potential to be low-cost, high-efficiency photovoltaic devices. The PSC can be fabricated by numerous techniques; however, the power conversion efficiency (PCE) for the two-step-processed PSC falls behind that of the one-step method. In this work, we investigate the effects of relative humidity (RH) and dry air flow on the lead iodide (PbI2) solution deposition process. We conclude that the quality of the PbI2 film is critical to the development of the perovskite film and the performance of the PSC device. Low RH and dry air flow used during the PbI2 spin coating procedure can increase supersaturation concentration to form denser PbI2 nuclei and a more suitable PbI2 film. Moreover, airflow-assisted PbI2 drying and thermal annealing steps can smooth transformation from the nucleation stage to the crystallization stage.

  2. The effects of synthesis parameters on the formation of PbI2 particles under DTAB-assisted hydrothermal process

    International Nuclear Information System (INIS)

    Zhu Gangqiang; Hojamberdiev, Mirabbos; Liu Peng; Peng Jianhong; Zhou Jianping; Bian Xiaobin; Huang Xijin

    2011-01-01

    Highlights: ► Submicron- and micron-sized PbI 2 particles were hydrothermally synthesized. ► Structural transformation form belt-like to rod- and microtube-like was observed. ► Phase-pure PbI 2 particles could be hydrothermally obtained at pH 2 particles. ► The optical band gap energy of PbI 2 was slightly affected by morphology. - Abstract: Submicron- and micron-sized lead iodide (PbI 2 ) particles with well-controlled morphologies were successfully fabricated via a low-temperature hydrothermal process assisted by dodecyltrimethylammonium bromide (DTAB) as cationic surfactant. The as-synthesized powders were characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, and UV–vis spectroscopy. The effects of synthesis parameters (temperature, time, pH, and surfactant amount) were systematically investigated. The obtained results showed that the submicron structure was belt-like at 100–120 °C, transformed to rod-like by increasing temperature to 140 °C and it became a microtube-like at 160–200 °C. By changing the pH of the synthesizing solution, it was found that a pure PbI 2 phase could be obtained below 7. With the addition of increasing amount of surfactant, microparticles were converted to microrods → submicron belts → microtubes. The time-dependent experimental results revealed that the dissolution–recrystallization and dissolution–recrystallization–self-oriented-attachment were considered to be the possible mechanisms for the formation of the belt- and tube-like PbI 2 submicron- and micron-sized particles, respectively. The optical properties of the PbI 2 particles synthesized at 100–200 °C for 8 h under hydrothermal conditions were also studied.

  3. Fabrication and Scale-up of Polybenzimidazole (PBI) Membrane Based System for Precombustion-Based Capture of Carbon Dioxide

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, Gopala; Jayaweera, Indira; Sanjrujo, Angel; O' Brien, Kevin; Callahan, Richard; Berchtold, Kathryn; Roberts, Daryl-Lynn; Johnson, Will

    2012-03-31

    The primary objectives of this project are to (1) demonstrate the performance and fabrication of a technically and economically viable pre-combustion-based CO{sub 2} capture system based on the high temperature stability and permeance of PBI membranes, (2) optimize a plan for integration of PBI capture system into an IGCC plant and (3) develop a commercialization plan that addresses technical issues and business issues to outline a clear path for technology transfer of the PBI membrane technology. This report describes research conducted from April 1, 2007 to March 30, 2012 and focused on achieving the above objectives. PBI-based hollow fibers have been fabricated at kilometer lengths and bundled as modules at a bench-scale level for the separation of CO{sub 2} from H{sub 2} at high temperatures and pressures. Long term stability of these fibers has been demonstrated with a relatively high H{sub 2}/CO{sub 2} selectivity (35 to 50) and H{sub 2} permeance (80 GPU) at temperatures exceeding 225°C. Membrane performance simulations and systems analysis of an IGCC system incorporating a PBI hollow fiber membrane modules have demonstrated that the cost of electricity for CO{sub 2} capture (<10%) using such a high temperature separator. When the cost of transporting, storing, and monitoring the CO{sub 2} is accounted for, the increase in the COE is only 14.4%.

  4. Adverse Effects of Excess Residual PbI2 on Photovoltaic Performance, Charge Separation, and Trap-State Properties in Mesoporous Structured Perovskite Solar Cells.

    Science.gov (United States)

    Wang, Hao-Yi; Hao, Ming-Yang; Han, Jun; Yu, Man; Qin, Yujun; Zhang, Pu; Guo, Zhi-Xin; Ai, Xi-Cheng; Zhang, Jian-Ping

    2017-03-17

    Organic-inorganic halide perovskite solar cells have rapidly come to prominence in the photovoltaic field. In this context, CH 3 NH 3 PbI 3 , as the most widely adopted active layer, has been attracting great attention. Generally, in a CH 3 NH 3 PbI 3 layer, unreacted PbI 2 inevitably coexists with the perovskite crystals, especially following a two-step fabrication process. There appears to be a consensus that an appropriate amount of unreacted PbI 2 is beneficial to the overall photovoltaic performance of a device, the only disadvantageous aspect of excess residual PbI 2 being viewed as its insulating nature. However, the further development of such perovskite-based devices requires a deeper understanding of the role of residual PbI 2 . In this work, PbI 2 -enriched and PbI 2 -controlled perovskite films, as two extreme cases, have been prepared by modulating the crystallinity of a pre-deposited PbI 2 film. The effects of excess residual PbI 2 have been elucidated on the basis of spectroscopic and optoelectronic studies. The initial charge separation, the trap-state density, and the trap-state distribution have all been found to be adversely affected in PbI 2 -enriched devices, to the detriment of photovoltaic performance. This leads to a biphasic recombination process and accelerates the charge carrier recombination dynamics. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Effects of current stressing on the p-Bi2Te3/Sn interfacial reactions

    International Nuclear Information System (INIS)

    Chan, Hsing-Ting; Lin, Chih-Fan; Yen, Yee-Wen; Chen, Chih-Ming

    2016-01-01

    The Sn/p-Bi 2 Te 3 /Sn sandwich-type sample was current stressed with a density of 150 A/cm 2 to investigate the effects of current stressing on the p-Bi 2 Te 3 /Sn interfacial reactions. Asymmetrical heating phenomenon was observed at the anodic Sn/p-Bi 2 Te 3 (50 °C) and cathodic p-Bi 2 Te 3 /Sn (120 °C) interfaces due to the Peltier effect. Besides the Peltier effect, the electromigration effect also influenced the growth of the SnTe phase and therefore polarity growth behavior was observed at the two interfaces. The growth of the SnTe phase at the cathodic p-Bi 2 Te 3 /Sn interface was accelerated because Peltier and electromigration effects drove more Sn atoms (dominant diffusion species) for the phase growth. By measuring the electromigration-induced atomic flux of Sn, the product of diffusivity and effective charge number (D × z*) was calculated to be 6.3 × 10 −9 cm 2 s −1 at 120 °C. - Highlights: • Sn/p-Bi 2 Te 3 /Sn sandwich-type sample is current stressed with a density of 150 A/cm 2 . • Passage of an electric current induces Peltier and electromigration effects. • Peltier effect causes asymmetrical heating at the anode and cathode interfaces. • Both effects accelerate the SnTe growth at the cathode interface. • Sn is the dominant diffusion species identified by a marker experiment.

  6. Organoelemental intercalation compounds in the system PbI2-ethan olamine

    International Nuclear Information System (INIS)

    Gurina, G.I.; Evtushenko, V.D.; Muraeva, O.A.; Ignatyuk, V.P.; Koshkin, V.M.

    1985-01-01

    Two intercalation phases with different stoichiometry in system PbI 2 -ethanolamine are identified, using the methods of IR spectroscopy, spectroscopy of diffusion reflection, X-ray phase and thermogravimetric analyses. Formation kinetics of intercalation compounds in the system, having two phases, differing in the content of intercalant in the matrix layers, is studied. In conformity with thermodynamic theory of intercalation, it is shown experimentally, that the value of a charge, transferred from intercalant molecules to the matrix layer, decreases with the increase in intercalant content in interlayer spaces

  7. Shape-Evolution Control of hybrid perovskite CH3NH3PbI3 crystals via solvothermal synthesis

    Science.gov (United States)

    Zhang, Baohua; Guo, Fuqiang; Yang, Lianhong; Jia, Xiuling; Liu, Bin; Xie, Zili; Chen, Dunjun; Lu, Hai; Zhang, Rong; Zheng, Youdou

    2017-02-01

    We systematically synthesized CH3NH3PbI3 crystals using solvothermal process, and the reaction conditions such as concentration of the precursor, temperature, time, and lead source have been comprehensively investigated to obtain shape-controlled CH3NH3PbI3 crystals. The results showed that the CH3NH3PbI3 crystals exhibit tetragonal phase and the crystals change from nanoparticles to hopper-faced cuboids. Photoluminescence spectra of the crystals obtained with different lead sources show a blue shift due to the presence of defects in the crystals, and the peak intensity is very sensitive to the lead sources. Moreover, impurities (undesirable byproducts and excess components like HI or CH3NH2) presented during crystal growth can result in hopper growth.

  8. Investigation and thermodynamic calculation of phase diagram of CdI2-PbI2-NaI system

    International Nuclear Information System (INIS)

    Storonkin, A.V.; Vasil'kova, I.V.; Korobkov, S.V.

    1976-01-01

    Using the thermographic and X-ray phase analyses binary CdI 2 -PbI 2 , PI 2 -NaI, CdI 2 -NaI systems and a triple CdI 2 -PbI 2 -NaI system are investigated and their melting diagrams are plotted. A method of thermodynamic calculation has been proposed and tested of the shape of the eutectic lines for the system CdI 2 -PbI 2 -NaI, taking into account the non-ideality of the liquid phase. The method uses data obtained for the binary systems. The liquidus surface of the triple system has been constructed on the basis of the calculation. The results of the calculation of the triple eutectics are in good agreement with the experimental data

  9. Hybrid perovskite solar cells: In situ investigation of solution-processed PbI2 reveals metastable precursors and a pathway to producing porous thin films

    KAUST Repository

    Barrit, Dounya

    2017-04-17

    The successful and widely used two-step process of producing the hybrid organic-inorganic perovskite CH3NH3PbI3, consists of converting a solution deposited PbI2 film by reacting it with CH3NH3I. Here, we investigate the solidification of PbI2 films from a DMF solution by performing in situ grazing incidence wide angle X-ray scattering (GIWAXS) measurements. The measurements reveal an elaborate sol–gel process involving three PbI2⋅DMF solvate complexes—including disordered and ordered ones—prior to PbI2 formation. The ordered solvates appear to be metastable as they transform into the PbI2 phase in air within minutes without annealing. Morphological analysis of air-dried and annealed films reveals that the air-dried PbI2 is substantially more porous when the coating process produces one of the intermediate solvates, making this more suitable for subsequent conversion into the perovskite phase. The observation of metastable solvates on the pathway to PbI2 formation open up new opportunities for influencing the two-step conversion of metal halides into efficient light harvesting or emitting perovskite semiconductors.

  10. Can Parental Bonding Be Assessed in Children? Factor Structure and Factorial Invariance of the Parental Bonding Instrument (PBI) between Adults and Children

    Science.gov (United States)

    Tsaousis, Ioannis; Mascha, Katerina; Giovazolias, Theodoros

    2012-01-01

    This study examined the factorial structure of the Parental Bonding Instrument (PBI) in the Greek population. Using confirmatory factor analysis different proposed models of the basic dimensions of PBI were evaluated. The results indicated that Kendler's three-factor (i.e. care, protectiveness and authoritarianism) solution was found to be more…

  11. ANALISIS SIKAP PEKERJA INFORMAL NON PBI YANG BELUM TERDAFTAR PROGRAM JAMINAN KESEHATAN NASIONAL (JKN 2014 DI KABUPATEN BREBES

    Directory of Open Access Journals (Sweden)

    Septiana Ika Purwandari

    2015-04-01

    Full Text Available Tujuan penelitian ini untuk mengetahui sikap pekerja informal non PBI terhadap program JKN di Kabupaten Brebes.Jenis Penelitian ini deskriptif dengan pendekatan kuantitatif. Populasi semua pekerja informal non PBI yang belum terdaftar JKN di Kabupaten Brebes. Sampel berjumalah 347 responden menggunakan teknik accidental sampling. Instrumen yang digunakan dalam penelitian ini adalah kuesioner.Dari 347 responden didapatkan hasil dengan 56,5% pekerja informal non PBI di Kabupaten Brebes mendukung terhadap program JKNdan 43,5% tidak mendukung, 83,3%mendukung menjadi peserta PBI, 25,4% mendukung dengan adanya denda, rata rata 86,76% mendukung semua pelayanan dalam JKN, rata rata 78,4% mendukung terhadap pengelolaan dana oleh BPJS kesehatan, dan 92,5% mendukung fasilitasnya.Saran bagi BPJS kesehatan untuk menginformasikan secara jelas dan lengkap tentang jaminan kesehatan nasional, bagi kelurahan untuk memilih warganya dengan adil dan bijaksana dan bagi peneliti selanjutnya untuk lebih mengembangkan penelitian mengenai BPJS kesehatan dan JKN. The purpose of this research was to know the attitude of informal workers non PBI(not supporting fund receiver that has not been registered in national health insurance at the district of Brebes. This research was descriptive quantitative. The population in this research were all informal workers non PBI(not supporting fund receiver that has not been registered national health insurance at the district of Brebes. Thesample were 347 respondents which obtained by accidental sampling technique. An instrument used in this research was the questionnaire.Based on the research of 347 respondents were obtained the result with 56,5% of informalworkersnon PBI(not supporting fund receiver at the district of Brebes was support the national health care program and 43,5% were not support, 83,3% support to become participants PBI (supporting fund receiver, 25,4% support with the fines, average 86,76% supported of all regarding

  12. Time-resolved photoemission spectroscopy of electronic cooling and localization in CH3NH3PbI3 crystals

    Science.gov (United States)

    Chen, Zhesheng; Lee, Min-i.; Zhang, Zailan; Diab, Hiba; Garrot, Damien; Lédée, Ferdinand; Fertey, Pierre; Papalazarou, Evangelos; Marsi, Marino; Ponseca, Carlito; Deleporte, Emmanuelle; Tejeda, Antonio; Perfetti, Luca

    2017-09-01

    We measure the surface of CH3NH3PbI3 single crystals by making use of two-photon photoemission spectroscopy. Our method monitors the electronic distribution of photoexcited electrons, explicitly discriminating the initial thermalization from slower dynamical processes. The reported results disclose the fast-dissipation channels of hot carriers (0.25 ps), set an upper bound to the surface-induced recombination velocity (PbI3 samples is consistent with the progressive reduction of photoconversion efficiency in operating devices. Minimizing the density of shallow traps and solving the aging problem may boost the macroscopic efficiency of solar cells to the theoretical limit.

  13. Transparent and flexible photodetectors based on CH3NH3PbI3 perovskite nanoparticles

    Science.gov (United States)

    Jeon, Young Pyo; Woo, Sung Jun; Kim, Tae Whan

    2018-03-01

    Transparent and flexible photodetectors (PDs) based on CH3NH3PbI3 perovskite nanoparticles (NPs) were fabricated by using co-evaporation of methyl ammonium iodide and lead iodide. X-ray diffraction patterns and high-resolution transmission electron microscopy images demonstrated the formation of perovskite NPs. The optical transmittance of the perovskite NPs/glass was above 80% over the entire range of visible wavelengths, indicative of high transparency. The PDs based on CH3NH3PbI3 perovskite NPs were sensitive to a broad range of visible light from 450 to 650 nm. The currents in the PDs under exposure to red, green, and blue light-emitting diodes were enhanced to 5, 10, and 20 times that of the PD in the dark, respectively. The rise and the decay times of the PDs were 50 and 120 μs. The current in the perovskite NP PD on a polyethylene terephthalate substrate was enhanced by approximately 69% when the NP PD was exposed to a blue LED emitting at a wavelength of 459 nm. Despite multiple bending, the transparent and flexible PDs based on methyl ammonium iodide and lead iodide NPs showed reproducibility and high stability in performance.

  14. Enhanced forward osmosis from chemically modified polybenzimidazole (PBI) nanofiltration hollow fiber membranes with a thin wall

    KAUST Repository

    Wang, Kai Yu; Yang, Qian; Chung, Tai-Shung; Rajagopalan, Raj

    2009-01-01

    To develop high-flux and high-rejection forward osmosis (FO) membranes for water reuses and seawater desalination, we have fabricated polybenzimidazole (PBI) nanofiltration (NF) hollow fiber membranes with a thin wall and a desired pore size via non-solvent induced phase inversion and chemically cross-linking modification. The cross-linking by p-xylylene dichloride can finely tune the mean pore size and enhance the salt selectivity. High water permeation flux and improved salt selectivity for water reuses were achieved by using the 2-h modified PBI NF membrane which has a narrow pore size distribution. Cross-linking at a longer time produces even a lower salt permeation flux potentially suitable for desalination but at the expense of permeation flux due to tightened pore sizes. It is found that draw solution concentration and membrane orientations are main factors determining the water permeation flux. In addition, effects of membrane morphology and operation conditions on water and salt transport through membrane have been investigated. © 2008 Elsevier Ltd. All rights reserved.

  15. Room temperature solution processed low dimensional CH3NH3PbI3 NIR detector

    Science.gov (United States)

    Besra, N.; Paul, T.; Sarkar, P. K.; Thakur, S.; Sarkar, S.; Das, A.; Chanda, K.; Sardar, K.; Chattopadhyay, K. K.

    2018-05-01

    Metal halide perovskites have recently drawn immense research interests among the worldwide scientific community due to their excellent light harvesting capabilities and above all, cost effectiveness. These new class of materials have already been used as efficient optoelectronic devices e.g. solar cells, photo detectors, etc. Here in this work, room temperature NIR (near infra red) response of organic-inorganic lead halide perovskite CH3NH3PbI3 (Methylammonium lead tri iodide) nanorods has been studied. A very simple solution process technique has been adopted to synthesize CH3NH3PbI3 nanostructures at room temperature. The NIR exposure upon the sample resulted in a considerable hike in its dark current with very good responsivity (0.37 mA/W). Along with that, a good on-off ratio (41.8) was also obtained when the sample was treated under a pulsed NIR exposure with operating voltage of 2 V. The specific detectivity of the device came in the order of 1010 Jone.

  16. Electrochemical promotion of catalytic reactions with Pt/C (or Pt/Ru/C)//PBI catalysts

    DEFF Research Database (Denmark)

    Petrushina, Irina; Bjerrum, Niels; Bandur, Viktor

    2007-01-01

    The paper is an overview of the results of the investigation on electrochemical promotion of three catalytic reactions: methane oxidation with oxygen, NO reduction with hydrogen at 135 degrees C and Fischer-Tropsch synthesis (FTS) at 170 degrees C in the [CH4/O-2(or NO/H-2 or CO/H-2)/Ar//Pt(or Pt....../Ru)//PBI(H3PO4)/H-2, Ar] fuel cell. It has been shown that the partial methane oxidation to C2H2 and the C-2 selectivity were electrochemically promoted by the negative catalyst polarization. This was also the case in NO reduction with hydrogen for low NO and H-2 partial pressures. In both cases the catalytic...... reactions have been promoted by the electrochemically produced hydrogen. It has been found that the NO reduction with hydrogen on the Pt/PBI strongly depends on NO and hydrogen partial pressures in the working gas mixture. At higher NO and H-2 partial pressures the catalysis is promoted...

  17. Definitive hematopoietic stem/progenitor cells manifest distinct differentiation output in the zebrafish VDA and PBI.

    Science.gov (United States)

    Jin, Hao; Sood, Raman; Xu, Jin; Zhen, Fenghua; English, Milton A; Liu, P Paul; Wen, Zilong

    2009-02-01

    One unique feature of vertebrate definitive hematopoiesis is the ontogenic switching of hematopoietic stem cells from one anatomical compartment or niche to another. In mice, hematopoietic stem cells are believed to originate in the aorta-gonad-mesonephros (AGM), subsequently migrate to the fetal liver (FL) and finally colonize the bone marrow (BM). Yet, the differentiation potential of hematopoietic stem cells within early niches such as the AGM and FL remains incompletely defined. Here, we present in vivo analysis to delineate the differentiation potential of definitive hematopoietic stem/progenitor cells (HSPCs) in the zebrafish AGM and FL analogies, namely the ventral wall of dorsal aorta (VDA) and the posterior blood island (PBI), respectively. Cell fate mapping and analysis of zebrafish runx1(w84x) and vlad tepes (vlt(m651)) mutants revealed that HSPCs in the PBI gave rise to both erythroid and myeloid lineages. However, we surprisingly found that HSPCs in the VDA were not quiescent but were uniquely adapted to generate myeloid but not erythroid lineage cells. We further showed that such distinct differentiation output of HSPCs was, at least in part, ascribed to the different micro-environments present in these two niches. Our results highlight the importance of niche in shaping the differentiation output of developing HSPCs.

  18. Enhanced forward osmosis from chemically modified polybenzimidazole (PBI) nanofiltration hollow fiber membranes with a thin wall

    KAUST Repository

    Wang, Kai Yu

    2009-04-01

    To develop high-flux and high-rejection forward osmosis (FO) membranes for water reuses and seawater desalination, we have fabricated polybenzimidazole (PBI) nanofiltration (NF) hollow fiber membranes with a thin wall and a desired pore size via non-solvent induced phase inversion and chemically cross-linking modification. The cross-linking by p-xylylene dichloride can finely tune the mean pore size and enhance the salt selectivity. High water permeation flux and improved salt selectivity for water reuses were achieved by using the 2-h modified PBI NF membrane which has a narrow pore size distribution. Cross-linking at a longer time produces even a lower salt permeation flux potentially suitable for desalination but at the expense of permeation flux due to tightened pore sizes. It is found that draw solution concentration and membrane orientations are main factors determining the water permeation flux. In addition, effects of membrane morphology and operation conditions on water and salt transport through membrane have been investigated. © 2008 Elsevier Ltd. All rights reserved.

  19. Growing large columnar grains of CH3NH3PbI3 using the solid-state reaction method enhanced by less-crystallized nanoporous PbI2 films

    Science.gov (United States)

    Zheng, Huifeng; Wang, Weiqi; Liu, Yangqiao; Sun, Jing

    2017-03-01

    Compact, pinhole-free and PbI2-free perovskite films, are desirable for high-performance perovskite solar cells (PSCs), especially if large columnar grains are obtained in which the adverse effects of grain boundaries will be minimized. However, the conventional solid-state reaction methods, originated from the two-step method, failed to grow columnar grains of CH3NH3PbI3 in a facile way. Here, we demonstrate a strategy for growing large columnar grains of CH3NH3PbI3, by less-crystallized nanoporous PbI2 (ln-PbI2) film enhanced solid-state reaction method. We demonstrated columnar grains were obtainable only when ln-PbI2 films were applied. Therefore, the replacement of compact PbI2 by ln-PbI2 in the solid-sate reaction, leads to higher power conversion efficiency, better reproducibility, better stability and less hysteresis. Furthermore, by systematically investigating the effects of annealing temperature and duration, we found that an annealing temperature ≥120 °C was also critical for growing columnar grains. With the optimal process, a champion efficiency of 16.4% was obtained and the average efficiency reached 14.2%. Finally, the mechanism of growing columnar grains was investigated, in which a VPb″ -assisted hooping model was proposed. This work reveals the origins of grain growth in the solid-state reaction method, which will contribute to preparing high quality perovskite films with much larger columnar grains.

  20. Effect of the Ultrasonic Substrate Vibration on Nucleation and Crystallization of PbI2 Crystals and Thin Films

    Directory of Open Access Journals (Sweden)

    Fatemeh Zabihi

    2018-01-01

    Full Text Available Preparation of defect-free and well-controlled solution-processed crystalline thin films is highly desirable for emerging technologies, such as perovskite solar cells. In this work, using PbI2 as a model solution with a vast variety of applications, we demonstrate that the excitation of a liquid thin film by imposed ultrasonic vibration on the film substrate significantly affects the nucleation and crystallization kinetics of PbI2 and the morphology of the resulting solid thin film. It is found that by applying ultrasonic vibration to PbI2 solution spun onto an ITO substrate with a moderate power and excitation duration (5 W and 1 min for the 40 kHz transducer used in this study, the nucleation rate increases and the crystals transform from 2D or planar to epitaxial 3D columnar structures, resulting in the suppression of crystallization dewetting. The effects of various induced physical phenomena as a result of the excitation by ultrasonic vibration are discussed, including microstreaming and micromixing, increased heat transfer and local temperature, a change in the thermodynamic state of the solution, and a decrease in the supersaturation point. It is shown that the ultrasonic-assisted solution deposition of the PbI2 thin films is controllable and reproducible, a process which is low-cost and in line with the large-scale fabrication of such solution-processed thin films.

  1. Third-order nonlinear optical properties of GeSe2-Ga2Se3-PbI2 glasses

    International Nuclear Information System (INIS)

    Tang Gao; Liu Cunming; Luo Lan; Chen Wei

    2010-01-01

    The third-order nonlinear optical (NLO) properties of new selenium-based GeSe 2 -Ga 2 Se 3 -PbI 2 glasses have been measured using the optical Kerr effect (OKE) technique, with picosecond and femtosecond laser pulses. The 0.70GeSe 2 -0.15Ga 2 Se 3 -0.15PbI 2 glass has the largest third-order optical nonlinear susceptibility in GeSe 2 -Ga 2 Se 3 -PbI 2 glass system with χ (3) of 5.28x10 12 esu. In addition, the response time of glasses is sub-picosecond, which is predominantly associated with electron cloud. Local structure of the glasses has been identified by using Raman studies, while the origins of the observed nonlinear optical response are discussed. The [Ge(Ga)Se 4 ] tetrahedral and lone-pair electrons from highly polarizable Pb atom in glasses play an important role in enhanced NLO response. These results as well as their good chemical stability indicate that GeSe 2 -Ga 2 Se 3 -PbI 2 glasses are promising materials for photonic applications of third-order nonlinear optical signal processing.

  2. Synergic solventing-out crystallization with subsequent time-delay thermal annealing of PbI2 precursor in mesostructured perovskite solar cells

    Science.gov (United States)

    Jia, Fujin; Guo, Yanqun; Che, Lijia; Liu, Zhiyong; Zeng, Zhigang; Cai, Chuanbing

    2018-06-01

    Although the two-step sequential deposition method provides an efficient route to fabricate high performance perovskite solar cells (PSSCs) with increasing reproducibility, the inefficient and incomplete conversion of PbI2 to perovskite is still quite a challenge. Following pioneering works, we found that the conversion process from PbI2 to perovskite mainly involves diffusion, infiltration, contact and reaction. In order to facilitate the conversion from PbI2 to perovskite, we demonstrate an effective method to regulate supersaturation level (the driving force to crystallization) of PbI2 by solventing-out crystallization combining with subsequent time-delay thermal annealing of PbI2 wet film. Enough voids and spaces in resulting porous PbI2 layer will be in favor of efficient diffusion, infiltration of CH3NH3I solution, and further enhance the contact and reaction between PbI2 and CH3NH3I in the whole film, leading to rapid, efficient and complete perovskite conversion with a conversion level of about 99.9%. Enhancement of light harvesting ranging from visible to near-IR region was achieved for the resultant high-quality perovskite. Upon this combined method, the fabricated mesostructured solar cells show tremendous power conversion efficiency (PCE) improvement from 3.2% to about 12.3% with less hysteresis owing to the simultaneous enhancement of short-circuit photocurrent density (J sc), open-circuit voltage (V oc) and fill factor (FF).

  3. Evolution of Chemical Composition, Morphology, and Photovoltaic Efficiency of CH 3 NH 3 PbI 3 Perovskite under Ambient Conditions

    KAUST Repository

    Huang, Weixin; Manser, Joseph S.; Kamat, Prashant V.; Ptasinska, Sylwia

    2016-01-01

    © 2015 American Chemical Society. The surface composition and morphology of CH3NH3PbI3 perovskite films stored for several days under ambient conditions were investigated by X-ray photoelectron spectroscopy, scanning electron microscopy, and X-ray diffraction techniques. Chemical analysis revealed the loss of CH3NH3 + and I- species from CH3NH3PbI3 and its subsequent decomposition into lead carbonate, lead hydroxide, and lead oxide. After long-term storage under ambient conditions, morphological analysis revealed the transformation of randomly distributed defects and cracks, initially present in the densely packed crystalline structure, into relatively small grains. In contrast to PbI2 powder, CH3NH3PbI3 exhibited a different degradation trend under ambient conditions. Therefore, we propose a plausible CH3NH3PbI3 decomposition pathway that explains the changes in the chemical composition of CH3NH3PbI3 under ambient conditions. In addition, films stored under such conditions were incorporated into photovoltaic cells, and their performances were examined. The chemical changes in the decomposed films were found to cause a significant decrease in the photovoltaic efficiency of CH3NH3PbI3.

  4. Evolution of Chemical Composition, Morphology, and Photovoltaic Efficiency of CH 3 NH 3 PbI 3 Perovskite under Ambient Conditions

    KAUST Repository

    Huang, Weixin

    2016-01-12

    © 2015 American Chemical Society. The surface composition and morphology of CH3NH3PbI3 perovskite films stored for several days under ambient conditions were investigated by X-ray photoelectron spectroscopy, scanning electron microscopy, and X-ray diffraction techniques. Chemical analysis revealed the loss of CH3NH3 + and I- species from CH3NH3PbI3 and its subsequent decomposition into lead carbonate, lead hydroxide, and lead oxide. After long-term storage under ambient conditions, morphological analysis revealed the transformation of randomly distributed defects and cracks, initially present in the densely packed crystalline structure, into relatively small grains. In contrast to PbI2 powder, CH3NH3PbI3 exhibited a different degradation trend under ambient conditions. Therefore, we propose a plausible CH3NH3PbI3 decomposition pathway that explains the changes in the chemical composition of CH3NH3PbI3 under ambient conditions. In addition, films stored under such conditions were incorporated into photovoltaic cells, and their performances were examined. The chemical changes in the decomposed films were found to cause a significant decrease in the photovoltaic efficiency of CH3NH3PbI3.

  5. Remnant PbI2, an unforeseen necessity in high-efficiency hybrid perovskite-based solar cells?

    Directory of Open Access Journals (Sweden)

    Duyen H. Cao

    2014-09-01

    Full Text Available Perovskite-containing solar cells were fabricated in a two-step procedure in which PbI2 is deposited via spin-coating and subsequently converted to the CH3NH3PbI3 perovskite by dipping in a solution of CH3NH3I. By varying the dipping time from 5 s to 2 h, we observe that the device performance shows an unexpectedly remarkable trend. At dipping times below 15 min the current density and voltage of the device are enhanced from 10.1 mA/cm2 and 933 mV (5 s to 15.1 mA/cm2 and 1036 mV (15 min. However, upon further conversion, the current density decreases to 9.7 mA/cm2 and 846 mV after 2 h. Based on X-ray diffraction data, we determined that remnant PbI2 is always present in these devices. Work function and dark current measurements showed that the remnant PbI2 has a beneficial effect and acts as a blocking layer between the TiO2 semiconductor and the perovskite itself reducing the probability of back electron transfer (charge recombination. Furthermore, we find that increased dipping time leads to an increase in the size of perovskite crystals at the perovskite-hole-transporting material interface. Overall, approximately 15 min dipping time (∼2% unconverted PbI2 is necessary for achieving optimal device efficiency.

  6. Performance Degradation Tests of Phosphoric Acid Doped PBI Membrane Based High Temperature PEM Fuel Cells

    DEFF Research Database (Denmark)

    Zhou, Fan; Araya, Samuel Simon; Grigoras, Ionela

    2014-01-01

    Degradation tests of two phosphoric acid (PA) doped PBI membrane based HT-PEM fuel cells were reported in this paper to investigate the effects of start/stop and the presence of methanol in the fuel to the performance degradation. Continuous tests with H2 and simulated reformate which was composed...... of H2, water steam and methanol as the fuel were performed on both single cells. 12-h-startup/12-h-shutdown dynamic tests were performed on the first single cell with pure dry H2 as the fuel and on the second single cell with simulated reformate as the fuel. Along with the tests electrochemical...... techniques such as polarization curves and electrochemical impedance spectroscopy (EIS) were employed to study the degradation mechanisms of the fuel cells. Both single cells showed an increase in the performance in the H2 continuous tests, because of a decrease in the ORR kinetic resistance probably due...

  7. Mechanical response of CH3NH3PbI3 nanowires

    Science.gov (United States)

    Ćirić, L.; Ashby, K.; Abadie, T.; Spina, M.; Duchamp, M.; Náfrádi, B.; Kollár, M.; Forró, L.; Horváth, E.

    2018-03-01

    We report a systematic study of the mechanical response of methylammonium lead triiodide CH3NH3PbI3 nanowires by employing bending measurements using atomic force microscope on suspended wires over photo-lithographically patterned channels. Force-deflection curves measured at room temperature give a Young's modulus between 2 and 14 GPa. This broad range of values is attributed to the variations in the microcrystalline texture of halide perovskite nanowires. The mechanical response of a highly crystalline nanowire is linear with force and has a brittle character. The braking modulus of 48 ± 20 MPa corresponds to 100 μm of radius of curvature of the nanowires, rendering them much better structures for flexible devices than spin coated films. The measured moduli decrease rapidly if the NW is exposed to water vapor.

  8. A comprehensive review of PBI-based high temperature PEM fuel cells

    DEFF Research Database (Denmark)

    Simon Araya, Samuel; Zhou, Fan; Liso, Vincenzo

    2016-01-01

    of their design and characterization techniques at single cell, stack and system levels is given. The state-of-the-art concepts of different degradation mechanisms and methods of their mitigation are also discussed. Moreover, accelerated stress testing (AST) procedures for HT-PEMFCs available in literature...... fuel cell faults for targeted interventions based on the observed conditions to prevent sudden failures and to prolong the fuel cell's lifetime. However, the technology is still under development and robust on-line diagnostics tools are hardly available. Currently, mitigation is mainly done based......The current status on the understanding of the various operational aspects of high temperature proton exchange membrane fuel cells (HT-PEMFC) has been summarized. The paper focuses on phosphoric acid-doped polybenzimidazole (PBI)-based HT-PEMFCs and an overview of the common practices...

  9. Effects of GeI2 or ZnI2 addition to perovskite CH3NH3PbI3 photovoltaic devices

    Science.gov (United States)

    Tanaka, Hiroki; Ohishi, Yuya; Oku, Takeo

    2018-01-01

    CH3NH3PbI3 added with GeI2 or ZnI2 perovskite photovoltaic devices were fabricated characterized. The surface coverages of the perovskite layers were improved by the addition of GeI2 or ZnI2. Formation of PbI2 observed for the pristine CH3NH3PbI3 was suppressed by the GeI2 or ZnI2 addition, which resulted in the improvement of the conversion efficiencies of the perovskite photovoltaic devices.

  10. Symmetric and asymmetric zeolitic imidazolate frameworks (ZIFs)/polybenzimidazole (PBI) nanocomposite membranes for hydrogen purification at high temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Tingxu; Shi, Gui Min; Chung, Tai-Shung [Department of Chemical and Biomolecular Engineering, National University of Singapore, Singapore (Singapore)

    2012-11-15

    High-performance zeolitic imidazolate frameworks (ZIFs)/polybenzimidazole (PBI) nanocomposites are molecularly designed for hydrogen separation at high temperatures, and demonstrate it in a useful configuration as dual-layer hollow fibers for the first time. By incorporating as-synthesized nanoporous ZIF-8 nanoparticles into the high thermal stability but extremely low permeability polybenzimidazole (PBI), the resultant mixed matrix membranes show an impressive enhancement in H{sub 2} permeability as high as a hundred times without any significant deduction in H{sub 2}/CO{sub 2} selectivity. The 30/70 ZIF-8/PBI dense membrane has a H{sub 2} permeability of 105.4 Barrer and a H{sub 2}/CO{sub 2} selectivity of 12.3. This performance is far superior to ZIF-7/PBI membranes and is the best ever reported data for H{sub 2}-selective polymeric materials in the literature. Meanwhile, defect-free ZIF-8-PBI/Matrimid dual-layer hollow fibers are successfully fabricated, without post-annealing and coating, by optimizing ZIF-8 nanoparticle loadings, spinning conditions, and solvent-exchange procedures. Two types of hollow fibers targeted at either high H{sub 2}/CO{sub 2} selectivity or high H{sub 2} permeance are developed: i) PZM10-I B fibers with a medium H{sub 2} permeance of 64.5 GPU (2.16 x 10{sup -8} mol m{sup -2} s{sup -1} Pa{sup -1}) at 180 C and a high H{sub 2}/CO{sub 2} selectivity of 12.3, and, ii) PZM33-I B fibers with a high H{sub 2} permeance of 202 GPU (6.77 x 10{sup -8} mol m{sup -2} s{sup -1} Pa{sup -1}) at 180 C and a medium H{sub 2}/CO{sub 2} selectivity of 7.7. This work not only molecularly designs novel nanocomposite materials for harsh industrial applications, such as syngas and hydrogen production, but also, for the first time, synergistically combines the strengths of both ZIF-8 and PBI for energy-related applications. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. Evaluating complex health financing interventions: using mixed methods to inform further implementation of a novel PBI intervention in rural Malawi.

    Science.gov (United States)

    McMahon, Shannon A; Brenner, Stephan; Lohmann, Julia; Makwero, Christopher; Torbica, Aleksandra; Mathanga, Don P; Muula, Adamson S; De Allegri, Manuela

    2016-08-19

    Gaps remain in understanding how performance-based incentive (PBI) programs affect quality of care and service quantity, whether programs are cost effective and how programs could be tailored to meet client and provider needs while remaining operationally viable. In 2014, Malawi's Ministry of Health launched the Service Delivery Integration-PBI (SSDI-PBI) program. The program is unique in that no portion of performance bonuses are paid to individual health workers, and it shifts responsibility for infrastructure and equipment procurement from facility staff to implementing partners. This protocol outlines an approach that analyzes processes and outcomes, considers expected and unexpected consequences of the program and frames the program's outputs relative to its costs. Findings from this evaluation will inform the intended future scale-up of PBI in Malawi. This study employs a prospective controlled before-and-after triangulation design to assess effects of the PBI program by analyzing quantitative and qualitative data from intervention and control facilities. Guided by a theoretical framework, the evaluation consists of four main components: service provision, health worker motivation, implementation processes and costing. Quality and access outcomes are assessed along four dimensions: (1) structural elements (related to equipment, drugs, staff); (2) process elements (providers' compliance with standards); (3) outputs (service utilization); (4) experiential elements (experiences of service delivery). The costing component includes costs related to start-up, ongoing management, and the cost of incentives themselves. The cost analysis considers costs incurred within the Ministry of Health, funders, and the implementing agency. The evaluation relies on primary data (including interviews and surveys) and secondary data (including costing and health management information system data). Through the lens of a PBI program, we illustrate how complex interventions can be

  12. Stable and metastable phases in reciprocal systems PbSe + Ag2I2 Ag2Se + PbI2 and PbSe + CdI2 = CdSe + PbI2

    International Nuclear Information System (INIS)

    Odin, I.N.; Grin'ko, V.V.; Kozlovskij, V.F.; Safronov, E.V.

    2005-01-01

    Mutual system PbSe + Ag 2 I 2 = Ag 2 Se + PbI 2 is investigated. It is shown that diagonal Ag 2 Se-PbI 2 is stable. Liquidus surface and isothermal section at 633 K of phase diagram of PbSe-Ag 2 Se-PbI 2 system are built. Transformations directing to crystallization metastable ternary compound forming in PbSe-PbI 2 system and metastable polytype modifications of lead iodide in PbSe-Ag 2 Se-PbI 2 system at 620-685 K are studied. By hardening from molten state (1150-1220 K) new interstitial metastable phases crystallizing in CdCl 2 structural type are obtained in PbSe-Ag 2 Se-PbI 2 and PbSe + CdI 2 = CdSe + PbI 2 systems [ru

  13. Preparation of planar CH3NH3PbI3 thin films with controlled size using 1-ethyl-2-pyrrolidone as solvent

    International Nuclear Information System (INIS)

    Hao, Qiuyan; Chu, Yixia; Zheng, Xuerong; Liu, Zhenya; Liang, Liming; Qi, Jiakun; Zhang, Xin; Liu, Gang; Liu, Hui; Chen, Hongjian; Liu, Caichi

    2016-01-01

    Recently, planar perovskite solar cells based on CH 3 NH 3 PbI 3 have attracted many researcher's interest due to their unique advantages such as simple cell architecture, easy fabrication and potential multijunction construction comparing to the initial mesoporous structure. However, the preparation of planar perovskite films with high quality is still in challenge. In this paper, we developed a vapor-assisted solution process using a novel and green solvent of 1-Ethyl-2-pyrrolidone (NEP) instead of the traditional N, N-dimethylformamide (DMF) to construct a high-quality perovskite CH 3 NH 3 PbI 3 thin film with pure phase, high compactness, small surface roughness and controlled size. The phase evolution and growth mechanism of the perovskite films are also discussed. Utilizing the NEP of low volatility and moderate boiling point as solvent, we dried the PbI 2 -NEP precursor films at different temperature under vacuum and then obtained PbI 2 thin films with different crystalline degree from amorphous to highly crystalline. The perovskite films with crystal size ranged from hundreds of nanometers to several micrometers can be prepared by reacting the PbI 2 films of different crystalline degree with CH 3 NH 3 I vapor. Moreover, planar-structured solar cells combining the perovskite film with TiO 2 and spiro-OMeTAD as the electron and holes transporting layer achieves a power conversion efficiency of 10.2%. - Highlights: • A novel and green solvent of 1-Ethyl-2-pyrrolidone (NEP) was used to construct high-quality perovskite CH 3 NH 3 PbI 3 thin film. • The CH 3 NH 3 PbI 3 grain with different sizes ranged from hundreds of nanometers to several micrometers can be obtained. • Planar-structured perovskite CH 3 NH 3 PbI 3 solar cells using NEP as solvent achieves a power conversion efficiency of 10.2%.

  14. Chemopreventive effects of PBI-Se, a selenium-containing analog of PBIT, on AOM-induced aberrant crypt foci in F344 rats.

    Science.gov (United States)

    Janakiram, Naveena B; Mohammed, Altaf; Ravillah, Durgadevi; Choi, Chang In; Zhang, Yuting; Desai, Dhimant; Amin, Shantu; Rao, Chinthalapally V

    2013-08-01

    Inducible nitric oxide synthase (iNOS) is a potential target for the treatment of inflammation and cancer. Previously, we showed that the selective iNOS inhibitor S,S'-1,4-phenylenebis(1,2-ethanediyl)bis-isothiourea (PBIT) caused significant inhibition of colon carcinogenesis induced by azoxymethane (AOM), although it did not completely abrogate NO production due to the exogenous bioavailability of NO and NO generation by eNOS in tumor tissues. To create an iNOS-targeting molecule that may have additional benefits, a novel isosteric analog of PBIT, PBI-Se, was developed, in which sulfur was replaced with selenium. Chemopreventive efficacy of PBI-Se was evaluated in an AOM-induced rat colon carcinogenesis model using aberrant crypt foci (ACF) as the endpoint. At 7 weeks of age, rats (12/group) were fed the control diet (AIN 76A) and then colonic ACF were induced with two AOM treatments. Three days later, rats were fed diets containing PBI-Se (0-20 ppm) for 8 weeks, and then ACF were evaluated histopathologically. Dietary administration of 10 or 20 ppm of PBI-Se significantly suppressed AOM-induced total colonic ACF formation (32 or 41%, pPBI-Se was dose-dependent and was half the dose of PBIT for inhibiting total ACF in rats. Both PBIT and PBI-Se induced dose-dependent apoptosis in CaCo2 cells and caused a significant decrease in the cell cycle proteins cyclin D1 (70%, pPBI-Se (2 and 4  µM) significantly decreased the LPS-induced cytokine interleukin-6 level. Incorporation of selenium into the structure of PBIT provided the agent with additional novel cytotoxic and immunologic properties. Results from the in vitro and in vivo bioassays suggest that PBI-Se could be developed further for the prevention and treatment of colon cancer.

  15. PBI-05204, a supercritical CO₂ extract of Nerium oleander, inhibits growth of human pancreatic cancer via targeting the PI3K/mTOR pathway.

    Science.gov (United States)

    Pan, Yong; Rhea, Patrea; Tan, Lin; Cartwright, Carrie; Lee, Ho-Jeong; Ravoori, Murali K; Addington, Crandell; Gagea, Mihai; Kundra, Vikas; Kim, Sun-Jin; Newman, Robert A; Yang, Peiying

    2015-04-01

    Introduction Oleandrin, a cardiac glycoside, exerts strong anti-proliferative activity against various human malignancies in in vitro cells. Here, we report the antitumor efficacy of PBI-05204, a supercritical C0₂ extract of Nerium oleander containing oleandrin, in a human pancreatic cancer Panc-1 orthotopic model. Results While all the control mice exhibited tumors by the end of treatment, only 2 of 8 mice (25%) treated for 6 weeks with PBI-05204 (40 mg/kg) showed dissectible tumor at the end of the treatment period. The average tumor weight (222.9 ± 116.9 mg) in mice treated with PBI-05204 (20 mg/kg) was significantly reduced from that in controls (920.0 ± 430.0 mg) (p PBI-05204 (40 mg/kg) treated group showed that the pancreatic tissues of 5/6 mice were normal while the remaining mouse had a tumor the largest diameter of which was less than 2.3 mm. In contrast, while gemcitabine alone did not significantly reduce tumor growth, PBI-05204 markedly enhanced the antitumor efficacy of gemcitabine in this particular model. Ki-67 staining was reduced in pancreatic tumors from mice treated with PBI-05204 (20 mg/kg) compared to that of control, suggesting that PBI-05204 inhibited the proliferation of the Panc-1 tumor cells. PBI-05204 suppressed expression of pAkt, pS6, and p4EPB1 in a concentration-dependent manner in both Panc-1 tumor tissues and human pancreatic cancer cell lines, implying that this novel botanical drug exerts its potent antitumor activity, at least in part, through down-regulation of PI3k/Akt and mTOR pathways.

  16. Rietveld refinement of the crystal structure of perovskite solar cells using CH3NH3PbI3 and other compounds

    Science.gov (United States)

    Ando, Yuji; Ohishi, Yuya; Suzuki, Kohei; Suzuki, Atsushi; Oku, Takeo

    2018-01-01

    The crystal structures of perovskite thin films including CH3NH3PbI3, CH3NH3Pb1-xSbxI3, and CH3NH3PbI3-yCly in the solar cell configuration were studied by using Rietveld refinement. For the CH3NH3PbI3 and CH3NH3Pb1-xSbxI3 samples, satisfactory agreement with the measured profiles was obtained with a weighted profile R-factor (Rwp) of as low as 3%. It was shown that the site occupancy of methylammonium (MA) was decreased in the antimonized cell due to the compensation effect of an increased positive charge brought about by replacing Pb2+ with Sb3+. Photovoltaic measurements showed that the power conversion efficiency was enhanced by adding a small amount of Sb to the CH3NH3PbI3 cell, but it was monotonically decreased as the mole fraction of Sb exceeded 0.03. This variation of the conversion efficiency was considered as a result of suppressed crystallization of PbI2 and carrier recombination via MA vacancies in the antimonized cells. In the case of CH3NH3PbI2.88Cl0.12 sample, the agreement with the measured profile with an Rwp of as high as 7% suggested the co-existence of cubic and tetragonal phases in the chlorinated cell.

  17. Stable and metastable equilibria in PbSe + SnI2=SnSe + PbI2

    International Nuclear Information System (INIS)

    Odin, I.N.; Grin'ko, V.V.; Kozlovskij, V.F.; Demidova, E.D.

    2003-01-01

    T-x-y phase diagrams of the PbSe + SnI 2 =SnSe + PbI 2 mutual system (stable states) are plotted for the first time. It is shown that melt, solid solutions on the base of components of the mutual system and phase on the base of Sn 2 SeI 4 take part in phase equilibria. Transformations in the PbSe + SnI 2 =SnSe + PbI 2 mutual system leading to crystallization of metastable polytype modifications of lead iodides and metastable ternary compound forming in PbSe-PbI 2 system are investigated for the first time [ru

  18. Laser-induced surface recrystallization of polycrystalline PbI2 thick films for X-ray detector application

    Science.gov (United States)

    Sun, Hui; Zhao, Beijun; Zhu, Xinghua; Zhu, Shifu; Yang, Dingyu; Wangyang, Peihua; Gao, Xiuyin

    2018-01-01

    In this work, laser-induced surface recrystallization process was developed to improve the surface properties and device performance of the polycrystalline PbI2 thick films prepared by using close space vapor deposition method. A continuous polycrystalline PbI2 recrystallized layer with a better mechanical strength and reflectivity improved from 2% to 4%-6% was obtained by this recrystallization process for the films with mechanical pretreatment. Other polytypes is absent in the recrystallized layer with the 2H-polytype remaining before and after treatment and obtaining improved electrical and X-ray photoelectric response performance. The pretreatment such as mechanical cutting/polishing and hydrogenation is necessary to lower the non-wetting crystallization behavior during the recrystallization process due to the rough surface state and oxygen contamination.

  19. Effects of CuBr addition to CH3NH3PbI3(Cl) perovskite photovoltaic devices

    Science.gov (United States)

    Oku, Takeo; Ohishi, Yuya; Tanaka, Hiroki

    2018-01-01

    Effects of CuBr addition to perovskite CH3NH3PbI3(Cl) precursor solutions on photovoltaic properties were investigated. The CH3NH3Pb(Cu)I3(Cl,Br)-based photovoltaic devices were fabricated by a spin-coating technique, and the microstructures of the devices were investigated by X-ray diffraction, optical microscopy and scanning electron microscopy. Current density-voltage characteristics were improved by a small amount of CuBr addition, which resulted in improvement of the conversion efficiencies of the devices. The structure analysis showed decrease of unit cell volume and increase of Cu/Br composition by the CuBr addition, which would indicate the Cu/Br substitution at the Pb/I sites in the perovskite crystal, respectively.

  20. New Polymer Electrolyte Membranes Based on Acid Doped PBI For Fuel Cells Operating above 100°C

    DEFF Research Database (Denmark)

    Li, Qingfeng

    2003-01-01

    The technical achievement and challenges for the PEMFC technology based on perfluorosulfonic acid (PFSA) polymer membranes (e.g. Nafion®) are briefly discussed. The newest development for alternative polymer electrolytes for operation above 100°C. As one of the successful approaches to high...... operational temperatures, the development and evaluation of acid doped PBI membranes are reviewed, covering polymer synthesis, membrane casting, acid doping, physiochemical characterization and fuel cell tests....

  1. Role of organic cations on hybrid halide perovskite CH3NH3PbI3 surfaces

    Science.gov (United States)

    Teng, Qiang; Shi, Ting-Ting; Tian, Ren-Yu; Yang, Xiao-Bao; Zhao, Yu-Jun

    2018-02-01

    Organic-inorganic hybrid halide perovskite CH3NH3PbI3 (MAPbI3) has received rapid progress in power conversion efficiency as promising photovoltaic materials, yet the surface structures and the role of MA cations are not well understood. In this work, we investigated the structural stability and electronic properties of (001) surface of cubic, (001) and (110) surfaces of tetragonal and orthorhombic phases of MAPbI3 with considering the orientation of MA cations, by density functional theory calculations. We demonstrate that the orientation of MA cations has profound consequences on the structural stability and the electronic properties of the surfaces, in contrast to the bulk phases. Compared with the MA-I terminated surfaces, the Pb-I2 terminated ones generally have smaller band gaps and the advantage to enable the photo-excited holes to transfer to the hole-transport materials in both tetragonal and orthorhombic phases. Overall, we suggest that the films with Pb-I2 terminated surfaces would prevail in high performance solar energy absorbers.

  2. Novel composite membranes based on PBI and dicationic ionic liquids for high temperature polymer electrolyte membrane fuel cells

    International Nuclear Information System (INIS)

    Hooshyari, Khadijeh; Javanbakht, Mehran; Adibi, Mina

    2016-01-01

    Two types of innovative composite membranes based on polybenzimidazole (PBI) containing dicationic ionic liquid 1,3-di(3-methylimidazolium) propane bis (trifluoromethylsulfonyl) imide (PDC 3 ) and monocationic ionic liquid 1-hexyl-3-methylimidazolium bis (trifluoromethanesulfonyl) imide (PMC 6 ) are prepared as electrolyte for high temperature fuel cells applications under anhydrous conditions. The analyses of results display promising characteristics such as high proton conductivity and thermal stability. Moreover the fuel cell performance of PA doped PDC 3 composite membranes is enhanced in comparison with PA doped PMC 6 and PA doped PBI membranes at high temperatures. Dicationic ionic liquid with high number of charge carriers provides well-developed ionic channels which form facile pathways and considerably develop the anhydrous proton conductivity. The highest proton conductivity of 81 mS/cm is achieved for PA doped PDC 3 composite membranes with PBI/IL mole ratio: 4 at 180 °C. A power density of 0.44 W/cm 2 is obtained at 0.5 V and 180 °C for PA doped PDC 3 composite membranes, which proves that these developed composite membranes can be considered as most promising candidates for high temperature fuel cell applications with enhanced proton conductivity.

  3. Electroluminescence of organic light-emitting diodes consisting of an undoped (pbi)2Ir(acac) phosphorescent layer

    Science.gov (United States)

    Lei, Xia; Yu, Junsheng; Zhao, Juan; Jiang, Yadong

    2011-11-01

    The electroluminescence (EL) characteristics of phosphorescent organic light-emitting diodes (OLEDs) with an undoped bis(1,2-dipheny1-1H-benzoimidazole) iridium (acetylacetonate) [(pbi)2Ir(acac)] emissive layer (EML) of various film thicknesses were studied. The results showed that the intensity of green light emission decreased rapidly with the increasing thickness of (pbi)2Ir(acac), which was relevant to the triplet excimer emission. It suggested that the concentration quenching of monomer emission in the undoped (pbi)2Ir(acac) film was mainly due to the formation of triplet excimer and partly due to the triplet-triplet annihilation (TTA) and triplet-polaron annihilation (TPA). A green OLED with a maximum luminance of 26,531 cd/m2, a current efficiency of 36.2 cd/A, and a power efficiency of 32.4 lm/W was obtained, when the triplet excimer emission was eliminated. Moreover, the white OLED with low efficiency roll-off was realized due to the broadened recombination zone and reduced quenching effects in the EML when no electron blocking layer was employed.

  4. Double functions of porous TiO2 electrodes on CH3NH3PbI3 perovskite solar cells: Enhancement of perovskite crystal transformation and prohibition of short circuiting

    Directory of Open Access Journals (Sweden)

    Govindhasamy Murugadoss

    2014-08-01

    Full Text Available In order to analyze the crystal transformation from hexagonal PbI2 to CH3NH3PbI3 by the sequential (two-step deposition process, perovskite CH3NH3PbI3 layers were deposited on flat and/or porous TiO2 layers. Although the narrower pores using small nanoparticles prohibited the effective transformation, the porous-TiO2 matrix was able to help the crystal transformation of PbI2 to CH3NH3PbI3 by sequential two-step deposition. The resulting PbI2 crystals in porous TiO2 electrodes did not deteriorate the photovoltaic effects. Moreover, it is confirmed that the porous TiO2 electrode had served the function of prohibiting short circuits between working and counter electrodes in perovskite solar cells.

  5. Preclinical Biodistribution and Safety Evaluation of a pbi-shRNA STMN1 Lipoplex after Subcutaneous Delivery.

    Science.gov (United States)

    Wang, Zhaohui; Jay, Christopher M; Evans, Courtney; Kumar, Padmasini; Phalon, Connor; Rao, Donald D; Senzer, Neil; Nemunaitis, John

    2017-02-01

    Stathmin-1 (STMN1) is a microtubule-destabilizing protein which is overexpressed in cancer. Its overexpression is associated with poor prognosis and also serves as a predictive marker to taxane therapy. We have developed a proprietary bi-functional shRNA (bi-shRNA) platform to execute RNA interference (RNAi)-mediated gene silencing and a liposome-carrier complex to systemically deliver the pbi-shRNA plasmids. In vitro and in vivo testing demonstrated efficacy and specificity of pbi-shRNA plasmid in targeting STMN1 (Phadke, A. P., Jay, C. M., Wang, Z., Chen, S., Liu, S., Haddock, C., Kumar, P., Pappen, B. O., Rao, D. D., Templeton, N. S., et al. (2011). In vivo safety and antitumor efficacy of bifunctional small hairpin RNAs specific for the human Stathmin 1 oncoprotein. DNA Cell Biol. 30, 715-726.). Biodistribution and toxicology studies in bio-relevant Sprague Dawley rats with pbi-shRNA STMN1 lipoplex revealed that the plasmid DNA was delivered to a broad distribution of organs after a single subcutaneous injection. Specifically, plasmid was detected within the first week using QPCR (threshold 50 copies plasmid/1 µg genomic DNA) at the injection site, lung, spleen, blood, skin, ovary (limited), lymph nodes, and liver. It was not detected in the heart, testis or bone marrow. No plasmid was detected from any organ 30 days after injection. Treatment was well tolerated. Minimal inflammation/erythema was observed at the injection site. Circulating cytokine response was also examined by ELISA. The IL-6 levels were induced within 6 h then declined to the vehicle control level 72 h after the injection. TNFα induction was transiently observed 4 days after the DNA lipoplex treatment. In summary, the pbi-shRNA STMN1 lipoplex was well tolerated and displayed broad distribution after a single subcutaneous injection. The pre-clinical data has been filed to FDA and the pbi-shRNA STMN1 lipoplex is being investigated in a phase I clinical study. © The Author 2016. Published

  6. Transport Properties Of PbI2 Doped Silver Oxysalt Based Amorphous Solid Electrolytes

    Science.gov (United States)

    Shrisanjaykumar Jayswal, Manishkumar

    with that a detailed review on fast ion conducting glasses is included. At the end of the chapter, the aim of the present work has been given. Chapter 2: A discussion about various theoretical models to explain fast ion conduction mechanism in superionic conductors in general and superionic conducting glasses in particular is given. In addition to that, impedance spectroscopy and its various formalisms are discussed. Chapter 3: This chapter describes the method of preparation of the glass samples and various characterizations and techniques to study their various properties. Chapter 4: Physical properties of the prepared glass samples are studied and discussed in this chapter. The glass samples are found to be fully amorphous as exhibited by x-ray diffraction studies. The density of the prepared samples is increasing consistently with increasing PbI 2 content in the glass. For glass series (a), the molar volume also increases with PbI2 content. However, for glass series (b) and (c), molar volume is reducing with increasing PbI2 content, showing that glass is getting compacted with increasing PbI2 content. Chapter 5: Transport properties of the prepared glass samples have been investigated using impedance spectroscopy and its various formalisms. The chapter discusses DC conductivity, AC conductivity, dielectric permittivity and modulus analysis of the obtained impedance spectra. The sigma' spectra were scaled using Summerfield scaling law using sigmaDCT as the scaling factor for frequency axis and a well defined Time-Temperature Superposition (TTS) is observed as a function of temperature. The dielectric spectra show the presence of a dielectric relaxation in all glass samples. The dielectric permittivity, epsilon', spectra were scaled using the scaling law given by Sidebottom. The modulus spectra exhibit non-Debye relaxation of Ag+ ions and could be explained using KWW (Kohlrausch-Williams-Watts) decay function. Scaling analysis of the modulus spectra as a function of

  7. Novel EDTA-ligands containing an integral perylene bisimide (PBI) core as an optical reporter unit.

    Science.gov (United States)

    Marcia, Mario; Singh, Prabhpreet; Hauke, Frank; Maggini, Michele; Hirsch, Andreas

    2014-09-28

    The synthesis, characterization and metal complexation of a new class of perylene bisimides (PBIs) as an integral part of ethylenediaminetetraacetic acid (EDTA) are reported. The simplest representative, namely derivative 1a, was synthesized both by a convergent as well as a direct approach while the elongated derivatives, 1b and 1c, were obtained only via a convergent synthetic pathway. All these new prototypes of water-soluble perylenes are bolaamphiphiles and were fully characterized by (1)H- and (13)C-NMR spectroscopy, matrix assisted laser desorption ionization-time of flight (MALDI-TOF) mass spectrometry and IR spectroscopy. In order to acquaint ourselves with the behaviour in solution of our PBIs bearing dendritic wedges, the simplest derivative, 1a, was chosen and tested by means of UV/Vis and fluorescence spectroscopy as well as by zeta-potential measurements. A photoexcitation induced intramolecular photo-electron transfer (PET) can be observed in these molecules. Therefore their potential applications as sensors can be imagined. Model compound 1a efficiently coordinates trivalent metal cations both in water and dimethyl sulfoxide (DMSO). Significantly, the effects of the complexation strongly depend on the aggregation state of the PBI molecules in solution. As a matter of fact, in water, the presence of M(3+) ions triggers the formation of light emitting supramolecular aggregates (excimers). On the other hand, in DMSO-rich solutions metal complexation leads to the suppression of the PET and leads to a strong fluorescence enhancement.

  8. Break-in and Performance Issues on a single cell PBI-based PEM Fuel Cell

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Jespersen, Jesper Lebæk

    of the fuel cell, even though break-in of a fuel cell implemented in a commercial application would most likely not be feasible. In the present work a commercially available PBI-based high temperature MEA is subject to a break-in procedure, as specified by the manufacturer. The cell was operated at 160 °C...... during the break-in procedure at a current density of 0.2 A/cm2. The performance of the cell was measured over the 100 hour break-in period and a polarization curve was recorded after completion of break-in. The performance change was minimal during the break-in cycle. However, in the first hour of op......-eration a significant performance decrease of 30 mV was observed. Hereafter a performance in-crease started and the overall performance change during the break-in procedure was a voltage in-crease of 35 mV corresponding to a rate of 240 μV/hr. The performance increase was however fast-est in the first 50 hours...

  9. The efficiency limit of CH3NH3PbI3 perovskite solar cells

    International Nuclear Information System (INIS)

    Sha, Wei E. I.; Ren, Xingang; Chen, Luzhou; Choy, Wallace C. H.

    2015-01-01

    With the consideration of photon recycling effect, the efficiency limit of methylammonium lead iodide (CH 3 NH 3 PbI 3 ) perovskite solar cells is predicted by a detailed balance model. To obtain convincing predictions, both AM 1.5 spectrum of Sun and experimentally measured complex refractive index of perovskite material are employed in the detailed balance model. The roles of light trapping and angular restriction in improving the maximal output power of thin-film perovskite solar cells are also clarified. The efficiency limit of perovskite cells (without the angular restriction) is about 31%, which approaches to Shockley-Queisser limit (33%) achievable by gallium arsenide (GaAs) cells. Moreover, the Shockley-Queisser limit could be reached with a 200 nm-thick perovskite solar cell, through integrating a wavelength-dependent angular-restriction design with a textured light-trapping structure. Additionally, the influence of the trap-assisted nonradiative recombination on the device efficiency is investigated. The work is fundamentally important to high-performance perovskite photovoltaics

  10. A numerical study on the effects of temperature and mass transfer in high temperature PEM fuel cells with ab-PBI membrane

    International Nuclear Information System (INIS)

    Sun, Hong; Xie, Chen; Chen, Hao; Almheiri, Saif

    2015-01-01

    Highlights: • A two-dimensional model is developed to study the HT-PEMFC with ab-PBI membrane. • The temperature distribution in the ab-PBI membrane is uneven. • With the increase of temperature, the resistance in ab-PBI membrane decreases. • Porosity has the most significant effect on the performance of HT-PEMFC. - Abstract: A two-dimensional, single-phase model is developed to study high temperature proton exchange membrane (HT-PEM) fuel cell with poly(2,5-benzimidazole) (ab-PBI) membrane. In this model, simulation region not only includes the cathode and anode, but also includes ab-PBI membrane; the continuity boundary condition at the interface between the catalyst layer (CL) and the gas diffusion layer (GDL) at each side of the cell is omitted by including the catalyst layers in the respective unified domains for the cathode and the anode. The flows, species, energy, current density are all coupled in the model. Experiments have been conducted to validate the proposed numerical simulations, and it is found that there is a good agreement between the modeling results and those obtained experimentally. By this simulation, not only the oxygen and water fraction distribution in the cathode, but also the temperature distribution and resistance distribution in the ab-PBI membrane are obtained, and the effects of the cell temperature, the porosity in the diffusion layer and its thickness on the current density are analyzed. The innovative researching results are that the temperature distribution is uneven in the ab-PBI membrane and its resistance is greatly affected by the operating temperature. Other results show that the increase of the cell temperature and the porosity in the diffusion layer, and the decrease of the diffusion layer thickness all improve the performance of HT-PEM fuel cells by promoting its internal mass transfer.

  11. Investigation of Structural and Electronic Properties of CH3NH3PbI3 Stabilized by Varying Concentrations of Poly(Methyl Methacrylate (PMMA

    Directory of Open Access Journals (Sweden)

    Celline Awino

    2017-08-01

    Full Text Available Studies have shown that perovskites have a high potential of outdoing silicon based solar cells in terms of solar energy conversion, but their rate of degradation is also high. This study reports on improvement on the stability of CH3NH3PbI3 by passivating it with polymethylmethacrylate (PMMA. Structural and electronic properties of CH3NH3PbI3 stabilized by polymethylmethacrylate (PMMA were investigated by varying concentrations of PMMA in the polymer solutions. Stability tests were performed over a period of time using modulated surface photovoltage (SPV spectroscopy, X-ray diffraction (XRD, and photoluminescence (PL measurements. The XRD patterns confirm the tetragonal structure of the deposited CH3NH3PbI3 for every concentration of PMMA. Furthermore, CH3NH3PbI3 coated with 40 mg/mL of PMMA did not show any impurity phase even after storage in air for 43 days. The Tauc gap (ETauc determined on the basis of the in-phase SPV spectra was found in the range from 1.585 to 1.62 eV for the samples stored during initial days, but shifted towards lower energies as the storage time increased. This can be proposed to be due to different chemical reactions between CH3NH3PbI3/PMMA interfaces and air. PL intensity increased with increasing concentration of PMMA except for the perovskite coated with 40 mg/mL of PMMA. PL quenching in the perovskite coated with 40 mg/mL of PMMA can be interpreted as fast electron transfer towards the substrate in the sample. This study shows that, with an optimum concentration of PMMA coating on CH3NH3PbI3, the lifetime and hence stability on electrical and structural behavior of CH3NH3PbI3 is improved.

  12. Observation of the long-lived triplet excited state of perylenebisimide (PBI) in C^N cyclometalated Ir(III) complexes and application in photocatalytic oxidation.

    Science.gov (United States)

    Sun, Jifu; Zhong, Fangfang; Zhao, Jianzhang

    2013-07-14

    Perylenebisimide (PBI) was used to prepare C^N cyclometalated Ir(III) complexes that show strong absorption of visible light and it is the first time the long-lived triplet excited state of PBI chromophore was observed in a transition metal complex (τT = 22.3 μs). Previously, the lifetime of the triplet state of PBI in transition metal complexes was usually shorter than 1.0 μs. Long-lived triplet excited states are useful for applications in photocatalysis or other photophysical processes concerning triplet-triplet-energy-transfer. PBI and amino-PBI were used for preparation of cyclometalated Ir(III) complexes (Ir-2 and Ir-3), in which the PBI chromophore was connected to the coordination center via C≡C π-conjugation bond. The new complexes show strong absorption in visible region (ε = 34,200 M(-1) cm(-1) at 541 nm for Ir-2, and ε = 19,000 at 669 nm for Ir-3), compared to the model complex Ir(ppy)(bpy)[PF6] Ir-1 (ε PBI-localized long-lived (3)IL states were populated for Ir-2 and Ir-3 upon photoexcitation. The complexes were used as triplet photosensitizers for (1)O2-mediated photooxidation of 1,5-dihydronaphthalene to produce juglone, an important intermediate for preparation of anti-cancer compounds. (1)O2 quantum yields (Φ(Δ)) up to 91% were observed for the new Ir(III) complexes and the overall photosensitizing ability is much higher than the conventional Ir(III) complex Ir-1, which shows the typical weak visible light absorption in visible region. Our results are useful for preparation of transition metal complexes that show strong absorption of visible light and long-lived triplet excited state and for the application of these complexes in photocatalysis.

  13. Improvement of photovoltaic performance of the inverted planar perovskite solar cells by using CH3NH3PbI3-xBrx films with solvent annealing

    Science.gov (United States)

    Wang, Shan; Zhang, Weijia; Ma, Denghao; Jiang, Zhaoyi; Fan, Zhiqiang; Ma, Qiang; Xi, Yilian

    2018-01-01

    In this paper, the CH3NH3PbI3-xBrx films with various Br-doping contents were successfully prepared by solution processed deposition and followed by annealing process. This method simultaneously modified the morphology and composition of the CH3NH3PbI3 film. The effects of annealing treatment of CH3NH3PbI3-xBrx films under N2 and DMSO conditions on the microstructure of films and photoelectric properties of the solar cells were systematically investigated. The relationship of the component ratio of RBr/I= CH3NH3PbI3-xBrx/CH3NH3PbI3 in the resulting perovskite versus CH3NH3Br concentration also was explored. The results revealed that the CH3NH3PbI3-xBrx films annealed under DMSO exhibited increased grain sizes, enhanced crystallinity, enlarged bandgap and reduced defect density compared with that of the N2 annealing. It also was found that the RBr/I linearly increased in the resulting perovskite with the increased of CH3NH3Br concentration in the methylammonium halide mixture solutions. Furthermore, the photovoltaic performances of devices fabricated using DMSO precursor solvent were worse than that of DMF under N2 annealing atmosphere. When CH3NH3Br concentration was 7.5 mg ml-1, the planar perovskite solar cell based on CH3NH3PbI3-xBrx annealed under DMSO showed the best efficiency of 13.7%.

  14. Low-temperature (75 °C) solid-state reaction enhanced by less-crystallized nanoporous PbI2 films for efficient CH3NH3PbI3 perovskite solar cells

    International Nuclear Information System (INIS)

    Zheng, Huifeng; Liu, Yangqiao; Sun, Jing

    2017-01-01

    Highlights: • Efficient perovskite solar cells were prepared with solid-state reaction at 75 °C. • Ln-PbI 2 is superior to c-PbI 2 when applied in low-temperature solid-state reaction. • A higher champion PCE was obtained at 75 °C (13.8%) than that of 140 °C (11.8%). • Non-radiative defects increase significantly when annealed at high temperature. - Abstract: Organohalide perovskite films are usually prepared with the solid-state reaction at a high temperature ≥100 °C, which causes the increase of non-radiative defects and decomposition of perovskite films. Here, we demonstrate it’s feasible to prepare high-quality perovskite films with the solid-state reaction method even at a temperature of 75 °C, when enhanced by less-crystallized nanoporous PbI 2 (ln-PbI 2 ) films. The replacement of compact PbI 2 (c-PbI 2 ) by ln-PbI 2 , results in a significant improvement of crystallinity of perovskite films, besides the elimination of remnant PbI 2 . As a result, ln-PbI 2 based perovskite solar cells display much higher power conversion efficiency (PCE) and better stability. Moreover, annealing duration was found to be critical for high PCE and was optimized as 60 min. Finally, with the optimal process, the champion device displayed a PCE of 13.8% and the average PCE reached 10.1% with a satisfactory deviation. Furthermore, we found annealing at high temperature (140 °C) led to a lower PCE compared with that annealed at 75 °C, because non-radiative defects increased significantly during high-temperature annealing. This work may open up a promising avenue for preparing high-quality perovskite films with the low-temperature solid-state reaction method, which is desirable for real application.

  15. Hexamethylenetetramine-mediated growth of grain-boundary-passivation CH3NH3PbI3 for highly reproducible and stable perovskite solar cells

    Science.gov (United States)

    Zheng, Yan-Zhen; Li, Xi-Tao; Zhao, Er-Fei; Lv, Xin-Ding; Meng, Fan-Li; Peng, Chao; Lai, Xue-Sen; Huang, Meilan; Cao, Guozhong; Tao, Xia; Chen, Jian-Feng

    2018-02-01

    Simultaneously achieving the long-term device stability and reproducibility has proven challenging in perovskite solar cells because solution-processing produced perovskite film with grain boundary is sensitive to moisture. Herein, we develop a hexamethylenetetramine (HMTA)-mediated one-step solution-processing deposition strategy that leads to the formation of high-purity and grain-boundary-passivation CH3NH3PbI3 film and thereby advances cell optoelectronic performance. Through morphological and structural characterizations and theoretical calculations, we demonstrate that HMTA fully occupies the moisture-exposed surface to build a bridge across grain boundary and coordinates with Pb ions to inhibit the formation of detrimental PbI2. Such HMTA-mediated grown CH3NH3PbI3 films achieves a decent augmentation of power conversion efficiency (PCE) from 12.70% to 17.87%. A full coverage of PbI2-free CH3NH3PbI3 surface on ZnO also boosts the device's stability and reproducibility.

  16. Dual activities of the anti-cancer drug candidate PBI-05204 provide neuroprotection in brain slice models for neurodegenerative diseases and stroke.

    Science.gov (United States)

    Van Kanegan, Michael J; Dunn, Denise E; Kaltenbach, Linda S; Shah, Bijal; He, Dong Ning; McCoy, Daniel D; Yang, Peiying; Peng, Jiangnan; Shen, Li; Du, Lin; Cichewicz, Robert H; Newman, Robert A; Lo, Donald C

    2016-05-12

    We previously reported neuroprotective activity of the botanical anti-cancer drug candidate PBI-05204, a supercritical CO2 extract of Nerium oleander, in brain slice and in vivo models of ischemic stroke. We showed that one component of this neuroprotective activity is mediated through its principal cardiac glycoside constituent, oleandrin, via induction of the potent neurotrophic factor brain-derived neurotrophic factor (BDNF). However, we also noted that the concentration-relation for PBI-05204 in the brain slice oxygen-glucose deprivation (OGD) model is considerably broader than that for oleandrin as a single agent. We thus surmised that PBI-05204 contains an additional neuroprotective component(s), distinct from oleandrin. We report here that neuroprotective activity is also provided by the triterpenoid constituents of PBI-05204, notably oleanolic acid. We demonstrate that a sub-fraction of PBI-05204 (Fraction 0-4) containing oleanolic and other triterpenoids, but without cardiac glycosides, induces the expression of cellular antioxidant gene transcription programs regulated through antioxidant transcriptional response elements (AREs). Finally, we show that Fraction 0-4 provides broad neuroprotection in organotypic brain slice models for neurodegeneration driven by amyloid precursor protein (APP) and tau implicated in Alzheimer's disease and frontotemporal dementias, respectively, in addition to ischemic injury modeled by OGD.

  17. The Effect of Solvents on the Performance of CH3NH3PbI3 Perovskite Solar Cells

    Directory of Open Access Journals (Sweden)

    Pao-Hsun Huang

    2017-04-01

    Full Text Available The properties of perovskite solar cells (PSCs fabricated using various solvents was studied. The devices had an indium tin oxide (ITO/poly(3,4-ethylenedioxythiophene: poly(styrenesulfonate (PEDOT:PSS/CH3NH3PbI3 (fabricated by using various solvents/fullerene (C60/bathocuproine (BCP/silver (Ag structure. The solvents used were dimethylformamide (DMF, γ-butyrolactone (GBL, dimethyl sulfoxide (DMSO, a mixture of DMSO and DMF (1:1 v/v, and a mixture of DMSO and GBL (DMSO: GBL, 1:1 v/v, respectively. The power conversion efficiency (PCE of the device fabricated using DMF is zero, which is attributed to the poor coverage of CH3NH3PbI3 film on the substrate. In addition, the PCE of the device made using GBL is only 1.74% due to the low solubility of PbI2 and CH3NH3I. In contrast, the PCE of the device fabricated using the solvents containing DMSO showed better performance. This is ascribed to the high solubilization properties and strong coordination of DMSO. As a result, a PCE of 9.77% was obtained using a mixed DMSO:GBL solvent due to the smooth surface, uniform film coverage on the substrate and the high crystallization of the perovskite structure. Finally, a mixed DMSO: DMF:GBL (5:2:3 v/v/v solvent that combined the advantages of each solvent was used to fabricate a device, leading to a further improvement of the PCE of the resulting PSC to 10.84%.

  18. Interfacial electronic structures revealed at the rubrene/CH3NH3PbI3 interface.

    Science.gov (United States)

    Ji, Gengwu; Zheng, Guanhaojie; Zhao, Bin; Song, Fei; Zhang, Xiaonan; Shen, Kongchao; Yang, Yingguo; Xiong, Yimin; Gao, Xingyu; Cao, Liang; Qi, Dong-Chen

    2017-03-01

    The electronic structures of rubrene films deposited on CH 3 NH 3 PbI 3 perovskite have been investigated using in situ ultraviolet photoelectron spectroscopy (UPS) and X-ray photoelectron spectroscopy (XPS). It was found that rubrene molecules interacted weakly with the perovskite substrate. Due to charge redistribution at their interface, a downward 'band bending'-like energy shift of ∼0.3 eV and an upward band bending of ∼0.1 eV were identified at the upper rubrene side and the CH 3 NH 3 PbI 3 substrate side, respectively. After the energy level alignment was established at the rubrene/CH 3 NH 3 PbI 3 interface, its highest occupied molecular orbital (HOMO)-valence band maximum (VBM) offset was found to be as low as ∼0.1 eV favoring the hole extraction with its lowest unoccupied molecular orbital (LUMO)-conduction band minimum (CBM) offset as large as ∼1.4 eV effectively blocking the undesired electron transfer from perovskite to rubrene. As a demonstration, simple inverted planar solar cell devices incorporating rubrene and rubrene/poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) hole transport layers (HTLs) were fabricated in this work and yielded a champion power conversion efficiency of 8.76% and 13.52%, respectively. Thus, the present work suggests that a rubrene thin film could serve as a promising hole transport layer for efficient perovskite-based solar cells.

  19. Photovoltaic properties of Cu-doped CH3NH3PbI3 with perovskite structure

    Science.gov (United States)

    Shirahata, Yasuhiro; Oku, Takeo

    2017-01-01

    Photovoltaic properties of copper (Cu)-doped perovskite (CH3NH3PbCuxI3+x) photovoltaic devices with different Cu content were investigated. The CH3NH3PbCuxI3+x films were polycrystalline with a tetragonal system, and their lattice constants and crystallite size varied with Cu doping. Compared to conversion efficiencies of non-doped CH3NH3PbI3 photovoltaic device, those of CH3NH3PbCuxI3+x photovoltaic devises increased. The improvement of photovoltaic properties was attributed to partial substitution of Cu at the Pb sites.

  20. Investigating the effects of methanol-water vapor mixture on a PBI-based high temperature PEM fuel cell

    DEFF Research Database (Denmark)

    Araya, Samuel Simon; Andreasen, Søren Juhl; Nielsen, Heidi Venstrup

    2012-01-01

    This paper investigates the effects of methanol and water vapor on the performance of a high temperature proton exchange membrane fuel cell (HT-PEMFC). A H3PO4-doped polybenzimidazole (PBI) membrane electrode assembly (MEA), Celtec P2100 of 45 cm2 of active surface area from BASF was employed....... A long-term durability test of around 1250 h was performed, in which the concentrations of methanol-water vapor mixture in the anode feed gas were varied. The fuel cell showed a continuous performance decay in the presence of vapor mixtures of methanol and water of 5% and 8% by volume in anode feed...

  1. Relationship between microstructure and optical properties of a novel perovskite C12PbI4 embedded in matrix of porous alumina

    Science.gov (United States)

    Zaghdoudi, W.; Bardaoui, A.; Khalifa, N.; Chtourou, R.

    2013-01-01

    In this study, organic-inorganic hybrid perovskite multiple quantum wells (PbI QWs) embedded in porous anodic alumina (PAA) thin films on glass and aluminum substrates are investigated in detail. The pore height and diameter of the nanoscale structure of porous anodic alumina (PAA) film produced by the anodization technique are controllable. The synthesized films are characterized morphologically using the atomic force microscopy (AFM). Scanning electron microscopy (SEM) study showed granular surface. The structural and optical properties were investigated by X-ray diffraction (XRD), photoluminescence (PL) and UV-Vis-NIR spectrophotometer. The effect of the two different substrates on the impregnation of the PbI QW in the PAA is presented. Both PL and AFM studies show a better penetration of the PbI QW in the case of the Al substrate providing a wider pore diameter. Remarkable enhancement of quantum confinement is demonstrated.

  2. Effects of CsBr addition on the performance of CH3NH3PbI3-xClx-based solar cells

    Science.gov (United States)

    Ueoka, Naoki; Oku, Takeo; Ohishi, Yuya; Tanaka, Hiroki; Suzuki, Atsushi; Sakamoto, Hiroki; Yamada, Masahiro; Minami, Satoshi; Tsukada, Shinichiro

    2018-01-01

    Perovskite-type photovoltaic devices were prepared by a spin-coating method using a precursor solution of CH3NH3I and lead(II) chloride in N,N-dimethylformamide. Effects of cesium bromide (CsBr) addition on the photovoltaic properties and microstructures of the perovskite phase were investigated. The fill factor was increased by adding the CsBr to the CH3NH3PbI3-xClx precursor solution, which resulted in increase of the conversion efficiency. The crystallinity of the CH3NH3PbI3-xClx perovskite phase was also improved by adding the CsBr to the H3NH3PbI3-xClx precursor solution.

  3. Room temperature atomic layer deposited Al2O3 on CH3NH3PbI3 characterized by synchrotron-based X-ray photoelectron spectroscopy

    Science.gov (United States)

    Kot, Małgorzata; Das, Chittaranjan; Henkel, Karsten; Wojciechowski, Konrad; Snaith, Henry J.; Schmeisser, Dieter

    2017-11-01

    An ultrathin Al2O3 film deposited on methylammonium lead triiodide (CH3NH3PbI3) perovskite has the capability to suppress the carrier recombination process and improve the perovskite solar cells efficiency and stability. However, annealing at temperatures higher than 85 °C degrades the CH3NH3PbI3 perovskite film. The X-ray photoelectron spectroscopy study performed in this work indicates that it is possible to grow Al2O3 by atomic layer deposition on the perovskite at room temperature, however, besides pure Al2O3 some OH groups are found and the creation of lead and iodine oxides at the Al2O3/CH3NH3PbI3 interface takes place.

  4. Multiple-Stage Structure Transformation of Organic-Inorganic Hybrid Perovskite CH3NH3PbI3

    Science.gov (United States)

    Chen, Qiong; Liu, Henan; Kim, Hui-Seon; Liu, Yucheng; Yang, Mengjin; Yue, Naili; Ren, Gang; Zhu, Kai; Liu, Shengzhong; Park, Nam-Gyu; Zhang, Yong

    2016-07-01

    By performing spatially resolved Raman and photoluminescence spectroscopy with varying excitation wavelength, density, and data acquisition parameters, we achieve a unified understanding towards the spectroscopy signatures of the organic-inorganic hybrid perovskite, transforming from the pristine state (CH3NH3PbI3 ) to the fully degraded state (i.e., PbI2 ) for samples with varying crystalline domain size from mesoscopic scale (approximately 100 nm) to macroscopic size (centimeters), synthesized by three different techniques. We show that the hybrid perovskite exhibits multiple stages of structure transformation occurring either spontaneously or under light illumination, with exceptionally high sensitivity to the illumination conditions (e.g., power, illumination time, and interruption pattern). We highlight four transformation stages (stages I-IV, with stage I being the pristine state) along either the spontaneous or photoinduced degradation path exhibiting distinctly different Raman spectroscopy features at each stage, and point out that previously reported Raman spectra in the literature reflect highly degraded structures of either stage III or stage IV. Additional characteristic optical features of partially degraded materials under the joint action of spontaneous and photodegradation are also given. This study offers reliable benchmark results for understanding the intrinsic material properties and structure transformation of this unique category of hybrid materials, and the findings are pertinently important to a wide range of potential applications where the hybrid material is expected to function in greatly different environment and light-matter interaction conditions.

  5. Formation Dynamics of CH3NH3PbI3 Perovskite Following Two-Step Layer Deposition.

    Science.gov (United States)

    Patel, Jay B; Milot, Rebecca L; Wright, Adam D; Herz, Laura M; Johnston, Michael B

    2016-01-07

    Hybrid metal-halide perovskites have emerged as a leading class of semiconductors for optoelectronic devices because of their desirable material properties and versatile fabrication methods. However, little is known about the chemical transformations that occur in the initial stages of perovskite crystal formation. Here we follow the real-time formation dynamics of MAPbI3 from a bilayer of lead iodide (PbI2) and methylammonium iodide (MAI) deposited through a two-step thermal evaporation process. By lowering the substrate temperature during deposition, we are able to initially inhibit intermixing of the two layers. We subsequently use infrared and visible light transmission, X-ray diffraction, and photoluminescence lifetime measurements to reveal the room-temperature transformations that occur in vacuum and ambient air, as MAI diffuses into the PbI2 lattice to form MAPbI3. In vacuum, the transformation to MAPbI3 is incomplete as unreacted MAI is retained in the film. However, exposure to moist air allows for conversion of the unreacted MAI to MAPbI3, demonstrating that moisture is essential in making MAI more mobile and thus aiding perovskite crystallization. These dynamic processes are reflected in the observed charge-carrier lifetimes, which strongly fluctuate during periods of large ion migration but steadily increase with improving crystallinity.

  6. Chlorine Incorporation in the CH3NH3PbI3 Perovskite: Small Concentration, Big Effect.

    Science.gov (United States)

    Quarti, Claudio; Mosconi, Edoardo; Umari, Paolo; De Angelis, Filippo

    2017-01-03

    The role of chlorine doping in CH 3 NH 3 PbI 3 represents an important open issue in the use of hybrid perovskites for photovoltaic applications. In particular, even if a positive role of chlorine doping on perovskite film formation and on material morphology has been demonstrated, an inherent positive effect on the electronic and photovoltaic properties cannot be excluded. Here we carried out periodic density functional theory and Car-Parrinello molecular dynamics simulations, going down to ∼1% doping, to investigate the effect of chlorine on CH 3 NH 3 PbI 3 . We found that such a small doping has important effects on the dynamics of the crystalline structure, both with respect to the inorganic framework and with respect to the cation libration motion. Together, we observe a dynamic spatial localization of the valence and conduction states in separated spatial material regions, which takes place in the 10 -1 ps time scale and which could be the key to ease of exciton dissociation and, likely, to small charge recombination in hybrid perovskites. Moreover, such localization is enhanced by chlorine doping, demonstrating an inherent positive role of chlorine doping on the electronic properties of this class of materials.

  7. Sequence and annotation of the 314-kb MT325 and the 321-kb FR483 viruses that infect Chlorella Pbi.

    Science.gov (United States)

    Fitzgerald, Lisa A; Graves, Michael V; Li, Xiao; Feldblyum, Tamara; Hartigan, James; Van Etten, James L

    2007-02-20

    Viruses MT325 and FR483, members of the family Phycodnaviridae, genus Chlorovirus, infect the fresh water, unicellular, eukaryotic, chlorella-like green alga, Chlorella Pbi. The 314,335-bp genome of MT325 and the 321,240-bp genome of FR483 are the first viruses that infect Chlorella Pbi to have their genomes sequenced and annotated. Furthermore, these genomes are the two smallest chlorella virus genomes sequenced to date, MT325 has 331 putative protein-encoding and 10 tRNA-encoding genes and FR483 has 335 putative protein-encoding and 9 tRNA-encoding genes. The protein-encoding genes are almost evenly distributed on both strands, and intergenic space is minimal. Approximately 40% of the viral gene products resemble entries in public databases, including some that are the first of their kind to be detected in a virus. For example, these unique gene products include an aquaglyceroporin in MT325, a potassium ion transporter protein and an alkyl sulfatase in FR483, and a dTDP-glucose pyrophosphorylase in both viruses. Comparison of MT325 and FR483 protein-encoding genes with the prototype chlorella virus PBCV-1 indicates that approximately 82% of the genes are present in all three viruses.

  8. Evolution of Photoluminescence, Raman, and Structure of CH3NH3PbI3 Perovskite Microwires Under Humidity Exposure

    Science.gov (United States)

    Segovia, Rubén; Qu, Geyang; Peng, Miao; Sun, Xiudong; Shi, Hongyan; Gao, Bo

    2018-03-01

    Self-assembled organic-inorganic CH3NH3PbI3 perovskite microwires (MWs) upon humidity exposure along several weeks were investigated by photoluminescence (PL) spectroscopy, Raman spectroscopy, and X-ray diffraction (XRD). We show that, in addition to the common perovskite decomposition into PbI2 and the formation of a hydrated phase, humidity induced a gradual PL redshift at the initial weeks that is stabilized for longer exposure ( 21 nm over the degradation process) and an intensity enhancement. Original perovskite Raman band and XRD reflections slightly shifted upon humidity, indicating defects formation and structure distortion of the MWs crystal lattice. By correlating the PL, Raman, and XRD results, it is believed that the redshift of the MWs PL emission was originated from the structural disorder caused by the incorporation of H2O molecules in the crystal lattice and radiative recombination through moisture-induced subgap trap states. Our study provides insights into the optical and structural response of organic-inorganic perovskite materials upon humidity exposure.

  9. The pure rotational spectra of the open-shell diatomic molecules PbI and SnI

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Corey J., E-mail: cje8@le.ac.uk, E-mail: nick.walker@newcastle.ac.uk; Needham, Lisa-Maria E. [Department of Chemistry, University of Leicester, Leicester LE1 7RH (United Kingdom); Walker, Nicholas R., E-mail: cje8@le.ac.uk, E-mail: nick.walker@newcastle.ac.uk; Köckert, Hansjochen; Zaleski, Daniel P.; Stephens, Susanna L. [School of Chemistry, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom)

    2015-12-28

    Pure rotational spectra of the ground electronic states of lead monoiodide and tin monoiodide have been measured using a chirped pulsed Fourier transform microwave spectrometer over the 7-18.5 GHz region for the first time. Each of PbI and SnI has a X {sup 2}Π{sub 1/2} ground electronic state and may have a hyperfine structure that aids the determination of the electron electric dipole moment. For each species, pure rotational transitions of a number of different isotopologues and their excited vibrational states have been assigned and fitted. A multi-isotopologue Dunham-type analysis was carried out on both species producing values for Y{sub 01}, Y{sub 02}, Y{sub 11}, and Y{sub 21}, along with Λ-doubling constants, magnetic hyperfine constants and nuclear quadrupole coupling constants. The Born-Oppenheimer breakdown parameters for Pb have been evaluated and the parameter rationalized in terms of finite nuclear field effects. Analysis of the bond lengths and hyperfine interaction indicates that the bonding in both PbI and SnI is ionic in nature. Equilibrium bond lengths have been evaluated for both species.

  10. The pure rotational spectra of the open-shell diatomic molecules PbI and SnI.

    Science.gov (United States)

    Evans, Corey J; Needham, Lisa-Maria E; Walker, Nicholas R; Köckert, Hansjochen; Zaleski, Daniel P; Stephens, Susanna L

    2015-12-28

    Pure rotational spectra of the ground electronic states of lead monoiodide and tin monoiodide have been measured using a chirped pulsed Fourier transform microwave spectrometer over the 7-18.5 GHz region for the first time. Each of PbI and SnI has a X (2)Π1/2 ground electronic state and may have a hyperfine structure that aids the determination of the electron electric dipole moment. For each species, pure rotational transitions of a number of different isotopologues and their excited vibrational states have been assigned and fitted. A multi-isotopologue Dunham-type analysis was carried out on both species producing values for Y01, Y02, Y11, and Y21, along with Λ-doubling constants, magnetic hyperfine constants and nuclear quadrupole coupling constants. The Born-Oppenheimer breakdown parameters for Pb have been evaluated and the parameter rationalized in terms of finite nuclear field effects. Analysis of the bond lengths and hyperfine interaction indicates that the bonding in both PbI and SnI is ionic in nature. Equilibrium bond lengths have been evaluated for both species.

  11. Preclinical Justification of pbi-shRNA EWS/FLI1 Lipoplex (LPX) Treatment for Ewing's Sarcoma.

    Science.gov (United States)

    Rao, Donald D; Jay, Christopher; Wang, Zhaohui; Luo, Xiuquan; Kumar, Padmasini; Eysenbach, Hilary; Ghisoli, Maurizio; Senzer, Neil; Nemunaitis, John

    2016-08-01

    The EWS/FLI1 fusion gene is well characterized as a driver of Ewing's sarcoma. Bi-shRNA EWS/FLI1 is a functional plasmid DNA construct that transcribes both siRNA and miRNA-like effectors each of which targets the identical type 1 translocation junction region of the EWS/FLI1 transcribed mRNA sequence. Previous preclinical and clinical studies confirm the safety of this RNA interference platform technology and consistently demonstrate designated mRNA and protein target knockdown at greater than 90% efficiency. We initiated development of pbi-shRNA EWS/FLI1 lipoplex (LPX) for the treatment of type 1 Ewing's sarcoma. Clinical-grade plasmid was manufactured and both sequence and activity verified. Target protein and RNA knockdown of 85-92% was demonstrated in vitro in type 1 human Ewing's sarcoma tumor cell lines with the optimal bi-shRNA EWS/FLI1 plasmid. This functional plasmid was placed in a clinically tested, liposomal (LP) delivery vehicle followed by in vivo verification of activity. Type 1 Ewing's sarcoma xenograft modeling confirmed dose related safety and tumor response to pbi-shRNA EWS/FLI1 LPX. Toxicology studies in mini-pigs with doses comparable to the demonstrated in vivo efficacy dose resulted in transient fever, occasional limited hypertension at low- and high-dose assessment and transient liver enzyme elevation at high dose. These results provide the justification to initiate clinical testing.

  12. Incorporating C60 as Nucleation Sites Optimizing PbI2 Films To Achieve Perovskite Solar Cells Showing Excellent Efficiency and Stability via Vapor-Assisted Deposition Method.

    Science.gov (United States)

    Chen, Hai-Bin; Ding, Xi-Hong; Pan, Xu; Hayat, Tasawar; Alsaedi, Ahmed; Ding, Yong; Dai, Song-Yuan

    2018-01-24

    To achieve high-quality perovskite solar cells (PSCs), the morphology and carrier transportation of perovskite films need to be optimized. Herein, C 60 is employed as nucleation sites in PbI 2 precursor solution to optimize the morphology of perovskite films via vapor-assisted deposition process. Accompanying the homogeneous nucleation of PbI 2 , the incorporation of C 60 as heterogeneous nucleation sites can lower the nucleation free energy of PbI 2 , which facilitates the diffusion and reaction between PbI 2 and organic source. Meanwhile, C 60 could enhance carrier transportation and reduce charge recombination in the perovskite layer due to its high electron mobility and conductivity. In addition, the grain sizes of perovskite get larger with C 60 optimizing, which can reduce the grain boundaries and voids in perovskite and prevent the corrosion because of moisture. As a result, we obtain PSCs with a power conversion efficiency (PCE) of 18.33% and excellent stability. The PCEs of unsealed devices drop less than 10% in a dehumidification cabinet after 100 days and remain at 75% of the initial PCE during exposure to ambient air (humidity > 60% RH, temperature > 30 °C) for 30 days.

  13. Hybrid perovskite solar cells: In situ investigation of solution-processed PbI2 reveals metastable precursors and a pathway to producing porous thin films

    KAUST Repository

    Barrit, Dounya; Sheikh, Arif D.; Munir, Rahim; Barbe, Jeremy; Li, Ruipeng; Smilgies, Detlef-M.; Amassian, Aram

    2017-01-01

    from a DMF solution by performing in situ grazing incidence wide angle X-ray scattering (GIWAXS) measurements. The measurements reveal an elaborate sol–gel process involving three PbI2⋅DMF solvate complexes—including disordered and ordered ones

  14. Interfacial Charge-Carrier Trapping in CH3NH3PbI3-Based Heterolayered Structures Revealed by Time-Resolved Photoluminescence Spectroscopy.

    Science.gov (United States)

    Yamada, Yasuhiro; Yamada, Takumi; Shimazaki, Ai; Wakamiya, Atsushi; Kanemitsu, Yoshihiko

    2016-06-02

    The fast-decaying component of photoluminescence (PL) under very weak pulse photoexcitation is dominated by the rapid relaxation of the photoexcited carriers into a small number of carrier-trapping defect states. Here, we report the subnanosecond decay of the PL under excitation weaker than 1 nJ/cm(2) both in CH3NH3PbI3-based heterostructures and bare thin films. The trap-site density at the interface was evaluated on the basis of the fluence-dependent PL decay profiles. It was found that high-density defects determining the PL decay dynamics are formed near the interface between CH3NH3PbI3 and the hole-transporting Spiro-OMeTAD but not at the CH3NH3PbI3/TiO2 interface and the interior regions of CH3NH3PbI3 films. This finding can aid the fabrication of high-quality heterointerfaces, which are required improving the photoconversion efficiency of perovskite-based solar cells.

  15. Larger spontaneous polarization ferroelectric inorganic-organic hybrids: [PbI3](infinity) chains directed organic cations aggregation to Kagomé-shaped tubular architecture.

    Science.gov (United States)

    Zhao, Hai-Rong; Li, Dong-Ping; Ren, Xiao-Ming; Song, You; Jin, Wan-Qin

    2010-01-13

    Four isostructural inorganic-organic hybrid ferroelectric compounds, assembled from achiral 3-R-benzylidene-1-aminopyridiniums (R = NO(2), Br, Cl, or F for 1-4, respectively) and [PbI(3)](-) anions with the chiral Kagomé-shaped tubular aggregating architecture, show larger spontaneous polarizations.

  16. Effects of hot airflow during spin-coating process on CH3NH3PbI3-xClx perovskite solar cells

    Science.gov (United States)

    Tanaka, Hiroki; Ohishi, Yuya; Oku, Takeo

    2018-01-01

    CH3NH3PbI3-xClx photovoltaic devices were fabricated, and the effects of hot airflow during spin-coating were investigated. Cubic perovskite crystals that is a high temperature phase were obtained by the hot airflow method. The conversion efficiencies of the devices prepared by the hot airflow were remained even after 56 days.

  17. The post-growth treatment of PbI2 thick films as an attempt to suppress the films surface effect

    International Nuclear Information System (INIS)

    Dmitriev, Yuri; Bennett, Paul R.; Cirignano, Leonard J.; Klugerman, Mikhail; Shah, Kanai S.

    2008-01-01

    PbI 2 thick films were coated with different materials (Parylene C, HumiSeal and PbBr 2 ) in order to improve the films' surface properties. It was shown that Parylene C and HumiSeal coating decreased the dark current of PbI 2 films and changed the shape of the I-V and I-t curves. X-ray-irradiated films demonstrated a significant increase in signal-to-noise ratio due to a decrease in the dark current, a slightly increased rise time, and a decreased decay time compared to non-coated PbI 2 films. In addition, Pd atoms from the electrical contact easily penetrated the Parylene C protective layer over a period of 1-2 h. The Pd diffusion coefficient and Parylene C dark resistivity estimated from these experiments were D Pd =(3.6±2.1)x10 -13 cm 2 /s and ρ ParyleneC =(130±70) T Ω cm, respectively. Only the PbBr 2 coating led to decreased rise and decay times compared to non-coated PbI 2 films

  18. Improvement of CH3NH3PbI3 thin film using the additive 1,8-diiodooctane for planar heterojunction perovskite cells

    Science.gov (United States)

    Abdulrahman, Solh; Wang, Chunhua; Cao, Chenghao; Zhang, Chujun; Yang, Junliang; Jiang, Li

    2017-10-01

    The thin-film quality is critical for obtaining high-performance perovskite solar cells (PSCs). The additive 1,8-diiodooctane (DIO) was used to control the morphology and structure of CH3NH3PbI3 perovskite thin films, and planar heterojunction (PHJ) PSCs with an architecture of ITO/PEDOT: PSS/CH3NH3PbI3/PCBM/Al was fabricated. It was found that the DIO played an important role on CH3NH3PbI3 thin-film quality and the performance of PHJ-PSCs. With the optimal volume ratio of 2%, the compact and uniform high-quality CH3NH3PbI3 thin films with enhanced crystallinity and less roughness were achieved, resulting in the great improvement of power conversion efficiency (PCE) from about 4.5% to over 9.0%. The research results indicate that the additive DIO is a simple and effective method to produce high-quality perovskite thin film and accordingly develop high-performance PHJ-PSCs.

  19. T-x-y diagrams for reciprocal systems PbX + CdI2 = CdX + PbI2 (X=S, Se, Te)

    International Nuclear Information System (INIS)

    Odin, I.N.

    2001-01-01

    The present research is undertaken in search of the new complex phases with interesting physical properties. The synthesized samples was analyzed by differential thermal, X-ray diffraction and microstructural methods. The diagonal cross-section CdTe - PbI 2 of the mutual PbTe + CdI 2 = CdTe + PbI 2 system is stable. The T-x phase diagram of the CdTe - PbI 2 system possess eutectic type, the coordinates of eutectic point is 657 ± 2 K, 15 ± 1 mol. % of CdTe. The lead iodide based solid solutions with the mixed structure and the CdTe based solid solutions take place in the equilibria. Solid CdTe dissolves 0.2 mol. % PbI 2 . The fields of the primary crystallization of the CdTe, Pb 1-x Cd x I 2 , PbTe based solid solutions are on the liquidus surface [ru

  20. Impact of CH3NH3PbI3-PCBM bulk heterojunction active layer on the photovoltaic performance of perovskite solar cells

    Science.gov (United States)

    Chaudhary, Dhirendra K.; Kumar, Pankaj; Kumar, Lokendra

    2017-10-01

    We report here the impact of CH3NH3PbI3-PCBM bulk heterojunction (BHJ) active layer on the photovoltaic performance of perovskite solar cells. The solar cells were prepared in normal architecture on FTO coated glass substrates with compact TiO2 (c-TiO2) layer on FTO as electron transport layer (ETL) and poly(3-hexylthiophene) (P3HT) as hole transport layer (HTL). For comparison, a few solar cells were also prepared in planar heterojunction structure using CH3NH3PbI3 only as the active layer. The bulk heterojunction CH3NH3PbI3-PCBM active layer exhibited very large crystalline grains of 2-3 μm compared to ∼150 nm only in CH3NH3PbI3 active layer. Larger grains in bulk-heterojunction solar cells resulted in enhanced power conversion efficiency (PCE) through enhancement in all the photovoltaic parameters compared to planar heterojunction solar cells. The bulk-heterojunction solar cells exhibited ∼9.25% PCE with short circuit current density (Jsc) of ∼18.649 mA/cm2, open circuit voltage (Voc) of 0.894 V and Fill Factor (FF) of 0.554. There was ∼36.9% enhancement in the PCE of bulk-heterojunction solar cells compared to that of planar heterojunction solar cells. The larger grains are formed as a result of incorporation on PCBM in the active layer.

  1. Species Boundaries and Interrelationships of Solanum Sect. Petota (Wild and Cultivated Potatoes) are Drastically Altered as a Result of PBI-Funded Research

    Science.gov (United States)

    In 1990, the latest comprehensive taxonomic monograph of Solanum section Petota Dumort recognized 232 species partitioned into 21 series. PBI-sponsored research has drastically altered knowledge of their species boundaries and interrelationships. The series contains diploids (2n = 2x = 24), tetraplo...

  2. Facile hydrothermal synthesis and characterization of cesium-doped PbI2 nanostructures for optoelectronic, radiation detection and photocatalytic applications

    Science.gov (United States)

    Shkir, Mohd; AlFaify, S.; Yahia, I. S.; Hamdy, Mohamed S.; Ganesh, V.; Algarni, H.

    2017-10-01

    Low-temperature hydrothermal-assisted synthesis of pure and cesium (Cs) (1, 3, 5, 7 and 10 wt%) doped lead iodide (PbI2) nanorods and nanosheets have been achieved successfully for the first time. The structural and vibrational studies confirm the formation of a 2H-polytypic PbI2 predominantly. Scanning electron microscope analysis confirms the formation of well-aligned nanorods of average size 100 nm at low concentration and nanosheets of average thicknesses in the range of 20-40 nm at higher concentrations of Cs doping. The presence of Cs doping was confirmed by energy dispersive X-ray study. Ultra-violet-visible absorbance spectra were recorded, and energy gap was calculated in the range of 3.33 to 3.45 eV for pure and Cs-doped PbI2 nanostructures which is higher than the bulk value (i.e., 2.27 eV) due to quantum confinement effect. Dielectric constant, loss, and AC conductivity studies have been done. Enhancement in Gamma linear absorption coefficient due to Cs doping confirms the suitability of prepared nanostructures for radiation detection applications. Furthermore, the photocatalytic performance of the synthesized nanostructures was evaluated in the decolorization of methyl green (MG) and methyl orange (MO) under the illumination of visible light (λ > 420 nm). The observed photocatalytic activity for 5 and 7 wt% Cs-doped PbI2 was observed to be more than pure PbI2 and also > 10 times higher than the commercially available photocatalysts. The results suggest that the prepared nanostructures are highly applicable in optoelectronic, radiation detection and many other applications. [Figure not available: see fulltext.

  3. Effect of Different CH3NH3PbI3 Morphologies on Photovoltaic Properties of Perovskite Solar Cells

    Science.gov (United States)

    Chen, Lung-Chien; Lee, Kuan-Lin; Wu, Wen-Ti; Hsu, Chien-Feng; Tseng, Zong-Liang; Sun, Xiao Hong; Kao, Yu-Ting

    2018-05-01

    In this study, the perovskite layers were prepared by two-step wet process with different CH3NH3I (MAI) concentrations. The cell structure was glass/FTO/TiO2-mesoporous/CH3NH3PbI3 (MAPbI3)/spiro-OMeTAD/Ag. The MAPbI3 perovskite films were prepared using high and low MAI concentrations in a two-step process. The perovskite films were optimized at different spin coating speed and different annealing temperatures to enhance the power conversion efficiency (PCE) of perovskite solar cells. The PCE of the resulting device based on the different perovskite morphologies was discussed. The PCE of the best cell was up to 17.42%, open circuit voltage of 0.97 V, short current density of 24.06 mA/cm2, and fill factor of 0.747.

  4. CH(3)NH(3)PbI(3) perovskite / silicon tandem solar cells: characterization based optical simulations.

    Science.gov (United States)

    Filipič, Miha; Löper, Philipp; Niesen, Bjoern; De Wolf, Stefaan; Krč, Janez; Ballif, Christophe; Topič, Marko

    2015-04-06

    In this study we analyze and discuss the optical properties of various tandem architectures: mechanically stacked (four-terminal) and monolithically integrated (two-terminal) tandem devices, consisting of a methyl ammonium lead triiodide (CH(3)NH(3)PbI(3)) perovskite top solar cell and a crystalline silicon bottom solar cell. We provide layer thickness optimization guidelines and give estimates of the maximum tandem efficiencies based on state-of-the-art sub cells. We use experimental complex refractive index spectra for all involved materials as input data for an in-house developed optical simulator CROWM. Our characterization based simulations forecast that with optimized layer thicknesses the four-terminal configuration enables efficiencies over 30%, well above the current single-junction crystalline silicon cell record of 25.6%. Efficiencies over 30% can also be achieved with a two-terminal monolithic integration of the sub-cells, combined with proper selection of layer thicknesses.

  5. Optical characterization of voltage-accelerated degradation in CH3NH3PbI3 perovskite solar cells.

    Science.gov (United States)

    Handa, Taketo; Tex, David M; Shimazaki, Ai; Aharen, Tomoko; Wakamiya, Atsushi; Kanemitsu, Yoshihiko

    2016-05-16

    We investigate the performance degradation mechanism of CH3NH3PbI3 perovskite solar cells under bias voltage in air and nitrogen atmospheres using photoluminescence and electroluminescence techniques. When applying forward bias, the power conversion efficiency of the solar cells decreased significantly in air, but showed no degradation in nitrogen atmosphere. Time-resolved photoluminescence measurements on these devices revealed that the application of forward bias in air accelerates the generation of non-radiative recombination centers in the perovskite layer buried in the device. We found a negative correlation between the electroluminescence intensity and the injected current intensity in air. The irreversible change of the perovskite grain surface in air initiates the degradation of the perovskite solar cells.

  6. Creation and annealing of metastable defect states in CH3NH3PbI3 at low temperatures

    Science.gov (United States)

    Lang, F.; Shargaieva, O.; Brus, V. V.; Rappich, J.; Nickel, N. H.

    2018-02-01

    Methylammonium lead iodide (CH3NH3PbI3), an organic-inorganic perovskite widely used for optoelectronic applications, is known to dissociate under illumination with light at photon energies around 2.7 eV and higher. Here, we show that photo-induced dissociation is not limited to ambient temperatures but can be observed even at 5 K. The photo-induced dissociation of N-H bonds results in the formation of metastable states. Photoluminescence (PL) measurements reveal the formation of defect states that are located 100 meV within the bandgap. This is accompanied by a quenching of the band-to-band PL by one order of magnitude. Defect generation is reversible and annealing at 30 K recovers the band-to-band PL, while the light-induced defect states disappear concurrently.

  7. High performance photodetector based on 2D CH3NH3PbI3 perovskite nanosheets

    International Nuclear Information System (INIS)

    Li, Pengfei; Shivananju, B N; Li, Shaojuan; Bao, Qiaoliang; Zhang, Yupeng

    2017-01-01

    In this work, a high performance vertical-type photodetector based on two-dimensional (2D) CH 3 NH 3 PbI 3 perovskite nanosheets was fabricated. The low trap density of the perovskite nanosheets and their short carrier diffusion distance result in a significant performance enhancement of the perovskite-based photodetector. The photoresponsivity of this vertical-type photodetector is as high as 36 mA W −1 at visible wavelength, which is much better than traditional perovskite photodetectors (0.34 mA W −1 ). Compared with traditional planar-type perovskite-based photodetectors, this vertical-type photodetector also shows the advantages of low-voltage operation and large responsivity. These results may pave the way for exploiting high performance perovskite-based photodetectors with an ingenious device design. (paper)

  8. Morphology-photovoltaic property correlation in perovskite solar cells: One-step versus two-step deposition of CH3NH3PbI3

    Directory of Open Access Journals (Sweden)

    Jeong-Hyeok Im

    2014-08-01

    Full Text Available Perovskite CH3NH3PbI3 light absorber is deposited on the mesoporous TiO2 layer via one-step and two-step coating methods and their photovoltaic performances are compared. One-step coating using a solution containing CH3NH3I and PbI2 shows average power conversion efficiency (PCE of 7.5%, while higher average PCE of 13.9% is obtained from two-step coating method, mainly due to higher voltage and fill factor. The coverage, pore-filling, and morphology of the deposited perovskite are found to be critical in photovoltaic performance of the mesoporous TiO2 based perovskite solar cells.

  9. Increasing the electrical anisotropy of solution-grown PbI2 thin films by addition of CdI2

    International Nuclear Information System (INIS)

    Ponpon, J.P.; Amann, M.

    2010-01-01

    In the present study up to 20% CdI 2 has been added to a lead iodide-water solution, which is used to grow PbI 2 polycrystalline thin films. As a result, a significant increase in the anisotropy of the lead iodide film's electrical properties has been observed: the resistivity in the direction parallel to the c-axis reached 10 15 Ω cm but did not change significantly in the orthogonal direction. This behavior can be explained by the modification of the transport properties related to the crystallographic structure of the films along the c-axis. As suggested by thermally stimulated current measurements, only a small number of the Cd atoms incorporated into the PbI 2 lattice could behave as dopants.

  10. Relativistic GW calculations on CH3NH3PbI3 and CH3NH3SnI3 perovskites for solar cell applications.

    Science.gov (United States)

    Umari, Paolo; Mosconi, Edoardo; De Angelis, Filippo

    2014-03-26

    Hybrid AMX3 perovskites (A = Cs, CH3NH3; M = Sn, Pb; X = halide) have revolutionized the scenario of emerging photovoltaic technologies, with very recent results demonstrating 15% efficient solar cells. The CH3NH3PbI3/MAPb(I(1-x)Cl(x))3 perovskites have dominated the field, while the similar CH3NH3SnI3 has not been exploited for photovoltaic applications. Replacement of Pb by Sn would facilitate the large uptake of perovskite-based photovoltaics. Despite the extremely fast progress, the materials electronic properties which are key to the photovoltaic performance are relatively little understood. Density Functional Theory electronic structure methods have so far delivered an unbalanced description of Pb- and Sn-based perovskites. Here we develop an effective GW method incorporating spin-orbit coupling which allows us to accurately model the electronic, optical and transport properties of CH3NH3SnI3 and CH3NH3PbI3, opening the way to new materials design. The different CH3NH3SnI3 and CH3NH3PbI3 electronic properties are discussed in light of their exploitation for solar cells, and found to be dominantly due to relativistic effects. These effects stabilize the CH3NH3PbI3 material towards oxidation, by inducing a deeper valence band edge. Relativistic effects, however, also increase the material band-gap compared to CH3NH3SnI3, due to the valence band energy downshift (~0.7 eV) being only partly compensated by the conduction band downshift (~0.2 eV).

  11. Quantum well effect in bulk PbI(2) crystals revealed by the anisotropy of photoluminescence and Raman spectra.

    Science.gov (United States)

    Baltog, I; Baibarac, M; Lefrant, S

    2009-01-14

    On subjecting a bulk 2H-PbI(2) crystal to vacuum annealing at 500 K followed by a sudden cooling at liquid nitrogen temperature stacking faults are generated that separate distinct layers of nanometric thickness in which different numbers of I-Pb-I atomic layers are bundled together. Such structures, containing two, three, four, five etc I-Pb-I atomic layers, behave as quantum wells of different widths. The signature of such a transformation is given by a shift towards higher energies of the fundamental absorption edge, which is experimentally revealed by specific anisotropies in the photoluminescence and Raman spectra. The quantum confining effect is made visible by specific variations of a wide extra-excitonic band (G) at 2.06 eV that originates in the radiative recombination of carriers (electrons and holes), trapped on the surface defects. The excitation spectrum of the G band, with p polarized exciting light, reveals a fine structure comprised of narrow bands at 2.75, 2.64, 2.59 and 2.56 eV, which are associated with the PbI(2) quantum wells formed from two, three, four and five I-Pb-I atomic layers of 0.7 nm thickness. Regardless of the polarization state of the laser exciting light of 514.5 nm (2.41 eV), which is close to the band gap energy of PbI(2) (2.52 eV), the Raman scattering on bulk as-grown PbI(2) crystals has the character of a resonant process. For p polarized exciting light, the Raman scattering process on vacuum annealed PbI(2) becomes non-resonant. This originates from the quantum well structures generated inside the crystal, whose band gap energies are higher than the energy of the exciting light.

  12. Donor-acceptor random copolyesters containing perylenebisimide (PBI) and oligo(p-phenylene vinylene) (OPV) by melt condensation polymerization: energy transfer studies.

    Science.gov (United States)

    Nisha, S Kumari; Asha, S K

    2013-10-31

    Novel copolyesters consisting of oligo(p-phenylene vinylene) (OPV) as donor (D) and perylenebisimide (PBI) as acceptor (A) were synthesized by melt polycondensation. Photoinduced energy transfer and photoinduced charge separation in these polyesters were studied in solution as well as in the solid state. Selective excitation of OPV moiety resulted in the energy transfer with >90% efficiency from OPV to PBI chromophore in the solution state. The direct excitation of PBI in the D-A copolyester resulted in reduced fluorescence emission of acceptor, indicating electron transfer between the D and A moieties. The effect of distance between donor and acceptor on the energy transfer efficiency from donor to acceptor was studied. Compared to a physical mixture of D and A polyesters alone, the energy transfer was 4 times more efficient in the D-A copolyester, highlighting the influence of covalently linking D and A in a single polymer chain. A strong fluorescence quenching (∼ 100%) of both chromophores in solid state indicated an efficient photoinduced charge transfer after photoexcitation of either D or A. Thus, OPV-PBI main chain copolyester is an excellent system for the study of energy- and electron-transfer processes in organic semiconductor. Reactive blend of D/A copolyester was also prepared by the transesterification reaction between D and A alone copolyesters. The energy transfer efficiency from D to A moiety upon selective excitation of D chromophore in the D/A copolyester blend was ∼4 times higher compared to a physical mixture of D and A alone copolyesters, which gave direct proof for the transesterification reaction in polyester/polyester reactive blending.

  13. Efficiency enhancement of perovskite solar cells using structural and morphological improvement of CH3NH3PbI3 absorber layers

    Science.gov (United States)

    Alidaei, Maryam; Izadifard, Morteza; Ghazi, Mohammad E.; Ahmadi, Vahid

    2018-01-01

    Perovskite solar cells have been heavily investigated due to their unique properties such as high power conversion efficiency (PCE), low-cost fabrication by solution processes, high diffusion length, large absorption coefficient, and direct and tunable band gap. PCE of perovskite devices is strongly dependent on the absorber layer properties such as morphology, crystallinity, and compactness, which are required to be optimized. In this work, the CH3NH3PbI3 (170-480 nm) absorber layers with various methylammonium iodine (MAI) concentrations (7, 10, 20 and 40 mg ml-1) and perovskite solar cells with the fluorine-doped tin oxide (400 nm)/C-TiO2 (30 nm)/Meso-TiO2 (400 nm)/CH3NH3PbI3 (170-480 nm)/P3HT (30 nm)/Au (100 nm) structure were fabricated. A two-step solution process was used for deposition of the CH3NH3PbI3 absorber layers. The morphology, crystal structure, and optical properties of the perovskite layer grown on glass and also the photovoltaic properties of the fabricated solar cells were studied. The results obtained showed that by controlling the deposition conditions, due to the reduction in charge recombination, PCE enhancement of the perovskite solar cell (up to 11.6%) was accessible.

  14. Homogeneous Emission Line Broadening in the Organo Lead Halide Perovskite CH3NH3PbI3-xClx.

    Science.gov (United States)

    Wehrenfennig, Christian; Liu, Mingzhen; Snaith, Henry J; Johnston, Michael B; Herz, Laura M

    2014-04-17

    The organic-inorganic hybrid perovskites methylammonium lead iodide (CH3NH3PbI3) and the partially chlorine-substituted mixed halide CH3NH3PbI3-xClx emit strong and broad photoluminescence (PL) around their band gap energy of ∼1.6 eV. However, the nature of the radiative decay channels behind the observed emission and, in particular, the spectral broadening mechanisms are still unclear. Here we investigate these processes for high-quality vapor-deposited films of CH3NH3PbI3-xClx using time- and excitation-energy dependent photoluminescence spectroscopy. We show that the PL spectrum is homogenously broadened with a line width of 103 meV most likely as a consequence of phonon coupling effects. Further analysis reveals that defects or trap states play a minor role in radiative decay channels. In terms of possible lasing applications, the emission spectrum of the perovskite is sufficiently broad to have potential for amplification of light pulses below 100 fs pulse duration.

  15. Structural phase transition causing anomalous photoluminescence behavior in perovskite (C6H11NH3)2[PbI4

    Science.gov (United States)

    Yangui, A.; Pillet, S.; Mlayah, A.; Lusson, A.; Bouchez, G.; Triki, S.; Abid, Y.; Boukheddaden, K.

    2015-12-01

    Optical and structural properties of the organic-inorganic hybrid perovskite-type (C6H11NH3)2[PbI4] (abbreviated as C6PbI4) were investigated using optical absorption, photoluminescence (PL), and x-ray diffraction measurements. Room temperature, optical absorption measurements, performed on spin-coated films of C6PbI4, revealed two absorption bands at 2.44 and 3.21 eV. Upon 325 nm (3.815 eV) laser irradiation, strong green PL emission peaks were observed at 2.41 eV (P1) and 2.24 eV (P2) and assigned to free and localized excitons, respectively. The exciton binding energy was estimated at 356 meV. At low temperature, two additional emission bands were detected at 2.366 eV (P3) and a large band (LB) at 1.97 eV. The former appeared only below 40 K and the latter emerged below 130 K. The thermal dependence of the PL spectra revealed an abnormal behavior accompanied by singularities in the peak positions and intensities at 40 and 130 K. X-ray diffraction studies performed on powder and single crystals as a function of temperature evidenced significant changes of the interlayer spacing at 50 K and ˜138 K. Around 138 K, a commensurate to incommensurate structural phase transition occurred on cooling. It involves a symmetry breaking leading to a distortion of the PbI6 octahedron. The resulting incommensurate spatial modulation of the Pb-I distances (and Pb-I-Pb angles) causes a spatial modulation of the band gap, which is at the origin of the emergence of the LB below ˜130 K and the anomalous behavior of the position of P1 below 130 K. The change of the interlayer spacing in the 40-50 K range may in turn be related to the significant decrease of the intensity of P2 and the maximum emission of the LB. These results underline the intricate character of the structural and the PL properties of the hybrid perovskites; understanding such properties should benefit to the design of optoelectronic devices with targeted properties.

  16. Fouling behaviors of polybenzimidazole (PBI)-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) hollow fiber membranes for engineering osmosis processes

    KAUST Repository

    Chen, Sicong; Fu, Xiuzhu; Chung, Neal Tai-Shung

    2014-01-01

    This paper investigated the individual effects of reverse salt flux and permeate flux on fouling behaviors of as-spun and annealed polybenzimidazole (PBI)-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) hollow fiber membranes under forward osmosis (FO) and pressure retarded osmosis (PRO) processes. Two types of membrane fouling had been studied; namely, inorganic fouling (CaSO4·2H2O gypsum scaling) during FO operations and organic fouling (sodium alginate fouling) during PRO operations. It is found that gypsum scaling on the membrane surface may be inhibited and even eliminated with an increase in reverse MgCl2 flux due to competitive formations of MgSO4° and CaSO4·2H2O. In contrast, the increase of reverse NaCl flux exhibits a slight enhancement on alginate fouling in both FO and PRO processes. Comparing to the reverse salt flux, the permeate flux always plays a dominant role in fouling. Therefore, lesser fouling has been observed on the membrane surface under the pressurized PRO process than FO process because the reduced initial flux mitigates the fouling phenomena more significantly than the enhancement caused by an increase in reverse NaCl flux. © 2013 Elsevier B.V.

  17. Piezoelectric scattering limited mobility of hybrid organic-inorganic perovskites CH3NH3PbI3

    Science.gov (United States)

    Lu, Ying-Bo; Kong, Xianghua; Chen, Xiaobin; Cooke, David G.; Guo, Hong

    2017-01-01

    Carrier mobility is one of the most important parameters for semiconducting materials and their use in optoelectronic devices. Here we report a systematic first principles analysis of the acoustic phonon scattering mechanism that limits the mobility of CH3NH3PbI3 (MAPbI3) perovskites. Due to the unique hybrid organic-inorganic structure, the mechanical, electronic and transport properties are dominated by the same factor, i.e. the weak interatomic bond and the easy rotation of methylammonium (MA) molecules under strain. Both factors make MAPbI3 soft. Rotation of MA molecule induces a transverse shift between Pb and I atoms, resulting in a very low deformation potential and a strong piezoelectricity in MAPbI3. Hence the carrier mobility of pristine MAPbI3 is limited by the piezoelectric scattering, which is consistent to the form of its temperature dependence. Our calculations suggest that in the pristine limit, a high mobility of about several thousand cm2 V−1 S−1 is expected for MAPbI3. PMID:28150743

  18. First-principles study on the initial decomposition process of CH3NH3PbI3

    Science.gov (United States)

    Xue, Yuanbin; Shan, Yueyue; Xu, Hu

    2017-09-01

    Hybrid perovskites are promising materials for high-performance photovoltaics. Unfortunately, hybrid perovskites readily decompose in particular under humid conditions, and the mechanisms of this phenomenon have not yet been fully understood. In this work, we systematically studied the possible mechanisms and the structural properties during the initial decomposition process of MAPbI3 (MA = CH3NH3+) using first-principles calculations. The theoretical results show that it is energetically favorable for PbI2 to nucleate and crystalize from the MAPbI3 matrix ahead of other decomposition products. Additionally, the structural instability is an intrinsic property of MAPbI3, regardless of whether the system is exposed to humidity. We find that H2O could facilitate the desorption of gaseous components, acting as a catalyst to transfer the H+ ion. These results provide insight into the cause of the instability of MAPbI3 and may improve our understanding of the properties of hybrid perovskites.

  19. Performance Improvement of CH3NH3PbI3 Perovskite Solar Cell by CH3SH Doping

    Directory of Open Access Journals (Sweden)

    Hong Li

    2016-03-01

    Full Text Available Organometal halide perovskites have recently emerged as an appealing candidate in photovoltaic devices due to their excellent properties. Therefore, intense efforts have been devoted to find the ideal organics for perovskite solar cells. In response, we investigate the doping effect of CH3SH organic on the structure and related performance of a CH3NH3PbI3 perovskite solar cell, via in situ synchrotron- based grazing incidence X-ray diffraction (GIXRD, together with scanning electron microscopy (SEM. In situ GIXRD investigations clearly illustrated the transformation and modification of the perovskite structure induced by the organic dopant, which subsequently led to the enhance‐ ment of the power conversion efficiency of fabricated solar cells. Notably, nanoporous morphology and nanocrystal‐ line structures were discovered in the perovskite film by SEM; they were also confirmed by the increase in broad‐ ening peaks/features in the GIXRD measurements. Overall, our study may ultimately result in an attractive strategy for the fabrication of high performance perovskite solar cells.

  20. Influence of the Grain Size on the Properties of CH3NH3PbI3 Thin Films.

    Science.gov (United States)

    Shargaieva, Oleksandra; Lang, Felix; Rappich, Jörg; Dittrich, Thomas; Klaus, Manuela; Meixner, Matthias; Genzel, Christoph; Nickel, Norbert H

    2017-11-08

    Hybrid perovskites have already shown a huge success as an absorber in solar cells, resulting in the skyrocketing rise in the power conversion efficiency to more than η = 22%. Recently, it has been established that the crystal quality is one of the most important parameters to obtain devices with high efficiencies. However, the influence of the crystal quality on the material properties is not fully understood. Here, the influence of the morphology on electronic properties of CH 3 NH 3 PbI 3 thin films is investigated. Postannealing was used to vary the average grain size continuously from ≈150 to ≈1000 nm. Secondary grain growth is thermally activated with an activation energy of E a = 0.16 eV. The increase in the grain size leads to an enhancement of the photoluminescence, indicating an improvement in the material quality. According to surface photovoltage measurements, the charge-carrier transport length exhibits a linear increase with increasing grain size. The charge-carrier diffusion length is limited by grain boundaries. Moreover, an improved morphology leads to a drastic increase in power conversion efficiency of the devices.

  1. Temperature-Dependent Electric Field Poling Effects in CH3NH3PbI3 Optoelectronic Devices.

    Science.gov (United States)

    Zhang, Chuang; Sun, Dali; Liu, Xiaojie; Sheng, Chuan-Xiang; Vardeny, Zeev Valy

    2017-04-06

    Organo-lead halide perovskites show excellent optoelectronic properties; however, the unexpected inconsistency in forward-backward I-V characteristics remains a problem for fabricating solar panels. Here we have investigated the reasons behind this "hysteresis" by following the changes in photocurrent and photoluminescence under electric field poling in transverse CH 3 NH 3 PbI 3 -based devices from 300 to 10 K. We found that the hysteresis disappears at cryogenic temperatures, indicating the "freeze-out" of the ionic diffusion contribution. When the same device is cooled under continuous poling, the built-in electric field from ion accumulation brings significant photovoltaic effect even at 10 K. From the change of photoluminescence upon polling, we found a second dipole-related mechanism which enhances radiative recombination upon the alignment of the organic cations. The ionic origin of hysteresis was also verified by applying a magnetic field to affect the ion diffusion. These findings reveal the coexistence of ionic and dipole-related mechanisms for the hysteresis in hybrid perovskites.

  2. Electrical Stress Influences the Efficiency of CH3 NH3 PbI3 Perovskite Light Emitting Devices.

    Science.gov (United States)

    Zhao, Lianfeng; Gao, Jia; Lin, YunHui L; Yeh, Yao-Wen; Lee, Kyung Min; Yao, Nan; Loo, Yueh-Lin; Rand, Barry P

    2017-06-01

    Organic-inorganic hybrid perovskite materials are emerging as semiconductors with potential application in optoelectronic devices. In particular, perovskites are very promising for light-emitting devices (LEDs) due to their high color purity, low nonradiative recombination rates, and tunable bandgap. Here, using pure CH 3 NH 3 PbI 3 perovskite LEDs with an external quantum efficiency (EQE) of 5.9% as a platform, it is shown that electrical stress can influence device performance significantly, increasing the EQE from an initial 5.9% to as high as 7.4%. Consistent with the enhanced device performance, both the steady-state photoluminescence (PL) intensity and the time-resolved PL decay lifetime increase after electrical stress, indicating a reduction in nonradiative recombination in the perovskite film. By investigating the temperature-dependent characteristics of the perovskite LEDs and the cross-sectional elemental depth profile, it is proposed that trap reduction and resulting device-performance enhancement is due to local ionic motion of excess ions, likely excess mobile iodide, in the perovskite film that fills vacancies and reduces interstitial defects. On the other hand, it is found that overstressed LEDs show irreversibly degraded device performance, possibly because ions initially on the perovskite lattice are displaced during extended electrical stress and create defects such as vacancies. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Fouling behaviors of polybenzimidazole (PBI)-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) hollow fiber membranes for engineering osmosis processes

    KAUST Repository

    Chen, Sicong

    2014-02-01

    This paper investigated the individual effects of reverse salt flux and permeate flux on fouling behaviors of as-spun and annealed polybenzimidazole (PBI)-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) hollow fiber membranes under forward osmosis (FO) and pressure retarded osmosis (PRO) processes. Two types of membrane fouling had been studied; namely, inorganic fouling (CaSO4·2H2O gypsum scaling) during FO operations and organic fouling (sodium alginate fouling) during PRO operations. It is found that gypsum scaling on the membrane surface may be inhibited and even eliminated with an increase in reverse MgCl2 flux due to competitive formations of MgSO4° and CaSO4·2H2O. In contrast, the increase of reverse NaCl flux exhibits a slight enhancement on alginate fouling in both FO and PRO processes. Comparing to the reverse salt flux, the permeate flux always plays a dominant role in fouling. Therefore, lesser fouling has been observed on the membrane surface under the pressurized PRO process than FO process because the reduced initial flux mitigates the fouling phenomena more significantly than the enhancement caused by an increase in reverse NaCl flux. © 2013 Elsevier B.V.

  4. CH 3 NH 3 PbI 3 /GeSe bilayer heterojunction solar cell with high performance

    Science.gov (United States)

    Hou, Guo-Jiao; Wang, Dong-Lin; Ali, Roshan; Zhou, Yu-Rong; Zhu, Zhen-Gang; Su, Gang

    2018-01-01

    Perovskite (CH3NH3PbI3) solar cells have made significant advances recently. In this paper, we propose a bilayer heterojunction solar cell comprised of a perovskite layer combining with a IV-VI group semiconductor layer, which can give a conversion efficiency even higher than the conventional perovskite solar cell. Such a scheme uses a property that the semiconductor layer with a direct band gap can be better in absorption of long wavelength light and is complementary to the perovskite layer. We studied the semiconducting layers such as GeSe, SnSe, GeS, and SnS, respectively, and found that GeSe is the best, where the optical absorption efficiency in the perovskite/GeSe solar cell is dramatically increased. It turns out that the short circuit current density is enhanced 100% and the power conversion efficiency is promoted 42.7% (to a high value of 23.77%) larger than that in a solar cell with only single perovskite layer. The power conversion efficiency can be further promoted so long as the fill factor and open-circuit voltage are improved. This strategy opens a new way on developing the solar cells with high performance and practical applications.

  5. Assessment of intravenous pbi-shRNA PDX1 nanoparticle (OFHIRNA-PDX1) in yucatan swine.

    Science.gov (United States)

    Jay, C M; Ruoff, C; Kumar, P; Maass, H; Spanhel, B; Miller, M; Arrington, A; Montalvo, N; Gresham, V; Rao, D D; Evans, C; Wang, Z; Brunicardi, F C; Liu, S-H; Zhou, G; Senzer, N; Nemunaitis, J; King, L; Weeks, B; Clubb, F J; Fossum, T W; Maples, P B

    2013-12-01

    PDX1 (pancreatic and duodenal homeobox 1) is overexpressed in pancreatic cancer, and its reduction results in tumor regression. Bi-functional pbi-shRNA PDX1 nanoparticle (OFHIRNA-PDX1) utilizes the endogenous micro-RNA biogenesis pathway to effect cleavage- and non-cleavage-dependent degradation of PDX1 mRNA. We have shown that OFHIRNA-PDX1 reduces pancreatic tumor volume in xenograft models. Thus, we are now exploring biorelevant large animal safety of OFHIRNA-PDX1. Mini pigs were chosen as the biorelevant species based on the similarity of human and pig PDX1 target sequence. In the initial study, animals developed fever, lethargy, hyporexia and cutaneous hyperemia following administration of OFHIRNA-PDX1. Twenty-one days later, the same animals demonstrated less toxicity with a second OFHIRNA-PDX1 infusion in conjunction with a prophylactic regimen involving dexamethasone, diphenhydramine, Indocin and ranitidine. In a new group of animals, PDX1 protein (31 kDa) expression in the pancreas was significantly repressed at 48 and 72 h (85%, P=0.018 and 88%, P=0.013; respectively) following a single infusion of OFHIRNA-PDX1 but recovered to normal state within 7 days. In conclusion, a single intravenous infusion of OFHIRNA-PDX1 in conjunction with premedication in pigs was well tolerated and demonstrated significant PDX1 knockdown.

  6. Polarization tunable photogenerated carrier transfer of CH3NH3PbI3/polyvinylidene fluoride heterostructure

    Science.gov (United States)

    Yang, Kang; Deng, Zun-Yi; Feng, Hong-Jian

    2017-10-01

    The integration of ferroelectrics and organic-inorganic halide perovskites could be a promising way to facilitate the separation of electron-hole pairs and charge extraction for the application of solar cells. To explore the effect of the external ferroelectric layer on the CH3NH3PbI3 (MAPbI3) side, we perform first-principles calculations to study the charge transfer properties of the MAPbI3/polyvinylidene fluoride (PVDF) heterostructure. Our calculations demonstrate that the ferroelectric polarization pointing to the PVDF side can clearly facilitate the separation of photo-induced carriers and enhance charge extraction from MAPbI3, while opposite polarization direction hinders the charge extraction and collection. Notably, the carrier behavior at the interface is strongly tuned by the electric field associated with the ferroelectric polarization. In addition, excited state simulation confirms the tunable charge transfer of the MAPbI3/PVDF heterojunction. Therefore, the polarization-driven charge transfer mechanism provides a route for fabricating the ferroelectrics-based high-efficiency photovoltaics and switchable diode devices.

  7. Shallow trapping vs. deep polarons in a hybrid lead halide perovskite, CH3NH3PbI3.

    Science.gov (United States)

    Kang, Byungkyun; Biswas, Koushik

    2017-10-18

    There has been considerable speculation over the nature of charge carriers in organic-inorganic hybrid perovskites, i.e., whether they are free and band-like, or they are prone to self-trapping via short range deformation potentials. Unusually long minority-carrier diffusion lengths and moderate-to-low mobilities, together with relatively few deep defects add to their intrigue. Here we implement density functional methods to investigate the room-temperature, tetragonal phase of CH 3 NH 3 PbI 3 . We compare charge localization behavior at shallow levels and associated lattice relaxation versus those at deep polaronic states. The shallow level originates from screened Coulomb interaction between the perturbed host and an excited electron or hole. The host lattice has a tendency towards forming these shallow traps where the electron or hole is localized not too far from the band edge. In contrast, there is a considerable potential barrier that must be overcome in order to initiate polaronic hole trapping. The formation of a hole polaron (I 2 - center) involves strong lattice relaxation, including large off-center displacement of the organic cation, CH 3 NH 3 + . This type of deep polaron is energetically unfavorable, and active shallow traps are expected to shape the carrier dynamics in this material.

  8. NÍVEIS SÉRICOS DE PBI EM BOVINOS MESTIÇOS HOLANDÊS-ZEBU DO ESTADO DE GOIÁS PBI SERUM LEVELS IN CROSSBRED HOLSTEIN-ZEBU BOVINES IN THE GOIÁS STATE

    Directory of Open Access Journals (Sweden)

    Suzete Silveira Fichtner

    2007-09-01

    Full Text Available

    Foram analisados 71 hemossoros de bovinos mestiços holandês-zebu, procedentes de cinco municípios da micro-região Mato-Grosso de Goiás. Os autores observaram que os valores obtidos para o gado mestiço holandês-zebu não diferem dos parâmetros fisiológicos estabelecidos pelos investigadores consultados, que trabalharam com gado de origem européia. As diferenças ocorridas poderão ser atribuídas a condições diversas, como por exemplo, as em que se desenvolveram o presente trabalho. Concluímos que, nas condições em que se realizou o presente trabalho, com animais em regime de campo, o gado mestiço holandês-zebu apresenta a importante característica de não aumentar a atividade de sua tireóide, em comparação com o gado de origem européia, apesar de habitar uma região onde as necessidades de dissipação do calor e de circulação sangüínea são mais intensas.

    It was analyzed 71 blood serum of crossbreed zebu from 5 counties of e specific region in the State of Goiás, Brazil. PBI serum levels were (in mg/100 ml of serum: calves 3.6 +/- 0.88; bullock 3.4 +/- 1.04 and cows 3.3 +/- 1.35.

  9. Comparison of orthogonal kilovolt X-ray images and cone-beam CT matching results in setup error assessment and correction for EB-PBI during free breathing

    International Nuclear Information System (INIS)

    Wang Wei; Li Jianbin; Hu Hongguang; Ma Zhifang; Xu Min; Fan Tingyong; Shao Qian; Ding Yun

    2014-01-01

    Objective: To compare the differences in setup error (SE) assessment and correction between the orthogonal kilovolt X-ray images and CBCT in EB-PBI patients during free breathing. Methods: Nineteen patients after breast conserving surgery EB-PBI were recruited. Interfraction SE was acquired using orthogonal kilovolt X-ray setup images and CBCT, after on-line setup correction,calculate the residual error and compare the SE, residual error and setup margin (SM) quantified for orthogonal kilovolt X-ray images and CBCT. Wilcoxon sign-rank test was used to evaluate the differences. Results: The CBCT based SE (systematic error, ∑) was smaller than the orthogonal kilovolt X-ray images based ∑ in AP direction (-1.2 mm vs 2.00 mm; P=0.005), and there was no statistically significant differences for three dimensional directions in random error (σ) (P=0.948, 0.376, 0.314). After on-line setup correction,CBCT decreases setup residual error than the orthogonal kilovolt X-ray images in AP direction (Σ: -0.20 mm vs 0.50 mm, P=0.008; σ: 0.45 mm vs 1.34 mm, P=0.002). And also the CBCT based SM was smaller than orthogonal kilovolt X-ray images based SM in AP direction (Σ: -1.39 mm vs 5.57 mm, P=0.003; σ: 0.00 mm vs 3.2 mm, P=0.003). Conclusions: Compared with kilovolt X-ray images, CBCT underestimate the setup error in the AP direction, but decreases setup residual error significantly.An image-guided radiotherapy and setup error assessment using kilovolt X-ray images for EB-PBI plans was feasible. (authors)

  10. Viscosity, surface tension, density and contact angle of selected PbI2, PbCl2 and methylammonium lead halide perovskite solutions used in perovskite solar cells

    Directory of Open Access Journals (Sweden)

    Mohammad-Reza Ahmadian-Yazdi

    2018-02-01

    Full Text Available Perovskite solar cells (PSCs are currently under vigorous research and development, owing to their compelling power conversion efficiencies. PSCs are solution-processed and, therefore, are fabricated using casting and printing methods, such as spin, spray and blade coating. The coating characteristics significantly depend on the physical and rheological properties of the solutions. Thus, due to the scarcity of such properties, in this work, we report the surface tension, viscosity, density, and contact angle of selected methylammonium lead halide perovskite solutions, in order to gain insight into the behavior of the perovskite solutions and the range of such physical properties. The contact angles were measured on PEDOT:PSS and compact TiO2 (c-TiO2 substrates, commonly used as the underneath layers of the perovskite film. In total, 12 solutions of CH3NH3PbI3 and CH3NH3PbI3-xClx dissolved in common solvents, as well as solutions of PbI2, PbCl2, and CH3NH3I were tested. Among the results, it is shown that the tested perovskite solutions are Newtonian, the apparent contact angles on the mesoporous TiO2 (m-TiO2 are close to zero, on the PEDOT:PSS are around 10°, and on the c-TiO2 are around 30°. Also, contact angle hysteresis is observed in the case of the c-TiO2 substrates. Representative impact dynamics and spreading of perovskite solution droplets are also studied, to demonstrate the importance of the solution properties and process parameters on the coating process.

  11. Viscosity, surface tension, density and contact angle of selected PbI2, PbCl2 and methylammonium lead halide perovskite solutions used in perovskite solar cells

    Science.gov (United States)

    Ahmadian-Yazdi, Mohammad-Reza; Rahimzadeh, Amin; Chouqi, Zineb; Miao, Yihe; Eslamian, Morteza

    2018-02-01

    Perovskite solar cells (PSCs) are currently under vigorous research and development, owing to their compelling power conversion efficiencies. PSCs are solution-processed and, therefore, are fabricated using casting and printing methods, such as spin, spray and blade coating. The coating characteristics significantly depend on the physical and rheological properties of the solutions. Thus, due to the scarcity of such properties, in this work, we report the surface tension, viscosity, density, and contact angle of selected methylammonium lead halide perovskite solutions, in order to gain insight into the behavior of the perovskite solutions and the range of such physical properties. The contact angles were measured on PEDOT:PSS and compact TiO2 (c-TiO2) substrates, commonly used as the underneath layers of the perovskite film. In total, 12 solutions of CH3NH3PbI3 and CH3NH3PbI3-xClx dissolved in common solvents, as well as solutions of PbI2, PbCl2, and CH3NH3I were tested. Among the results, it is shown that the tested perovskite solutions are Newtonian, the apparent contact angles on the mesoporous TiO2 (m-TiO2) are close to zero, on the PEDOT:PSS are around 10°, and on the c-TiO2 are around 30°. Also, contact angle hysteresis is observed in the case of the c-TiO2 substrates. Representative impact dynamics and spreading of perovskite solution droplets are also studied, to demonstrate the importance of the solution properties and process parameters on the coating process.

  12. Enhanced Crystalline Phase Purity of CH3NH3PbI3-xClx Film for High-Efficiency Hysteresis-Free Perovskite Solar Cells.

    Science.gov (United States)

    Yang, Yingguo; Feng, Shanglei; Xu, Weidong; Li, Meng; Li, Li; Zhang, Xingmin; Ji, Gengwu; Zhang, Xiaonan; Wang, Zhaokui; Xiong, Yimin; Cao, Liang; Sun, Baoquan; Gao, Xingyu

    2017-07-12

    Despite rapid successful developments toward promising perovskite solar cells (PSCs) efficiency, they often suffer significant hysteresis effects. Using synchrotron-based grazing incidence X-ray diffraction (GIXRD) with different probing depths by varying the incident angle, we found that the perovskite films consist of dual phases with a parent phase dominant in the interior and a child phase with a smaller (110) interplanar space (d (110) ) after rapid thermal annealing (RTA), which is a widely used post treatment to improve the crystallization of solution-processed perovskite films for high-performance planar PSCs. In particular, the child phase composition gradually increases with decreasing depth till it becomes the majority on the surface, which might be one of the key factors related to hysteresis in fabricated PSCs. We further improve the crystalline phase purity of the solution-processed CH 3 NH 3 PbI 3-x Cl x perovskite film (referred as g-perovskite) by using a facile gradient thermal annealing (GTA), which shows a uniformly distributed phase structure in pinhole-free morphology with less undercoordinated Pb and I ions determined by synchrotron-based GIXRD, grazing incidence small-angle X-ray scattering, scanning electron microscopy, and X-ray photoelectron spectroscopy. Regardless of device structures (conventional and inverted types), the planar heterojunction PSCs employing CH 3 NH 3 PbI 3-x Cl x g-perovskite films exhibit negligible hysteresis with a champion power conversion efficiency of 17.04% for TiO 2 -based conventional planar PSCs and 14.83% for poly(3,4-ethylenedioxythiophene:poly(styrenesulfonate) (PEDOT:PSS)-based inverted planar PSCs. Our results indicate that the crystalline phase purity in CH 3 NH 3 PbI 3-x Cl x perovskite film, especially in the surface region, plays a crucial role in determining the hysteresis effect and device performance.

  13. Nickel oxide electrode interlayer in CH3 NH3 PbI3 perovskite/PCBM planar-heterojunction hybrid solar cells.

    Science.gov (United States)

    Jeng, Jun-Yuan; Chen, Kuo-Cheng; Chiang, Tsung-Yu; Lin, Pei-Ying; Tsai, Tzung-Da; Chang, Yun-Chorng; Guo, Tzung-Fang; Chen, Peter; Wen, Ten-Chin; Hsu, Yao-Jane

    2014-06-25

    This study successfully demonstrates the application of inorganic p-type nickel oxide (NiOx ) as electrode interlayer for the fabrication of NiOx /CH3 NH3 PbI3 perovskite/PCBM PHJ hybrid solar cells with a respectable solar-to-electrical PCE of 7.8%. The better energy level alignment and improved wetting of the NiOx electrode interlayer significantly enhance the overall photovoltaic performance. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Analysis of HgI2 and PbI2 crystals and detectors by particle-induced x-ray emission (PIXE) and ion backscattering spectroscopy (IBS)

    International Nuclear Information System (INIS)

    Bench, G.S.; Heikkinen, D.W.; Antolak, A.J.; Morse, D.H.; Pontau, A.E.; James, R.B.; David, D.C.; Burger, A.; Van Den Berg, L.

    1993-03-01

    The Ion Micro-Analysis Group (IMAG) in Livermore conducts quantitative trace elemental analysis with PIXE and depth profiling with IBS using an MeV ion microbeam. The system has the capability to produce two-dimensional trace element and IBS images. PIXE analyses have been conducted on HgI 2 and PbI 2 crystals and detector materials in order to identify and quantify near surface trace contaminants. IBS measurements have been conducted to investigate elemental depth distributions in various materials. The results of measurements on several different samples are reported and a discussion of factors affecting quantitative in vacuo microanalysis of these materials is presented

  15. Perspective: Understanding of ripening growth model for minimum residual PbI2 and its limitation in the planar perovskite solar cells

    Directory of Open Access Journals (Sweden)

    Se-Yun Kim

    2016-10-01

    Full Text Available The power conversion efficiency of lead halide perovskite solar cells recently surpassed 22.1%. In this study, we suggest the perovskite absorber growth mechanism of the two-step process could be explained by an Ostwald ripening growth model for planar-structure perovskite solar cells. We attempt to find out the source of two main problems such as unreacted PbI2 and non-uniformed morphology by the proposed ripening growth mechanism and experimental results. This growth mechanism opens the way toward understanding a key aspect of the photovoltaic operation of high-efficiency, two-step perovskite solar cells.

  16. Structural phase transition causing anomalous photoluminescence behavior in perovskite (C6H11NH3)2[PbI4

    International Nuclear Information System (INIS)

    Yangui, A.; Pillet, S.; Mlayah, A.; Lusson, A.; Bouchez, G.; Boukheddaden, K.; Triki, S.; Abid, Y.

    2015-01-01

    Optical and structural properties of the organic-inorganic hybrid perovskite-type (C 6 H 11 NH 3 ) 2 [PbI 4 ] (abbreviated as C 6 PbI 4 ) were investigated using optical absorption, photoluminescence (PL), and x-ray diffraction measurements. Room temperature, optical absorption measurements, performed on spin-coated films of C 6 PbI 4 , revealed two absorption bands at 2.44 and 3.21 eV. Upon 325 nm (3.815 eV) laser irradiation, strong green PL emission peaks were observed at 2.41 eV (P1) and 2.24 eV (P2) and assigned to free and localized excitons, respectively. The exciton binding energy was estimated at 356 meV. At low temperature, two additional emission bands were detected at 2.366 eV (P3) and a large band (LB) at 1.97 eV. The former appeared only below 40 K and the latter emerged below 130 K. The thermal dependence of the PL spectra revealed an abnormal behavior accompanied by singularities in the peak positions and intensities at 40 and 130 K. X-ray diffraction studies performed on powder and single crystals as a function of temperature evidenced significant changes of the interlayer spacing at 50 K and ∼138 K. Around 138 K, a commensurate to incommensurate structural phase transition occurred on cooling. It involves a symmetry breaking leading to a distortion of the PbI 6 octahedron. The resulting incommensurate spatial modulation of the Pb–I distances (and Pb–I–Pb angles) causes a spatial modulation of the band gap, which is at the origin of the emergence of the LB below ∼130 K and the anomalous behavior of the position of P1 below 130 K. The change of the interlayer spacing in the 40-50 K range may in turn be related to the significant decrease of the intensity of P2 and the maximum emission of the LB. These results underline the intricate character of the structural and the PL properties of the hybrid perovskites; understanding such properties should benefit to the design of optoelectronic devices with targeted properties

  17. Optical spectroscopy of two-dimensional layered (C(6)H(5)C(2)H(4)-NH(3))(2)-PbI(4) perovskite.

    Science.gov (United States)

    Gauthron, K; Lauret, J-S; Doyennette, L; Lanty, G; Al Choueiry, A; Zhang, S J; Brehier, A; Largeau, L; Mauguin, O; Bloch, J; Deleporte, E

    2010-03-15

    We report on optical spectroscopy (photoluminescence and photoluminescence excitation) on two-dimensional self-organized layers of (C(6)H(5)C(2)H(4)-NH(3))(2)-PbI(4) perovskite. Temperature and excitation power dependance of the optical spectra gives a new insight into the excitonic and the phononic properties of this hybrid organic/inorganic semiconductor. In particular, exciton-phonon interaction is found to be more than one order of magnitude higher than in GaAs QWs. As a result, photoluminescence emission lines have to be interpreted in the framework of a polaron model.

  18. Phase diagrams of high-order critical phenomene and high-temperature equilibria in the H2O-HgI2-PbI2 system

    International Nuclear Information System (INIS)

    Valyashko, V.M.; Urusova, M.A.

    1996-01-01

    The paper studies the principal schemes of complete state diagram of volatile component-two non-volatile components three-component system with tricritical point and sequence of phase transformations at variation of temperature, pressure and composition of mixture. H 2 O-HgI 2 -PbI 2 system, solid phase dissolving process, stratification of solutions and critical phenomena under 200-400 deg C are studied experimentally. General nature of the system phase diagram and parameters of three-phase equilibrium critical point (tricritical point), that is, gas-liquid 1 -liquid 2 are determined. 17 refs., 8 figs., 3 tabs

  19. Influence of PbCl2 content in PbI2 solution of DMF on the absorption, crystal phase, morphology of lead halide thin films and photovoltaic performance in planar perovskite solar cells

    International Nuclear Information System (INIS)

    Wang, Mao; Shi, Chengwu; Zhang, Jincheng; Wu, Ni; Ying, Chao

    2015-01-01

    In this paper, the influence of PbCl 2 content in PbI 2 solution of DMF on the absorption, crystal phase and morphology of lead halide thin films was systematically investigated and the photovoltaic performance of the corresponding planar perovskite solar cells was evaluated. The result revealed that the various thickness lead halide thin film with the small sheet-like, porous morphology and low crystallinity can be produced by adding PbCl 2 powder into PbI 2 solution of DMF as a precursor solution. The planar perovskite solar cell based on the 300-nm-thick CH 3 NH 3 PbI 3−x Cl x thin film by the precursor solution with the mixture of 0.80 M PbI 2 and 0.20 M PbCl 2 exhibited the optimum photoelectric conversion efficiency of 10.12% along with an open-circuit voltage of 0.93 V, a short-circuit photocurrent density of 15.70 mA cm −2 and a fill factor of 0.69. - Graphical abstract: The figure showed the surface and cross-sectional SEM images of lead halide thin films using the precursor solutions: (a) 0.80 M PbI 2 , (b) 0.80 M PbI 2 +0.20 M PbCl 2 , (c) 0.80 M PbI 2 +0.40 M PbCl 2 , and (d) 0.80 M PbI 2 +0.60 M PbCl 2 . With the increase of the PbCl 2 content in precursor solution, the size of the lead halide nanosheet decreased and the corresponding thin films gradually turned to be porous with low crystallinity. - Highlights: • Influence of PbCl 2 content on absorption, crystal phase and morphology of thin film. • Influence of perovskite film thickness on photovoltaic performance of solar cell. • Lead halide thin film with small sheet-like, porous morphology and low crystallinity. • Planar solar cell with 300 nm-thick perovskite thin film achieved PCE of 10.12%.

  20. Fabrication and Characterization of CH3NH3PbI3−x−yBrxCly Perovskite Solar Cells

    Directory of Open Access Journals (Sweden)

    Atsushi Suzuki

    2016-05-01

    Full Text Available Fabrication and characterization of CH3NH3PbI3−x−yBrxCly perovskite solar cells using mesoporous TiO2 as electron transporting layer and 2,2′,7,7′-tetrakis-(N,N-di-4-methoxyphenylamino-9,9′-spirobifluorene as a hole-transporting layer (HTL were performed. The purpose of the present study is to investigate role of halogen doping using iodine (I, bromine (Br and chlorine (Cl compounds as dopant on the photovoltaic performance and microstructures of CH3NH3PbI3−x−yBrxCly perovskite solar cells. The X-ray diffraction identified a slight decrease of crystal spacing in the perovskite crystal structure doped with a small amount of I, Br, and Cl in the perovskite compounds. Scanning electron microscopy (SEM and energy dispersive X-ray spectroscopy (EDX showed the perovskite crystal behavior depended on molar ratio of halogen of Pb, I, Br and Cl. Incorporation of the halogen doping into the perovskite crystal structure improved photo generation, carrier diffusion without carrier recombination in the perovskite layer and optimization of electronic structure related with the photovoltaic parameters of open-circuit voltage, short-circuit current density and conversion efficiency. The energy diagram and photovoltaic mechanisms of the perovskite solar cells were discussed in the context of the experimental results.

  1. Nanoscale charge localization induced by random orientations of organic molecules in hybrid perovskite CH3NH3PbI3

    Science.gov (United States)

    Ma, Jie; Wang, Lin-Wang

    2015-03-01

    Perovskite-based solar cells have achieved high solar-energy conversion efficiencies and attracted wide attentions nowadays. Despite the rapid progress in solar-cell devices, many fundamental issues of the hybrid perovskites have not been fully understood. Experimentally, it is well known that in CH3NH3PbI3, the organic molecules CH3NH3 are randomly orientated at the room temperature, but the impact of the random molecular orientation has not been investigated. Using linear-scaling ab-initiomethods, we have calculated the electronic structures of the tetragonal phase of CH3NH3PbI3 with randomly orientated organic molecules in large supercells up to ~20,000 atoms. Due to the dipole moment of the organic molecule, the random orientation creates a novel system with long-range potential fluctuations unlike alloys or other conventional disordered systems. We find that the charge densities of the conduction-band minimum and the valence-band maximum are localized separately in nanoscales due to the potential fluctuations. The charge localization causes electron-hole separation and reduces carrier recombination rates, which may contribute to the long carrier lifetime observed in experiments. We have also proposed a model to explain the charge localization.

  2. Electronic structure calculations and optical properties of a new organic-inorganic luminescent perovskite: (C9H19NH3)2PbI2Br2

    International Nuclear Information System (INIS)

    Abid, H.; Samet, A.; Dammak, T.; Mlayah, A.; Hlil, E.K.; Abid, Y.

    2011-01-01

    (C 9 H 19 NH 3 ) 2 PbI 2 Br 2 compound is a new crystal belonging to the large hybrid organic-inorganic perovskites compounds family. Optical properties are investigated by optical absorption UV-visible and photoluminescence (PL) techniques. Bands to band absorption peak at 2.44 eV as well as an extremely strong yellow-green photoluminescence emission at 2.17 eV is observed at room temperature. First principle calculations based on the DFT and FLAPW methods combined with LDA approximation are performed as well. Density of state close to the gap is presented and discussed in terms of optical absorption and photoluminescence experimental results. The perfect agreement between experimental data and electronic structure calculations is highlighted. - Highlights: → (C 9 H 19 NH 3 ) 2 PbI 2 Br 2 compound is a new crystal with strong yellow-green PL emission at 2.17 eV. → Calculations based on DFT and FLAPW method combined with LDA approximation are performed. → Gap, optical transitions and exciton presence were predicted from density of states. → Agreement between experimental data and electronic structure calculations.

  3. Carrier injection and recombination processes in perovskite CH3NH3PbI3 solar cells studied by electroluminescence spectroscopy

    Science.gov (United States)

    Handa, Taketo; Okano, Makoto; Tex, David M.; Shimazaki, Ai; Aharen, Tomoko; Wakamiya, Atsushi; Kanemitsu, Yoshihiko

    2016-02-01

    Organic-inorganic hybrid perovskite materials, CH3NH3PbX3 (X = I and Br), are considered as promising candidates for emerging thin-film photovoltaics. For practical implementation, the degradation mechanism and the carrier dynamics during operation have to be clarified. We investigated the degradation mechanism and the carrier injection and recombination processes in perovskite CH3NH3PbI3 solar cells using photoluminescence (PL) and electroluminescence (EL) imaging spectroscopies. By applying forward bias-voltage, an inhomogeneous distribution of the EL intensity was clearly observed from the CH3NH3PbI3 solar cells. By comparing the PL- and EL-images, we revealed that the spatial inhomogeneity of the EL intensity is a result of the inhomogeneous luminescence efficiency in the perovskite layer. An application of bias-voltage for several tens of minutes in air caused a decrease in the EL intensity and the conversion efficiency of the perovskite solar cells. The degradation mechanism of perovskite solar cells under bias-voltage in air is discussed.

  4. Antiferroelectric Nature of CH3NH3PbI3-xClx Perovskite and Its Implication for Charge Separation in Perovskite Solar Cells

    Science.gov (United States)

    Sewvandi, Galhenage A.; Kodera, Kei; Ma, Hao; Nakanishi, Shunsuke; Feng, Qi

    2016-07-01

    Perovskite solar cells (PSCs) have been attracted scientific interest due to high performance. Some researchers have suggested anomalous behavior of PSCs to the polarizations due to the ion migration or ferroelectric behavior. Experimental results and theoretical calculations have suggested the possibility of ferroelectricity in organic-inorganic perovskite. However, still no studies have been concretely discarded the ferroelectric nature of perovskite absorbers in PSCs. Hysteresis of P-E (polarization-electric field) loops is an important evidence to confirm the ferroelectricity. In this study, P-E loop measurements, in-depth structural study, analyses of dielectric behavior and the phase transitions of CH3NH3PbI3-xClx perovskite were carried out and investigated. The results suggest that CH3NH3PbI3-xClx perovskite is in an antiferroelectric phase at room temperature. The antiferroelectric phase can be switched to ferroelectric phase by the poling treatment and exhibits ferroelectric-like hysteresis P-E loops and dielectric behavior around room temperature; namely, the perovskite can generate a ferroelectric polarization under PSCs operating conditions. Furthermore, we also discuss the implications of ferroelectric polarization on PSCs charge separation.

  5. Efficient and stable CH3NH3PbI3-x(SCN)x planar perovskite solar cells fabricated in ambient air with low-temperature process

    Science.gov (United States)

    Zhang, Zongbao; Zhou, Yang; Cai, Yangyang; Liu, Hui; Qin, Qiqi; Lu, Xubing; Gao, Xingsen; Shui, Lingling; Wu, Sujuan; Liu, Jun-Ming

    2018-02-01

    Planar perovskite solar cells (PSCs) based on CH3NH3PbI3-x(SCN)x (SCN: thiocyanate) active layer and low-temperature processed TiO2 films are fabricated by a sequential two-step method in ambient air. Here, alkali thiocyanates (NaSCN, KSCN) are added into Pb(SCN)2 precursor to improve the microstructure of CH3NH3PbI3-x(SCN)x perovskite layers and performance of the as-prepared PSCs. At the optimum concentrations of alkali thiocyanates as additives, the as-prepared NaSCN-modified and KSCN-modified PSCs demonstrate the efficiencies of 16.59% and 15.63% respectively, being much higher than 12.73% of the reference PSCs without additives. This improvement is primarily ascribed to the enhanced electron transport, reduced recombination rates and much improved microstructures with large grain size and low defect density at grain boundaries. Importantly, it is revealed that the modified PSCs at the optimized concentrations of alkali thiocyanates additives exhibit remarkably improved stability than the reference PSCs against humid circumstance, and a continuous exposure to humid air without encapsulation over 45 days only records about 5% degradation of the efficiency. These findings provide a facile approach to fabricate efficient and stable PSCs by low processing temperature in ambient air, both of which are highly preferred for future practical applications of PSCs.

  6. Role of bromine doping on the photovoltaic properties and microstructures of CH3NH3PbI3 perovskite solar cells

    International Nuclear Information System (INIS)

    Suzuki, Atsushi; Okada, Hiroshi; Oku, Takeo

    2016-01-01

    Organic-inorganic hybrid heterojunction solar cells containing CH 3 NH 3 PbI 3 perovskite compound were fabricated using mesoporous TiO 2 as the electronic transporting layer and spirobifluorence as the hole-transporting layer. The purpose of the present study is to investigate role of bromine (Br) doping on the photovoltaic properties and microstructure of CH 3 NH 3 PbI 3 perovskite solar cells. Photovoltaic, optical properties and microstructures of perovskite-based solar cells were investigated. The X-ray diffraction identified crystal structure of the perovskite layer doped with Br in the solar cell. Scanning electron microscopy observation showed a different behavior of surface morphology and the perovskite crystal structure on the TiO 2 mesoporous structure depending on extent amount of hydrogen doping of Br. The role of bromide halogen doping on the perovskite crystal structure and photovoltaic properties was due to improvement of carrier mobility, optimization of electron structure, band gap related with the photovoltaic parameters of V oc , J sc and η. Energy diagram and photovoltaic mechanism of the perovskite solar cells varied with halogen doping was discussed by experimental results

  7. High-Performance CH3NH3PbI3-Inverted Planar Perovskite Solar Cells with Fill Factor Over 83% via Excess Organic/Inorganic Halide.

    Science.gov (United States)

    Jahandar, Muhammad; Khan, Nasir; Lee, Hang Ken; Lee, Sang Kyu; Shin, Won Suk; Lee, Jong-Cheol; Song, Chang Eun; Moon, Sang-Jin

    2017-10-18

    The reduction of charge carrier recombination and intrinsic defect density in organic-inorganic halide perovskite absorber materials is a prerequisite to achieving high-performance perovskite solar cells with good efficiency and stability. Here, we fabricated inverted planar perovskite solar cells by incorporation of a small amount of excess organic/inorganic halide (methylammonium iodide (CH 3 NH 3 I; MAI), formamidinium iodide (CH(NH 2 ) 2 I; FAI), and cesium iodide (CsI)) in CH 3 NH 3 PbI 3 perovskite film. Larger crystalline grains and enhanced crystallinity in CH 3 NH 3 PbI 3 perovskite films with excess organic/inorganic halide reduce the charge carrier recombination and defect density, leading to enhanced device efficiency (MAI+: 14.49 ± 0.30%, FAI+: 16.22 ± 0.38% and CsI+: 17.52 ± 0.56%) compared to the efficiency of a control MAPbI 3 device (MAI: 12.63 ± 0.64%) and device stability. Especially, the incorporation of a small amount of excess CsI in MAPbI 3 perovskite film leads to a highly reproducible fill factor of over 83%, increased open-circuit voltage (from 0.946 to 1.042 V), and short-circuit current density (from 18.43 to 20.89 mA/cm 2 ).

  8. DFT analysis and FDTD simulation of CH3NH3PbI3-x Cl x mixed halide perovskite solar cells: role of halide mixing and light trapping technique

    Science.gov (United States)

    Saffari, Mohaddeseh; Mohebpour, Mohammad Ali; Rahimpour Soleimani, H.; Bagheri Tagani, Meysam

    2017-10-01

    Since perovskite solar cells have attracted a great deal of attention over the past few years, the enhancement of their optical absorption and current density are among the basic upcoming challenges. For this reason, first, we have studied the structural and optical properties of organic-inorganic hybrid halide perovskite CH3NH3PbI3 and the compounds doped by chlorine halogen CH3NH3PbI3-x Cl x in the cubic phase by using a density functional theory (DFT). Then, we model a single-junction perovskite solar cell based on a full solution to Maxwell’s equations, using a finite difference time domain (FDTD) technique, which helps us to investigate the light absorption efficiency and optical current density of the cell with CH3NH3PbI3-x Cl x (x  =  0, 1, 2, 3) as the active layer. The results suggest that increasing the amount of chlorine in CH3NH3PbI3-x Cl x compound leads to an increase in the bandgap energy, as well as a decrease in the lattice constants and optical properties, like the refractive index and extinction coefficient of the structure. Also, the results obtained by the simulation express that by taking advantage of the light trapping techniques of SiO2, a remarkable increase of light absorption will be achieved to the magnitude of 83.13%, which is noticeable.

  9. REBUILDING THE PROFESSIONAL TEACHING CAPACITY OF UNDERGRADUATE ENGLISH EDUCATION STUDENTS OF UIN ALAUDDIN MAKASSAR (A Case Study on Student-Teachers of PBI Students of Tarbiyah Faculty

    Directory of Open Access Journals (Sweden)

    Mardiana Nurdin

    2014-12-01

    Full Text Available Abstrak: Penelitian ini bertujuan untuk mengeksplorasi kapasitas pengajaran yang profe­sional mahasiswa PPL PBI UIN Alauddin Makassar yang melibatkan 4 guru pamong dan 30 mahasiswa PPL. Data dikumpulkan melalui survei online, lembar pengamatan dan dokumentasi yang dianalisis dengan menggunakan metode campuran qualitatif dan kuantitatif. Penelitian ini menyimpulkan bahwa: 1 mahasiswa PPL berpendapat bahwa seorang guru bahasa Inggris seharusnya mampu melakukan tanggung jawabnya sebagai seorang guru yang memiliki kompetensi paedagogik, profesional, sosial, dan kepribadian, 2 mahasiswa PPL cenderung menerima pebelajar mandiri, kerja berpasangan dan kerja kelompok, mengadaptasi pengajaran untuk memenuhi kebutuhan siswa sebelum praktik pembelajaran, tetapi cenderung menguranginya selama proses pembelajaran; mahasiswa PPL juga cenderung menerima pengajaran grammar secara eksplisit, koreksi kesalahan, dan pengucapan seperti penutur asli, pengetahuan teknikal, dan keterampilan interpersonal sebelum praktik mengajar dan meningkatkan proporsinya selama proses mengajar, 3 Guru pamong berpendapat bahwa maha­siswa PPL PBI UIN alauddin harus meningkatkan kemampuan bahasa Inggris, penggunaan metode pengajaran yang inovatif, penilaian autentik, dan penggu­naan media yang bervariasi. Abstract: This research aims to explore the professional teaching capacity of undergraduate English education students of UIN Alauddin Makassar. It involves 4 supervising-teachers and 30 student-teachers. The data were collected through online survey questionnaires, feedback observation sheets and documentation; analyzed quanti­tatively and qualitatively. The research finds that: 1 the student-teachers perceive an EFL teacher should be able to do their responsibilities which involves peda­gogic, professional, social, and personal competences; 2 the student-teachers have a tendency to accept learner autonomy, pair/group work, adapting teaching to cater for learner needs before

  10. Small angle, quasielastic and inelastic neutron scattering from 0.85AgPO3-0.15PbI2 glass

    International Nuclear Information System (INIS)

    Malugani, J.P.; Tachez, M.; Mercier, R.

    1987-01-01

    A small angle neutron scattering (SANS) experiment and a quasielastic neutron scattering (QENS) experiment were performed on the fast ionic conductor 0.85AgPO 3 -0.15PbI 2 , which is a vitreous electrolyte. The SANS data show that the scattering obeys Guinier's law for Q -2 A; dispersed heterogeneities are present in the glass with a mean radius of gyration of 20 A. The QENS spectra show a quasielastic broadening of the elastic peak and a long tail up to 40 meV which is due to an inelastic distribution. The results seem to confirm the hypothesis on the structure of this glass: small 'clusters' of AgI with tetrahedral coordination are dispersed in the AgPO 3 host glass. In order to build these clusters, an exchange between Ag + and Pb 2+ is proposed. 18 refs.; 6 figs.; 2 tabs

  11. Antisolvent-assisted powder engineering for controlled growth of hybrid CH3NH3PbI3 perovskite thin films

    Directory of Open Access Journals (Sweden)

    Yong Chan Choi

    2017-02-01

    Full Text Available We develop antisolvent-assisted powder engineering for the controlled growth of hybrid inorganic-organic CH3NH3PbI3 (MAPbI3 perovskite thin films. The powders, which are used as the precursors for solution processing, are synthesized by pouring a MAPbI3 precursor solution into various antisolvents, such as dichloromethane, chloroform, diethyl ether, and toluene. Two types of powders having different colors are obtained, depending on the antisolvent used. The choice of the antisolvent used for synthesizing the powders strongly influences not only the phases of the powders but also the morphology and structure of the thin films subsequently fabricated by solution processing. This, in turn, affects the photovoltaic performance.

  12. Trapping charges at grain boundaries and degradation of CH3NH3Pb(I1-x Br x )3 perovskite solar cells

    Science.gov (United States)

    Phuong Nguyen, Bich; Kim, Gee Yeong; Jo, William; Kim, Byeong Jo; Jung, Hyun Suk

    2017-08-01

    The electrical properties of CH3NH3Pb(I1-x Br x )3 (x = 0.13) perovskite materials were investigated under ambient conditions. The local work function and the local current were measured using Kelvin probe force microscopy and conductive atomic force microscopy, respectively. The degradation of the perovskite layers depends on their grain size. As the material degrades, an additional peak in the surface potential appears simultaneously with a sudden increase and subsequent relaxation of the local current. The potential bending at the grain boundaries and the intragrains is the most likely reason for the change of the local current surface of the perovskite layers. The improved understanding of the degradation mechanism garnered from this study helps pave the way toward an improved photo-conversion efficiency in perovskite solar cells.

  13. Graphene assisted effective hole-extraction on In2O3:H/CH3NH3PbI3 interface: Studied by modulated surface spectroscopy

    Science.gov (United States)

    Vinoth Kumar, Sri Hari Bharath; Muydinov, Ruslan; Kol'tsova, Tat‘yana; Erfurt, Darja; Steigert, Alexander; Tolochko, Oleg; Szyszka, Bernd

    2018-01-01

    Charge separation in CH3NH3PbI3 (MAPbI3) films deposited on a hydrogen doped indium oxide (In2O3:H) photoelectrode was investigated by modulated surface photovoltage (SPV) spectroscopy in a fixed capacitor arrangement. It was found that In2O3:H reproducibly extracts photogenerated-holes from MAPbI3 films. The oxygen-plasma treatment of the In2O3:H surface is suggested to be a reason for this phenomenon. Introducing graphene interlayer increased charge separation nearly 6 times as compared to that on the In2O3:H/MAPbI3 interface. Furthermore, it is confirmed by SPV spectroscopy that the defects of the MAPbI3 interface are passivated by graphene.

  14. In-situ X-ray diffraction reveals the degradation of crystalline CH3NH3PbI3 by water-molecule collisions at room temperature

    Science.gov (United States)

    Hada, Masaki; Hasegawa, Yoichi; Nagaoka, Ryota; Miyake, Tomoya; Abdullaev, Ulugbek; Ota, Hiromi; Nishikawa, Takeshi; Yamashita, Yoshifumi; Hayashi, Yasuhiko

    2018-02-01

    We have developed a vacuum-compatible chamber for in-situ X-ray diffraction (XRD) studies and have used it to characterize the changing crystal structure of an inorganic-organic hybrid perovskite material, CH3NH3PbI3 (MAPbI3), during interactions with water vapor at room temperature. In the XRD spectra, we have observed the degradation of MAPbI3 and the creation of MAPbI3 hydrates, which follow simple rate equations. The time constant for the degradation of MAPbI3 during accelerated aging suggests that multiple collisions of water molecules with the MAPbI3 crystal trigger the degradation of the crystal.

  15. Temperature dependence of the effective mass of the hybrid organic-inorganic perovskites CH3NH3PbI3

    Science.gov (United States)

    Lu, Ying-Bo; Yang, Haozhi; Cong, Wei-Yan; Zhang, Peng; Guo, Hong

    2017-12-01

    The material of methylammonium lead iodide, CH3NH3PbI3 (MAPbI3), has shown significant promise in solar cell applications. A way to infer the microscopic scattering mechanism(s) in MAPbI3 is through the measured temperature dependence of carrier mobility. To this end, how does the carrier effective mass depend on temperature, m* = m*(T), is a useful information since the mobility is a function of m*. By atomistic first principles, we report the calculated m*(T) due to the thermal expansion of MAPbI3 materials, in the experimentally relevant range of 130 K to room temperature. The calculated results suggest m* = m*(T) to be linear in T. The increase of m* versus temperature is predominantly due to the expansion of the longitudinal atomic spacing that weakens the s/p hybridization between the I/Pb atoms.

  16. Metastable phases freezing from melts of reciprocal systems PbX + CdI2=CdX + PbI2 (X=S, Se, Te)

    International Nuclear Information System (INIS)

    Odin, I.N.; Chukichev, M.V.

    2001-01-01

    The transformations in the mutual PbX + CdI 2 =CdX + PbI 2 (X=S, Se, Te) systems leading to the crystallization of metastable polytypical modifications of lead iodide in metastable ternary compounds are studied for the first time. Microstructural and X-ray diffraction analyses were conducted. Their phase diagrams were constructed. The luminescence properties of the stable and metastable modifications of the lead iodide and the metastable compound Pb 4 SeI 6 were investigated. The lines 504 and 512 nm are noted in the 2H-PbI 2 cathodoluminescence spectra. The close lines - 508 and 516 nm provide for the 6R-PbI 2 modification. The metastable compound Pb 4 SeI 6 is characterized by the 769 and 868 nm lines [ru

  17. Influence of hydration water on CH3NH3PbI3 perovskite films prepared through one-step procedure.

    Science.gov (United States)

    Wang, Ziyi; Yuan, Sijian; Li, Dahai; Jin, Feng; Zhang, Rongjun; Zhan, Yiqiang; Lu, Ming; Wang, Songyou; Zheng, Yuxiang; Guo, Junpeng; Fan, Zhiyong; Chen, Liangyao

    2016-10-31

    Organic-inorganic perovskites were fabricated through a one-step procedure with different levels of hydration water in precursor solutions. The optical properties of CH3NH3PbI3 films were investigated through spectroscopic ellipsometry and photoluminescence measurements. With the measured optical constants, the efficiency limit of perovskite solar cells is predicted with a detailed balance model. By comparing the optical measurement to that of planar heterojunction solar cells, we conclude that the radiative efficiency and porosity of the perovskite film significantly influence the performance of perovskite solar cells. An optimized hydration-water concentration is obtained for the 3CH3NH3I:1PbAc2•xH2O precursor solution. The results can provide guidance for further optimization of the device performance of perovskite solar cells by utilizing hydration water.

  18. Electron energy transfer effect in Au NS/CH3NH3PbI3-xClx heterostructures via localized surface plasmon resonance coupling.

    Science.gov (United States)

    Cai, Chunfeng; Zhai, Jizhi; Bi, Gang; Wu, Huizhen

    2016-09-15

    Localized surface plasmon resonance coupling effects (LSPR) have attracted much attention due to their interesting properties. This Letter demonstrates significant photoluminescence (PL) enhancement in the Au NS/CH3NH3PbI3-xClx heterostructures via the LSPR coupling. The observed PL emission enhancement is mainly attributed to the hot electron energy transfer effect related to the LSPR coupling. For the energy transfer effect, photo-generated electrons will be directly extracted into Au SPs, rather than relaxed into exciton states. This energy transfer process is much faster than the diffusion and relaxation time of free electrons, and may provide new ideas on the design of high-efficiency solar cells and ultrafast response photodetectors.

  19. Formation of stable and metastable phases in reciprocal systems PbSe + MI2 = MSe + PbI2 (M = Hg, Mn, Sn)

    International Nuclear Information System (INIS)

    Odin, I.N.; Grin'ko, V.V.; Kozlovskij, V.F.; Safronov, E.V.; Gapanovich, M.V.

    2004-01-01

    Using data of differential thermal, X-ray phase and microstructural analyses, phase diagrams of reciprocal systems PbSe + MI 2 = MSe + PbI 2 (M=Hg (1), Mn (2), Sn (3)) were constructed. It was ascertained that the HgSe-PbI 2 diagonal in system 1 is stable. Transformations leading to crystallization of metastable ternary compound formed in the system PbSe-PbI 2 and metastable polytypes of lead iodide in systems 1 and 2 in the range of temperatures from 620 to 685 K were studied. New intermediate metastable phases in systems 1, 2 and 3 were prepared by melt quenching. Crystal lattice parameters of the phases crystallizing in the CdCl 2 structural type were defined [ru

  20. One-Step Cationic Grafting of 4-Hydroxy-TEMPO and its Application in a Hybrid Redox Flow Battery with a Crosslinked PBI Membrane.

    Science.gov (United States)

    Chang, Zhenjun; Henkensmeier, Dirk; Chen, Ruiyong

    2017-08-24

    By using a one-step epoxide ring-opening reaction between 4-hydroxy-2,2,6,6-tetramethylpiperidine 1-oxyl (4-hydroxy-TEMPO) and glycidyltrimethylammonium cation (GTMA + ), we synthesized a cation-grafted TEMPO (g + -TEMPO) and studied its electrochemical performance against a Zn 2+ /Zn anode in a hybrid redox flow battery. To conduct Cl - counter anions, a crosslinked methylated polybenzimidazole (PBI) membrane was prepared and placed between the catholyte and anolyte. Compared to 4-hydroxy-TEMPO, the positively charged g + - TEMPO exhibits enhanced reaction kinetics. Moreover, flow battery tests with g + -TEMPO show improved Coulombic, voltage, and energy efficiencies and cycling stability over 140 cycles. Crossover of active species through the membrane was not detected. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. A mindfulness training program based on brief practices (M-PBI) to reduce stress in the workplace: a randomised controlled pilot study.

    Science.gov (United States)

    Arredondo, M; Sabaté, M; Valveny, N; Langa, M; Dosantos, R; Moreno, J; Botella, L

    2017-01-01

    Work stress is a major contributor to absenteeism and reduced work productivity. A randomised and controlled study in employee-volunteers (with Perceived Stress Scale [PSS-14]>22) was performed to assess a mindfulness program based on brief integrated mindfulness practices (M-PBI) with the aim of reducing stress in the workplace. The PSS-14 of the employees before and after 8-weeks M-PBI program, as well as after a 20-week follow-up, was assessed (primary endpoint). The employees also carried the following questionnaires (secondary endpoints): Five Facet Mindfulness Questionnaire (FFMQ), Self-Compassion Scale (SCS), Experiences Questionnaire-Decentering (EQ-D), and Maslach Burnout Inventory-General Survey (MBI-GS). Heart Rate Variability (HRV) was measured during each session in a subgroup of employees (n = 10) of the interventional group randomly selected. A total of 40 employees (77.5% female median [SD] age of 36.6 [5.6] years) took part in this study: 21 and 19 in the intervention and control group, respectively. No differences in baseline characteristics were encountered between the groups. Results show a significant decrease in stress and increase in mindfulness over time in the intervention group (PSS-14 and FFMQ; p < 0.05 both). Additionally, an improvement in decentering (EQ-D), self-compassion (SCS) and burnout (MBI-GS) were also observed compared to the control group (p < 0.05 in all). HRV measurement also showed an improvement. In conclusion, a brief practices, 8-weeks M-BIP program is an effective tool to quickly reduce stress and improve well-being in a workplace.

  2. First-in-human study of pbi-05204, an oleander-derived inhibitor of akt, fgf-2, nf-κΒ and p70s6k, in patients with advanced solid tumors.

    Science.gov (United States)

    Hong, D S; Henary, H; Falchook, G S; Naing, A; Fu, S; Moulder, S; Wheler, J J; Tsimberidou, A; Durand, J B; Khan, R; Yang, P; Johansen, M; Newman, R A; Kurzrock, R

    2014-12-01

    PBI-05204, a Nerium oleander extract (NOE) containing the cardiac glycoside oleandrin, inhibits the α-3 subunit of Na-K ATPase, as well as FGF-2 export, Akt and p70S6K, hence attenuating mTOR activity. This first-in-human study determined the safety, pharmacokinetics (PK) and pharmacodynamics (PD) of PBI-05204 in patients with advanced cancer. Methods Forty-six patients received PBI-05204 by mouth for 21 of 28 days (3 + 3 trial design). Dose was escalated 100% using an accelerated titration design until grade 2 toxicity was observed. Plasma PK and mTOR effector (p70S6K and pS6) protein expressions were evaluated. Results Dose-limiting toxicities (grade 3 proteinuria, fatigue) were observed at dose level 8 (0.3383 mg/kg/day). Common possible drug-related adverse were fatigue (26 patients, 56.5%), nausea (19 patients, 41.3%) and diarrhea (15 patients, 32.6 %). Electrocardiogram monitoring revealed grade 1 atrioventricular block (N = 10 patients) and grade 2 supraventricular tachycardia (N = 1). The MTD was DL7 (0.2255 mg/kg) where no toxicity of grade ≥ 3 was observed in seven patients treated. Seven patients (15%) had stable disease > 4 months. Mean peak oleandrin concentrations up to 2 ng/mL were achieved, with area under the curves 6.6 to 25.5 μg/L*hr and a half-life range of 5-13 h. There was an average 10% and 35% reduction in the phosphorylation of Akt and pS6 in PBMC samples in 36 and 32 patients, respectively, tested between predose and 21 days of treatment. Conclusions PBI-05204 was well tolerated in heavily pretreated patients with advanced solid tumors. The recommended Phase II dose is 0.2255 mg/kg/day.

  3. CH3NH3PbI3 and CsPbI3 Supramolecular Clusters in 1D: Do They Evolve with the Same Principle of Cooperative Binding?

    Science.gov (United States)

    Varadwaj, Arpita; Varadwaj, Pradeep R.; Yamashita, Koichi

    Development of novel semiconductor-based photo-catalytic and -voltaic systems is a major area of research in nanoscience and technologies, and engineering. The process can be either direct or indirect in converting the light energy into electricity. Some of the photovoltaics include the organic, dye-sensitized, and halide perovskite solar cells, among others. Methylammonium lead iodide (CH3NH3PbI3) inorganic-organic hybrid perovskite is one among the many highly valued semiconductors reported till date, comparable with the inorganic cesium lead iodide (CsPbI3) perovskite. These are competitive candidates in the solar energy race. Nevertheless, this study was concentrated on the fundamental understanding of the rational designs of the CH3NH3PbI3 and CsPbI3 supramolecular materials using first-principles calculations, emerged though the self-assembly of the respective building blocks. It therefore addresses the question whether the (CH3NH3PbI3)n and (CsPbI3)n (n =1-10) supramolecular clusters are the consequences of additivity, or non-additive cooperative binding? For addressing this question, the supramolecular properties such as the polarizability, the intermolecular charge transfer, and the binding energy, etc., all w.r.t the cluster size n, are exploited. CREST-JST, 7 Gobancho, Chiyoda-ku, Tokyo, Japan 102-0076.

  4. Evidence and detailed study of a second-order phase transition in the (C6H11NH3)2[PbI4] organic-inorganic hybrid material

    International Nuclear Information System (INIS)

    Yangui, A.; Pillet, S.; Garrot, D.; Boukheddaden, K.; Triki, S.; Abid, Y.

    2015-01-01

    The thermal properties of the organic-inorganic hybrid material (C 6 H 11 NH 3 ) 2 [PbI 4 ] are investigated using diffuse reflectivity, spectroscopic ellipsometry, differential scanning calorimetry, Raman spectroscopy, and X-ray diffraction. The diffuse reflectivity, performed in heating mode, clearly evidences the presence of a singularity at 336 K. This is confirmed by the temperature dependence of the spectroscopic ellipsometry spectra, which points out a second-order phase transition at 336 K with a critical exponent ∼0.5. Differential scanning calorimetry measurements on a polycrystalline powder of (C 6 H 11 NH 3 ) 2 [PbI 4 ] show a reversible phase transition detected at T C  = 336 K without hysteresis. Raman spectroscopy data suggest that this transition arises from a change in the interactions between inorganic sheets (([PbI 4 ] 2− ) ∞ ) and organic protonated molecules ([C 6 H 11 NH 3 ] + ). The structural analysis from power X-ray diffraction reveals an incomplete order-disorder transition of the cyclohexylammonium cation, causing a subtle contraction of the inter-plane distance. The transition results from repulsive close contacts between the organic molecules in the interlayer spacing

  5. Unraveling current hysteresis effects in regular-type C60-CH3NH3PbI3 heterojunction solar cells.

    Science.gov (United States)

    Chen, Lung-Chien; Lin, Yu-Shiang; Tang, Po-Wen; Tai, Chao-Yi; Tseng, Zong-Liang; Lin, Ja-Hon; Chen, Sheng-Hui; Kuo, Hao-Chung

    2017-11-23

    Comprehensive studies were carried out to understand the origin of the current hysteresis effects in highly efficient C 60 -CH 3 NH 3 PbI 3 (MAPbI 3 ) heterojunction solar cells, using atomic-force microscopy, transmittance spectra, photoluminescence spectra, X-ray diffraction patterns and a femtosecond time-resolved pump-probe technique. The power conversion efficiency (PCE) of C 60 -MAPbI 3 solar cells can be increased to 18.23% by eliminating the point (lattice) defects in the MAPbI 3 thin film which is fabricated by using the one-step spin-coating method with toluene washing treatment. The experimental results show that the point defects and surface defects of the MAPbI 3 thin films can be minimized by varying the dropping time of the washing solvent. The point defects (surface defects) can be reduced with an (a) increase (decrease) in the dropping time, resulting in an optimized dropping time for obtaining the defect-minimized MAPbI 3 thin film deposited on top of the C 60 thin film. Consequently, the formation of the defect-minimized MAPbI 3 thin film allows for high-efficiency MAPbI 3 solar cells.

  6. Nanostructured TiO2/CH3NH3PbI3 heterojunction solar cells employing spiro-OMeTAD/Co-complex as hole-transporting material

    KAUST Repository

    Noh, Jun Hong

    2013-01-01

    For using 2,2′,7,7′-tetrakis(N,N′-di-p- methoxyphenylamine)-9,9′-spirobifluorene (spiro-OMeTAD) as a hole conductor in solar cells, it is necessary to improve its charge-transport properties through electrochemical doping. With the aim of fabricating efficient mesoscopic TiO2/CH3NH3PbI3 heterojunction solar cells, we used tris[2-(1H-pyrazol-1-yl)-4-tert- butylpyridine)cobalt(iii) tris(bis(trifluoromethylsulfonyl) imide)] (FK209) as a p-dopant for spiro-OMeTAD. The mixture of spiro-OMeTAD, FK209, lithium bis(trifluoromethylsulfonyl)imide (Li-TFSI), and 4-tert-butylpyridine (TBP) exhibited significantly higher performance than mixtures of pristine spiro-OMeTAD, spiro-OMeTAD, and FK209, and spiro-OMeTAD, Li-TFSI, and TBP. Such a synergistic effect between the Co-complex and Li-TFSI in conjunction with spiro-OMeTAD effectively improved the power conversion efficiency (PCE) of the fabricated solar cells. As a result, we achieved PCE of 10.4%, measured under standard solar conditions (AM 1.5G, 100 mW cm-2). © 2013 The Royal Society of Chemistry.

  7. Experimental Characterization of the Poisoning Effects of Methanol-Based Reformate Impurities on a PBI-Based High Temperature PEM Fuel Cell

    Directory of Open Access Journals (Sweden)

    Samuel Simon Araya

    2012-10-01

    Full Text Available In this work the effects of reformate gas impurities on a H3PO4-doped polybenzimidazole (PBI membrane-based high temperature proton exchange membrane fuel cell (HT-PEMFC are studied. A unit cell assembly with a BASF Celtec®-P2100 high temperature membrane electrode assembly (MEA of 45 cm2 active surface area is investigated by means of impedance spectroscopy. The concentrations in the anode feed gas of all impurities, unconverted methanol-water vapor mixture, CO and CO2 were varied along with current density according to a multilevel factorial design of experiments. Results show that all the impurities degrade the performance, with CO being the most degrading agent and CO2 the least. The factorial analysis shows that there is interdependence among the effects of the different factors considered. This interdependence suggests, for example, that tolerances to concentrations of CO above 2% may be compromised by the presence in the anode feed of CO2. Methanol has a poisoning effect on the fuel cell at all the tested feed ratios, and the performance drop is found to be proportional to the amount of methanol in feed gas. The effects are more pronounced when other impurities are also present in the feed gas, especially at higher methanol concentrations.

  8. High throughput two-step ultrasonic spray deposited CH3NH3PbI3 thin film layer for solar cell application

    Science.gov (United States)

    Lan, Ding-Hung; Hong, Shao-Huan; Chou, Li-Hui; Wang, Xiao-Feng; Liu, Cheng-Liang

    2018-06-01

    Organometal halide perovskite materials have demonstrated tremendous advances in the photovoltaic field recently because of their advantageous features of simple fabrication and high power conversion efficiency. To meet the high demand for high throughput and cost-effective, we present a wet process method that enables the probing of the parameters for perovskite layer deposition through two-step sequential ultrasonic spray-coating. This paper describes a detailed investigation on the effects of modification of spray precursor solution (PbI2 and CH3NH3I precursor concentration and solvents used) and post-annealing condition (temperature and time), which can be performed to create optimal film quality as well as improve device efficiency. Through the systematic optimization, the inverted planar perovskite solar cells show the reproducible photovoltaic properties with best power conversion efficiency (PCE) of 10.40% and average PCE of 9.70 ± 0.40%. A continuous spray-coating technique for rapid fabrication of total 16 pieces of perovskite films was demonstrated for providing a viable alternative for the high throughput production of the perovskite solar cells.

  9. Effect of Thermal and Structural Disorder on the Electronic Structure of Hybrid Perovskite Semiconductor CH3NH3PbI3.

    Science.gov (United States)

    Singh, Shivam; Li, Cheng; Panzer, Fabian; Narasimhan, K L; Graeser, Anna; Gujar, Tanaji P; Köhler, Anna; Thelakkat, Mukundan; Huettner, Sven; Kabra, Dinesh

    2016-08-04

    In this Letter, we investigate the temperature dependence of the optical properties of methylammonium lead iodide (MAPbI3 = CH3NH3PbI3) from room temperature to 6 K. In both the tetragonal (T > 163 K) and the orthorhombic (T photoluminescence (PL) measurements) decreases with decrease in temperature, in contrast to what is normally seen for many inorganic semiconductors, such as Si, GaAs, GaN, etc. We show that in the perovskites reported here, the temperature coefficient of thermal expansion is large and accounts for the positive temperature coefficient of the band gap. A detailed analysis of the exciton line width allows us to distinguish between static and dynamic disorder. The low-energy tail of the exciton absorption is reminiscent of Urbach absorption. The Urbach energy is a measure of the disorder, which is modeled using thermal and static disorder for both the phases separately. The static disorder component, manifested in the exciton line width at low temperature, is small. Above 60 K, thermal disorder increases the line width. Both these features are a measure of the high crystal quality and low disorder of the perovskite films even though they are produced from solution.

  10. Structural, optical and morphological studies of Cd2+ doping in CH3NH3PbI3 perovskite semiconductor at Pb2+ site for photovoltaic applications

    Science.gov (United States)

    Parrey, Khursheed; Warish, Mohd.; Devi, Nisha; Niazi, A.; Aziz, A.; Ansari, S. G.

    2018-05-01

    Doping of semiconductors in a controlled mannner have paramount technological importance as far as the optical and electronic properties of the devices are concerned. Hybrid organic-inorganic perovskites (HOPs) as intrinsic semiconductors have sensational properties required for both the solar photovoltaics and perovskite light emitting diodes. However, undoped and complexity in the dpoing process of HOPs have limited their exploitation in the field of elcronics. In this papper we present the synthesis of HOP semiconductor (CH3NH3PbI3) doped in Pb2+ position by Cd2+. We studied the effect of the incorporation of Cd2+ into the crystalline structure and analysed the changes in the properties like crystal structure, optical absorption and the surface morphology. The structure of HOPs confirmed by X-ray diffraction analysis is tetragonal perovskite type. It can be found that the crystallinity of the samples was enhanced with the doping concentration as the intensity of diffraction peaks were observed to increase with doping. The absorption spectra as obtained from UV-Visible spectrophotometry and Tauc plot analysis indicated that the band gap observed (1.73 eV) is direct type and gets reduced to 1.67 eV with the doping concentration. The red shift may be due to the increase in the size of nanocrystalline material with doping.

  11. A Feasible and Effective Post-Treatment Method for High-Quality CH3NH3PbI3 Films and High-Efficiency Perovskite Solar Cells

    Directory of Open Access Journals (Sweden)

    Yaxiao Jiang

    2018-01-01

    Full Text Available The morphology control of CH3NH3PbI3 (MAPbI3 thin-film is crucial for the high-efficiency perovskite solar cells, especially for their planar structure devices. Here, a feasible and effective post-treatment method is presented to improve the quality of MAPbI3 films by using methylamine (CH3NH2 vapor. This post-treatment process is studied thoroughly, and the perovskite films with smooth surface, high preferential growth orientation and large crystals are obtained after 10 s treatment in MA atmosphere. It enhances the light absorption, and increases the recombination lifetime. Ultimately, the power conversion efficiency (PCE of 15.3% for the FTO/TiO2/MAPbI3/spiro-OMeTAD/Ag planar architecture solar cells is achieved in combination with this post-treatment method. It represents a 40% improvement in PCE compared to the best control cell. Moreover, the whole post-treatment process is simple and cheap, which only requires some CH3NH2 solution in absolute ethanol. It is beneficial to control the reaction rate by changing the volume of the solution. Therefore, we are convinced that the post-treatment method is a valid and essential approach for the fabrication of high-efficiency perovskite solar cells.

  12. Dependence of Acetate-Based Antisolvents for High Humidity Fabrication of CH3NH3PbI3 Perovskite Devices in Ambient Atmosphere.

    Science.gov (United States)

    Yang, Fu; Kapil, Gaurav; Zhang, Putao; Hu, Zhaosheng; Kamarudin, Muhammad Akmal; Ma, Tingli; Hayase, Shuzi

    2018-05-16

    High-efficiency perovskite solar cells (PSCs) need to be fabricated in the nitrogen-filled glovebox by the atmosphere-controlled crystallization process. However, the use of the glovebox process is of great concern for mass level production of PSCs. In this work, notable efficient CH 3 NH 3 PbI 3 solar cells can be obtained in high humidity ambient atmosphere (60-70% relative humidity) by using acetate as the antisolvent, in which dependence of methyl, ethyl, propyl, and butyl acetate on the crystal growth mechanism is discussed. It is explored that acetate screens the sensitive perovskite intermediate phases from water molecules during perovskite film formation and annealing. It is revealed that relatively high vapor pressure and high water solubility of methyl acetate (MA) leads to the formation of highly dense and pinhole free perovskite films guiding to the best power conversion efficiency (PCE) of 16.3% with a reduced hysteresis. The devices prepared using MA showed remarkable shelf life stability of more than 80% for 360 h in ambient air condition, when compared to the devices fabricated using other antisolvents with low vapor pressure and low water solubility. Moreover, the PCE was still kept at 15.6% even though 2 vol % deionized water was added in the MA for preparing the perovskite layer.

  13. Efficient CH3NH3PbI3 perovskite/fullerene planar heterojunction hybrid solar cells with oxidized Ni/Au/Cu transparent electrode

    Science.gov (United States)

    Lai, Wei-Chih; Lin, Kun-Wei; Guo, Tzung-Fang; Chen, Peter; Liao, Yuan-Yu

    2018-02-01

    We demonstrated the performance of inverted CH3NH3PbI3 perovskite-based solar cells (SCs) with a thermally oxidized nickel/gold/copper (Ni/Au/Cu) trilayer transparent electrode. Oxidized Ni/Au/Cu is a high transparent layer and has less resistance than the oxidized Ni/Au layer. Like the oxidized Ni/Au layer, oxidized Ni and Cu in oxidized Ni/Au/Cu could perform as a hole transport layer of the perovskite-based SCs. It leads to improved perovskite SC performance on an open circuit voltage of 1.01 V, a short circuit current density of 14.36 mA/cm2, a fill factor of 76.7%, and a power conversion efficiency (η%) of 11.1%. The η% of perovskite SCs with oxidized Ni (10 nm)/Au (6 nm)/Cu (1 nm) improved by approximately 10% compared with that of perovskite SCs with oxidized Ni/Au.

  14. Stability and carrier mobility of organic-inorganic hybrid perovskite CH3NH3PbI3 in two-dimensional limit

    Science.gov (United States)

    Huang, Kui; Lai, Kang; Yan, Chang-Lin; Zhang, Wei-Bing

    2017-10-01

    Recently, atomically thin organic-inorganic hybrid perovskites have been synthesized experimentally, which opens up new opportunities for exploring their novel properties in the 2D limit. Based on the comparative density functional theory calculation with and without spin-orbit coupling effects, the stability, electronic structure, and carrier mobility of the two-dimensional organic-inorganic hybrid perovskites MAPbI3 (MA = CH3NH3) have been investigated systemically. Two single-unit-cell-thick 2D MAPbI3 terminated by PbI2 and CH3NH3I are constructed, and their thermodynamic stabilities are also evaluated using the first-principles constrained thermodynamics method. Our results indicate that both 2D MAPbI3 with different terminations can be stable under certain conditions and have a suitable direct bandgap. Moreover, they are also found to have termination-dependent band edge and carrier mobility. The acoustic-phonon-limited carrier mobilities estimated using the deformation theory and effective mass approximation are on the order of thousands of square centimeters per volt per second and also highly anisotropic. These results indicate that 2D MAPbI3 are competitive candidates for low-dimensional photovoltaic applications.

  15. Optical absorption enhancement in NH2CH=NH2PbI3 lead halide perovskite solar cells with nanotextures

    Science.gov (United States)

    Xie, Ziang; Sun, Shuren; Xie, Xixi; Hou, Ruixiang; Xu, Wanjin; Li, Yanping; Qin, G. G.

    2018-01-01

    This article reports, for the first time to our knowledge, that the power conversion efficiencies (PCEs) of planar NH2CH=NH2PbI3 (FAPbI3) lead halide perovskite solar cells (SCs) can be largely improved by fabricating nanotextures on the SC surface. Four kinds of nanotextures are investigated and compared with each other: column hollow (CLH) nanoarrays, cone hollow (CNH) nanoarrays, square prism hollow (SPH) nanoarrays, and pyramid hollow (PYH) nanoarrays. Compared with the PCEs of the planar SCs with the same layer depth d, it is found that when d is in the range of 125-500 nm and when the array period, as well as the filling fraction of the nanotexture, are optimized, the ultimate efficiency increased 29%-50% for the CLH and SPH textured FAPbI3 SCs relative to the planar ones, and 20%-41% for the CNH and PYH textured FAPbI3 SCs relative to the planar ones. When d < 250 nm, the optimized ultimate efficiencies of the CLH and SPH textured FAPbI3 SCs with optimized nanotextures are higher than those of the CNH and PYH ones, and vice versa. The reasons why fabricating nanotextures on SC surfaces can largely improve the PCE of the FAPbI3 SCs are discussed.

  16. Electron Transfer from Triplet State of TIPS-Pentacene Generated by Singlet Fission Processes to CH3NH3PbI3 Perovskite.

    Science.gov (United States)

    Lee, Sangsu; Hwang, Daesub; Jung, Seok Il; Kim, Dongho

    2017-02-16

    To reveal the applicability of singlet fission processes in perovskite solar cell, we investigated electron transfer from TIPS-pentacene to CH 3 NH 3 PbI 3 (MAPbI 3 ) perovskite in film phase. Through the observation of the shorter fluorescence lifetime in TIPS-pentacene/MAPbI 3 perovskite bilayer film (5 ns) compared with pristine MAPbI 3 perovskite film (20 ns), we verified electron-transfer processes between TIPS-pentacene and MAPbI 3 perovskite. Furthermore, the observation of singlet fission processes, a faster decay rate, TIPS-pentacene cations, and the analysis of kinetic profiles of the intensity ratio between 500 and 525 nm in the TA spectra of the TIPS-pentacene/MAPbI 3 perovskite bilayer film indicate that electron transfer occurs from triplet state of TIPS-pentacene generated by singlet fission processes to MAPbI 3 perovskite conduction band. We believe that our results can provide useful information on the design of solar cells sensitized by singlet fission processes and pave the way for new types of perovskite solar cells.

  17. Ba2+ Doped CH3NH3PbI3 to Tune the Energy State and Improve the Performance of Perovskite Solar Cells

    International Nuclear Information System (INIS)

    Zhang, Hanbing; Shang, Ming-hui; Zheng, Xiaoying; Zeng, Zhaobing; Chen, Renjie; Zhang, Ying; Zhang, Jing; Zhu, Yuejin

    2017-01-01

    Highlights: •Ba doping enlarges the energy band gap of MAPb 1-x Ba x I 3 . •Voc and Jsc are enhanced in perovskite solar cells. •DFT calculation proves the experiment results. -- Abstract: Elements substitution and doping in perovskite CH 3 NH 3 PbI 3 exhibit versatile tunability of energy band structure and opto-electric properties. Ba 2+ is chosen to substitute Pb 2+ for its similar valence state and ionic radius with Pb 2+ . Ba 2+ doping in perovskite (mol% <5) slightly enlarges the optic energy gap by conduction band minimum(CBM) upshifting to vacuum energy level, which is due to the smaller electronegativity of Ba than Pb. The enlarged band gap is also verified by density function theory calculations. In n-i-p structure perovskite solar cells (PSCs), because of the higher CBM of doped perovskite, the Fermi energy difference between n and p side is enlarged and the electron injection from the perovskite to TiO 2 is improved. Thus, both the photovoltage and photocurrent are improved by small amount Ba 2+ doping, resulting optimized 17.4% efficiency under AM1.5. This work reveals the relationship between the doping element property and the energy band structure of the perovskite, and highlights the doping method to improve the performance of PSCs.

  18. Systematic characterization of HT PEMFCs containing PBI/H{sub 3}PO{sub 4} systems. Thermodynamic analysis and experimental investigations

    Energy Technology Data Exchange (ETDEWEB)

    Bandlamudi, George Chakravarthy

    2011-07-01

    High temperature PEMFCs (HT PEMFCs), operating at 120 C - 200 C are rather new and offer tremendous advantages. For instance fuel cells operating at > 100 C reduce issues related to water management substantially. Circulating excess heat energy from such fuel cells into other system processes where heat is needed would be much more practical (due to higher {delta}T) compared to the standard LT PEMFCs where the produced heat has less than 90 C (lower {delta}T). Higher tolerance to fuel impurities such as CO, by these HT PEMFCs has made them very practical for many applications. Although PBI/H{sub 3}PO{sub 4} based membranes have been explored for use in PEMFCs from the early 1990s, only recently PEMEAS (currently BASF) has marketed them as commercially available MEAs. Besides, some companies such as Sartorius (currently Elcomax) and Fuma Tech of Germany, Danish Power Systems of Denmark are offering HT-MEAs on a commercial basis. Although some issues remain, such as development of durable and low cost catalyst and catalyst support materials, acid management, the rapid development of membranes and MEAs has been motivated by a huge demand from many a market. Recently, DLR in Germany has tested its pilot airplane (Antares) fully operated with a HT PEMFC stack (with on-board H{sub 2} bottle). ClearEdge Power in Portland, USA has been developing systems based on HT PEMFC technology to be deployed in the US as well as in South Korean households. Many more companies are increasingly interested in this technology due to the many fold advantages it has to offer. This work is aimed at elucidating this HT PEMFC technology, in terms of giving an in-depth view of what it means to operate a HT PEMFC. (orig.)

  19. Effect of Annealing Process on CH3NH3PbI3-XClX Film Morphology of Planar Heterojunction Perovskite Solar Cells with Optimal Compact TiO2 Layer

    Directory of Open Access Journals (Sweden)

    Dan Chen

    2017-01-01

    Full Text Available The morphology of compact TiO2 film used as an electron-selective layer and perovskite film used as a light absorption layer in planar perovskite solar cells has a significant influence on the photovoltaic performance of the devices. In this paper, the spin coating speed of the compact TiO2 is investigated in order to get a high-quality film and the compact TiO2 film exhibits pinhole- and crack-free films treated by 2000 rpm for 60 s. Furthermore, the effect of annealing process, including annealing temperature and annealing program, on CH3NH3PbI3-XClX film morphology is studied. At the optimal annealing temperature of 100°C, the CH3NH3PbI3-XClX morphology fabricated by multistep slow annealing method has smaller grain boundaries and holes than that prepared by one-step direct annealing method, which results in the reduction of grain boundary recombination and the increase of Voc. With all optimal procedures, a planar fluorine-doped tin oxide (FTO substrate/compact TiO2/CH3NH3PbI3-XClX/Spiro-MeOTAD/Au cell is prepared for an active area of 0.1 cm2. It has achieved a power conversion efficiency (PCE of 14.64%, which is 80.3% higher than the reference cell (8.12% PCE without optimal perovskite layer. We anticipate that the annealing process with optimal compact TiO2 layer would possibly become a promising method for future industrialization of planar perovskite solar cells.

  20. Interfacial Interactions in Monolayer and Few-Layer SnS/CH3 NH3 PbI3 Perovskite van der Waals Heterostructures and Their Effects on Electronic and Optical Properties.

    Science.gov (United States)

    Li, Jian-Cai; Wei, Zeng-Xi; Huang, Wei-Qing; Ma, Li-Li; Hu, Wangyu; Peng, Ping; Huang, Gui-Fang

    2018-02-05

    A high light-absorption coefficient and long-range hot-carrier transport of hybrid organic-inorganic perovskites give huge potential to their composites in solar energy conversion and environmental protection. Understanding interfacial interactions and their effects are paramount for designing perovskite-based heterostructures with desirable properties. Herein, we systematically investigated the interfacial interactions in monolayer and few-layer SnS/CH 3 NH 3 PbI 3 heterostructures and their effects on the electronic and optical properties of these structures by density functional theory. It was found that the interfacial interactions in SnS/CH 3 NH 3 PbI 3 heterostructures were van der Waals (vdW) interactions, and they were found to be insensitive to the layer number of 2D SnS sheets. Interestingly, although their band gap decreased upon increasing the layer number of SnS, the near-gap electronic states and optical absorption spectra of these heterostructures were found to be strikingly similar. This feature was determined to be critical for the design of 2D layered SnS-based heterostructures. Strong absorption in the ultraviolet and visible-light regions, type II staggered band alignment at the interface, and few-layer SnS as an active co-catalyst make 2D SnS/CH 3 NH 3 PbI 3 heterostructures promising candidates for photocatalysis, photodetectors, and solar energy harvesting and conversion. These results provide first insight into the nature of interfacial interactions and are useful for designing hybrid organic-inorganic perovskite-based devices with novel properties. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. PBI treated polypropylene battery separator

    Science.gov (United States)

    Veryzwyvelt, S. A.

    1981-01-01

    A generalized procedure for fabricating the separator is described. Some of the desired properties considered in fabricating the separator material for nickel-cadmium cells were good mechanical strength, good chemical stability, good wettability to the electrolyte, high electrolyte retention, and gas passage.

  2. Oxygen influencing the photocarriers lifetime of CH3NH3PbI3-xClx film grown by two-step interdiffusion method and its photovoltaic performance

    Science.gov (United States)

    Yuan, Shuai; Qiu, Zhiwen; Zhang, Hailiang; Gong, Haibo; Hao, Yufeng; Cao, Bingqiang

    2016-01-01

    During the growth of CH3NH3PbI3-xClx (MAPbI3-xClx) perovskite films by the two-step inter-diffusion method, the presence of a trace amount of oxygen gas is critical to their physical properties and photovoltaic performance. As the oxygen concentration increases, poor film morphologies and incomplete surface coverage are observed. Moreover, by XRD, Raman scattering, and photoluminescence measurements, we find that MAPbI3-xClx grains become more distorted and the electron-hole recombination rate dramatically increases. Higher oxygen concentration triggers a sharp decrease in the current density and the fill factor of corresponding solar cells, which degrades device performance, on average, from 14.3% to 4.4%. This work proves the importance of controlling the oxygen atmosphere in the fabrication of high-performance perovskite solar cells.

  3. Near-band-edge optical responses of solution-processed organic-inorganic hybrid perovskite CH3NH3PbI3 on mesoporous TiO2 electrodes

    Science.gov (United States)

    Yamada, Yasuhiro; Nakamura, Toru; Endo, Masaru; Wakamiya, Atsushi; Kanemitsu, Yoshihiko

    2014-03-01

    We studied the near-band-edge optical responses of solution-processed CH3NH3PbI3 on mesoporous TiO2 electrodes, which is utilized in mesoscopic heterojunction solar cells. Photoluminescence (PL) and PL excitation spectra peaks appear at 1.60 and 1.64 eV, respectively. The transient absorption spectrum shows a negative peak at 1.61 eV owing to photobleaching at the band-gap energy, indicating a direct band-gap semiconductor. On the basis of the temperature-dependent PL and diffuse reflectance spectra, we clarified that the absorption tail at room temperature is explained in terms of an Urbach tail and consistently determined the band-gap energy to be ˜1.61 eV at room temperature.

  4. Bloating in (Pb0.95Sn0.05Te)0.92(PbS)0.08-0.055%PbI2 Thermoelectric Specimens as a Result of Processing Conditions

    Science.gov (United States)

    Ni, Jennifer E.; Case, Eldon D.; Stewart, Ryan; Wu, Chun-I.; Hogan, Timothy P.; Kanatzidis, Mercouri G.

    2012-06-01

    Lead chalcogenides such as (Pb0.95Sn0.05Te)0.92(PbS)0.08-0.055%PbI2 have received attention due to their encouraging thermoelectric properties. For the hot pressing (HP) and pulsed electric current sintering (PECS) techniques used in this study, decomposition reactions can generate porosity (bloating). Porosity in turn can degrade electrical, thermal, and mechanical properties. In this study, microstructural observations (scanning electron microscopy) and room-temperature elasticity measurements (resonant ultrasound spectroscopy) were used to characterize bloating generated during post-densification anneals. Although every HP specimen bloated during post-densification annealing, no bloating was observed for the PECS specimens processed from dry milled only powders. The lack of bloating for the annealed PECS specimens may be related to the electrical discharge intrinsic in the PECS process, which reportedly cleans the powder particle surfaces during densification.

  5. Oxygen influencing the photocarriers lifetime of CH3NH3PbI3−xClx film grown by two-step interdiffusion method and its photovoltaic performance

    International Nuclear Information System (INIS)

    Yuan, Shuai; Qiu, Zhiwen; Zhang, Hailiang; Gong, Haibo; Cao, Bingqiang; Hao, Yufeng

    2016-01-01

    During the growth of CH 3 NH 3 PbI 3−x Cl x (MAPbI 3−x Cl x ) perovskite films by the two-step inter-diffusion method, the presence of a trace amount of oxygen gas is critical to their physical properties and photovoltaic performance. As the oxygen concentration increases, poor film morphologies and incomplete surface coverage are observed. Moreover, by XRD, Raman scattering, and photoluminescence measurements, we find that MAPbI 3−x Cl x grains become more distorted and the electron-hole recombination rate dramatically increases. Higher oxygen concentration triggers a sharp decrease in the current density and the fill factor of corresponding solar cells, which degrades device performance, on average, from 14.3% to 4.4%. This work proves the importance of controlling the oxygen atmosphere in the fabrication of high-performance perovskite solar cells

  6. Perylene bisimide hydrogels and lyotropic liquid crystals with temperature-responsive color change† †Electronic supplementary information (ESI) available: Detailed procedures and results for all reported experiments, along with synthetic details for PBI 1. See DOI: 10.1039/c6sc02249a Click here for additional data file.

    Science.gov (United States)

    Görl, Daniel; Soberats, Bartolome; Herbst, Stefanie; Stepanenko, Vladimir

    2016-01-01

    The self-assembly of perylene bisimide (PBI) dyes bearing oligo ethylene glycol (OEG) units in water affords responsive functional nanostructures characterized by their lower critical solution temperature (LCST). Tuning of the LCST is realized by a supramolecular approach that relies on two structurally closely related PBI–OEG molecules. The two PBIs socially co-assemble in water and the resulting nanostructures exhibit a single LCST in between the transition temperatures of the aggregates formed by single components. This permits to precisely tune the transition from a hydrogel to a lyotropic liquid crystal state at temperatures between 26 and 51 °C by adjusting the molar fraction of the two PBIs. Owing to concomitant changes in PBI–PBI interactions this phase transition affords a pronounced color change with “fluorescence-on” response that can be utilized as a smart temperature sensory system. PMID:28451124

  7. PENGGUNAAN MODEL PEMBELAJARAN PROBLEM BASED INSTRUCTION (PBI UNTUK MENINGKATKAN KEAKTIFAN DAN HASIL BELAJAR MATEMATIKA SISWA KELAS 9B SEMESTER GASAL TAHUN PELAJARAN 2014/2015 SMP NEGERI 2 TUNTANG - SEMARANG

    Directory of Open Access Journals (Sweden)

    Tri Muah

    2016-02-01

    Full Text Available Penelitian tindakan kelas ini bertujuan untuk meningkatkan keaktifan dan hasil belajar matematika siswa pada materi peluang dengan penerapan model pembelajaran PBI bagi kelas 9B Semester Gasal SMP Negeri 2 Tuntang Kabupaten Semarang. Hasil penelitian kondisi awal menggunakan wawancara, observasi dan analisis butir soal, siswa kelas 9B ini memiliki keaktifan belajar yang kurang, kemudian berdampak pada hasil belajar siswa rendah juga. Berdasarkan kondisi awal tersebut, perlu dilakukan penelitian tindakan kelas untuk meningkatkan keaktifan belajar dan hasil belajar matematika siswa. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK dengan mengetahui model prosedur penelitian yang dikembangkan oleh Kemmis dan Mc Taggart berupa model penelitian yang spiral yang pada umumnya direncanakan terdiri dari dua siklus. Setiap siklus terdiri dari empat tahap yaitu: 1 tahap pelaksanaan tindakan (planning, 2 tahap pelaksanaan tindakan (acting, 3 tahap pengamatan (observing, dan 4 tahap refleksi (reflecting. Subjek penelitian ini adalah siswa kelas 9B SMP Negeri 2 Tuntang yang terdiri dari 32 orang siswa. Data diperoleh melalui tes kognitif dan lembar observasi siswa. Dari hasil penelitian ini dapat disimpulkan bahwa model pembelajaran PBI dapat meningkatkan keaktifan belajar dan hasil belajar matematika siswa. Hal ini ditunjukan dengan hasil wawancara dan observasi yang dilakukan sebelum penelitian ini dilakukan dimana keaktifan belajar siswa secara individu 14% dan keaktifan belajar siswa secara kelompok 50% dan hasil belajar matematika siswa pada materi sebelumnya juga menunjukkan hasil belajar yang rendah dimana dari 32 siswa 6.25% siswa mendapatkan nilai tuntas dengan rata-rata 34,3. Setelah dilakukan tindakan pada siklus I, terjadi peningkatan terhadap keaktifan belajar dan hasil belajar matematika. Lembar observasi pada siklus I menunjukkan keaktifan siswa secara individu meningkat menjadi 27.4% dan keaktifan belajar siswa secara kelompok 65% dan

  8. Inorganic alkali lead iodide semiconducting APbI3 (A = Li, Na, K, Cs and NH4PbI3 films prepared from solution: Structure, morphology, and electronic structure

    Directory of Open Access Journals (Sweden)

    Eric Mankel

    2016-06-01

    Full Text Available APbI3 alkali lead iodides were prepared from aqueous (A= Na, Cs, ammonium NH4+, and methyl­ammonium CH3NH3+ and acetone (A= Li, K solutions by a self-organization low temperature process. Diffraction analysis revealed that the methylammonium-containing system (MAPbI3 crystallizes into a tetragonal perovskite structure, whereas the alkali and NH4+ systems adopt orthorhombic structures. Morphological inspection confirmed the influence of the cation on the growth mechanism: for A = Cs and NH4+, needle-like crystallites with lengths up to 3–4 mm; for A = K, thin stripes with lengths up to 5–6 mm; and for A = MA+, dodecahedral crystallites were observed. For A = Li and Na, the APbI3 systems typically resulted in polycrystalline aggregates. Optical absorption measurements demonstrated large energy band gaps for the alkali and ammonium systems with values between 2.19 and 2.40 eV. For electronic and chemical characterization by photoelectron spectroscopy, the as-prepared powders were dissolved in di-methylformamide and re-crystallized as thin films on F:SnO2 substrates by spin-coating. The binding energy differences between Pb4f and I3d core levels are highly similar in the investigated systems and close to the value measured for PbI2, indicating similar relative partial charges and formal oxidation states. The binding energies of the alkali ions are in accordance with oxidation state +1. The X-ray excited valence band spectra of the investigated APbI3 systems exhibited similar line shapes in the region between the valence band maximum and 4.5 eV higher binding energy due to common PbI6 octahedra which dominate the electronic structure. While the ionization energy values are quite similar (6.15 ± 0.25 eV, the Fermi-level positions of the unintentionally doped materials vary for different cations and different batches of the same material, which indicates that the position of the Fermi level can be influenced by changing the process parameters.

  9. Memories of early attachment: the use of PBI as a predictor of outcome in Pesso-Boyden System Psychomotor (PBSP) group therapy, Cognitive-Behavioural Group Therapy (CBGT), Individual Cognitive-Behavioural Therapy (CBT) and Individual Treatment As Usual (TAU) with adult out-patients.

    Science.gov (United States)

    Ryum, Truls; Vogel, Patrick A; Hagen, Roger; Stiles, Tore C

    2008-01-01

    To examine the predictive validity of the Parental Bonding Instrument (PBI) for outcome in individual and group psychotherapy. Data from four different clinical trials were combined, yielding a total of 105 patients. After controlling for gender, age and initial symptomatic distress, the predictive validity of the PBI subscales was investigated using the symptom checklist-90-revised (SCL-90-R) and inventory of interpersonal problems-64 (IIP-64) at termination as dependent measures in each treatment condition using separate hierarchical multiple regression analyses. Using the SCL-90-R at termination as dependent measure, reports of higher paternal and maternal care were related to a worse outcome in the Pesso-Boyden System Psychomotor condition, whereas reports of higher paternal care were related to a better outcome in the Cognitive-Behavioural Therapy condition. Also, higher maternal protection was related to a better outcome in the Cognitive-Behavioral Group condition. Using the IIP-64 at termination as dependent measure, reports of higher paternal protection were related to a better outcome in the Treatment As Usual condition. The study shows that the PBI may function as a clinical predictor for treatment response, although the results were somewhat contrary to previous reportings. Future studies should contrast and investigate possible differences between individual and group treatments further, as well as more clearly defined diagnostic groups. Clinical implications are presented. Copyright (c) 2008 John Wiley & Sons, Ltd.

  10. Scintillation properties of (C sub 6 H sub 1 sub 3 NH sub 3) sub 2 PbI sub 4 Exciton luminescence of an organic/inorganic multiple quantum well structure compound induced by 2.0 MeV protons

    CERN Document Server

    Shibuya, K; Takeoka, Y; Asai, K

    2002-01-01

    We report a new type of scintillator especially suitable for pulse-radiation detection. Thin films of organic/inorganic perovskite compound (n-C sub 6 H sub 1 sub 3 NH sub 3) sub 2 PbI sub 4 , which is characterized by a multiple quantum well structure, were bombarded by 2.0 MeV protons, and their radiation-induced emission spectra were obtained. A single and sharp emission peak due to an exciton was observed at the wavelength of 524 nm. This emission was clearly detected even at room temperature, and its quantum efficiency was very high. The line shape of this emission did not change, retaining its sharpness, and no other emissions appeared throughout the irradiation. The optical response of (n-C sub 6 H sub 1 sub 3 NH sub 3) sub 2 PbI sub 4 is very fast. (n-C sub 6 H sub 1 sub 3 NH sub 3) sub 2 PbI sub 4 is a promising scintillator material, meeting requirements not satisfied by conventional scintillators.

  11. [Agrobacterium-mediated sunflower transformation (Helianthus annuus L.) in vitro and in Planta using strain of LBA4404 harboring binary vector pBi2E with dsRNA-suppressor proline dehydrogenase gene].

    Science.gov (United States)

    Tishchenko, E N; Komisarenko, A G; Mikhal'skaia, S I; Sergeeva, L E; Adamenko, N I; Morgun, B V; Kochetov, A V

    2014-01-01

    To estimate the efficiency of proline dehydrogenase gene suppression towards increasing of sunflower (Helianthus annuus L.) tolerance level to water deficit and salinity, we employed strain LBA4404 harboring pBi2E with double-stranded RNA-suppressor, which were prepared on basis arabidopsis ProDH1 gene. The techniques of Agrobacterium-mediated transformation in vitro and in planta during fertilization sunflower have been proposed. There was shown the genotype-depended integration of T-DNA in sunflower genome. PCR-analysis showed that ProDH1 presents in genome of inbred lines transformed in planta, as well as in T1- and T2-generations. In trans-genic regenerants the essential accumulation of free L-proline during early stages of in vitro cultivation under normal conditions was shown. There was established the essential accumulation of free proline in transgenic regenerants during cultivation under lethal stress pressure (0.4 M mannitol and 2.0% sea water salts) and its decline upon the recovery period. These data are declared about effectiveness of suppression of sunflower ProDH and gene participation in processes connected with osmotolerance.

  12. Sequential Introduction of Cations Deriving Large-Grain Csx FA1-x PbI3 Thin Film for Planar Hybrid Solar Cells: Insight into Phase-Segregation and Thermal-Healing Behavior.

    Science.gov (United States)

    Huang, Jiahao; Xu, Pan; Liu, Jian; You, Xiao-Zeng

    2017-03-01

    Composition engineering of perovskite materials has been demonstrated to be important for high-performance solar cells. Recently, the energy favorable hybridization of formamidinium (FA) and cesium (Cs) in three dimension lead halide perovskites has been attracting increasing attention due to its potential benefit on durability. Herein, we reported a simple and effective method to produce phase-pure CsxFA1-xPbI3 thin film via sequential introduction of cations, in which the FA cation was introduced by interdiffusion annealing in the presence of N-methylimidazole (NMI). NMI was employed as an additive to slow down the crystallization and thus drive the formation of CsxFA1-xPbI3 with micrometer grain size, which probably facilitate the charge dissociation and transportation in photovoltaic devices. More importantly, composition dependent phase-segregation has been revealed and investigated for the first time during the phase-pure mixed-cation perovskites CsxFA1-xPbI3. The present findings demonstrated that suppressing phase-segregation of mixed-cation perovskites by meticulous composition engineering is significant for further development of efficient photovoltaics. It also suggested that phase-pure Cs0.15FA0.85PbI3 may be a promising candidate with superior phase-durability, which performed an efficiency over 16% in planar perovskite solar cells. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Hybrid perovskite resulting from the solid-state reaction between the organic cations and perovskite layers of alpha1-(Br-(CH(2))(2)-NH(3))(2)PbI(4).

    Science.gov (United States)

    Sourisseau, Sebastien; Louvain, Nicolas; Bi, Wenhua; Mercier, Nicolas; Rondeau, David; Buzaré, Jean-Yves; Legein, Christophe

    2007-07-23

    The alpha1-(Br-(CH(2))(2)-NH(3))(2)PbI(4) hybrid perovskite undergoes a solid-state transformation, that is, the reaction between the organic cations and the perovskite layers to give the new hybrid perovskite (Br-(CH(2))(2)-NH(3))(2-x)(I-(CH(2))(2)-NH(3))(x)PbBr(x)I(4-x), based on mixed halide inorganic layers. This transformation has been followed by a conventional powder X-ray diffraction system equipped with a super speed detector, and both solid-state (13)C NMR and ESI/MS measurements have been adopted in the estimation of the rate of halide substitution. The first reaction step leads to the special composition of x approximately 1 (A phase), while the complete substitution is not achieved even at elevated temperature (x(max) approximately 1.85 (B phase)). This unprecedented solid-state reaction between organic and inorganic components of a hybrid perovskite can be considered as a completely new strategy to achieve interesting hybrid perovskites.

  14. Fast self-diffusion of ions in CH 3 NH 3 PbI 3 : the interstiticaly mechanism versus vacancy-assisted mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Ji-Hui; Yin, Wan-Jian; Park, Ji-Sang; Wei, Su-Huai

    2016-01-01

    The stability of organic-inorganic halide perovskites is a major challenge for their applications and has been extensively studied. Among the possible underlying reasons, ion self-diffusion has been inferred to play important roles. While theoretical studies congruously support that iodine is more mobile, experimental studies only observe the direct diffusion of the MA ion and possible diffusion of iodine. The discrepancy may result from the incomplete understanding of ion diffusion mechanisms. With the help of first-principles calculations, we studied ion diffusion in CH3NH3PbI3 (MAPbI3) through not only the vacancy-assisted mechanisms presumed in previous theoretical studies, but also the neglected interstiticaly mechanisms. We found that compared to the diffusion through the vacancy-assisted mechanism, MA ion diffusion through the interstiticaly mechanism has a much smaller barrier which could explain experimental observations. For iodine diffusion, both mechanisms can yield relatively small barriers. Depending on the growth conditions, defect densities of vacancies and interstitials can vary and so do the diffusion species as well as diffusion mechanisms. Our work thus supports that both MA and iodine ion diffusion could contribute to the performance instability of MAPbI3. While being congruous with experimental results, our work fills the research gap by providing a full understanding of ion diffusion in halide perovskites.

  15. Optical characterization and bandgap engineering of flat and wrinkle-textured FA0.83Cs0.17Pb(I1-xBrx)3 perovskite thin films

    Science.gov (United States)

    Tejada, A.; Braunger, S.; Korte, L.; Albrecht, S.; Rech, B.; Guerra, J. A.

    2018-05-01

    The complex refractive indices of formamidinium cesium lead mixed-halide [FA0.83Cs0.17Pb(I1- xBrx)3] perovskite thin films of compositions ranging from x = 0 to 0.4, with both flat and wrinkle-textured surface topographies, are reported. The films are characterized using a combination of variable angle spectroscopic ellipsometry and spectral transmittance in the wavelength range of 190 nm to 850 nm. Optical constants, film thicknesses and roughness layers are obtained point-by-point by minimizing a global error function, without using optical dispersion models, and including topographical information supplied by a laser confocal microscope. To evaluate the bandgap engineering potential of the material, the optical bandgaps and Urbach energies are then accurately determined by applying a band fluctuation model for direct semiconductors, which considers both the Urbach tail and the fundamental band-to-band absorption region in a single equation. With this information, the composition yielding the optimum bandgap of 1.75 eV for a Si-perovskite tandem solar cell is determined.

  16. Etude de l'effet du vieillissement sur les proprietes d'un tissu en melange KevlarRTM-PBI utilise dans le revetement exterieur des habits de protection contre le feu

    Science.gov (United States)

    Arrieta, Carlos

    The aim of this work is to study and model the effect of three aging factors, temperature, humidity and light radiation, on the properties of a fabric made of a blend of KevlarRTM and PBI fibers frequently used to manufacture fire-protective garments. Accelarated-aging treatments carried out at carefully chosen conditions for the three factors resulted in a sizeable loss of mechanical performance. The breaking force of both the fabric and the yarns extracted from it decreases to less than 50% after one month of continuous exposure. X-ray diffraction (XRD) tests performed on thermally-aged samples indicated an increase of the crystallinity of the fabric, whereas the disappearance of Raman spectral lines suggested instead a reduction of the crystallinity following thermal aging. To explain these seemingly contradictory results, a hypothesis was introduced, stating that two different processes occurred simultaneously during thermal aging. The first one, an increase of size of the crystallites in the direction of the fibers' axis, accounted for the increase in crystallinity observed in XRD tests. The second one, an increase in the gap separating lamellar crystallites that causes a non-measurable reduction of the crystallinity of the sample, was highlighted by the Raman analyses. The results of the dielectric spectroscopy analyses carried out on thermally-aged samples confirmed the XRD results showing a significant change in the Kevlar's morphology during thermal aging. Despite the important decrease of the breaking force that ensued thermal aging, no evidence of a chemical structure modification of KevlarRTM was found. On the other hand, differential thermal analyses conducted on thermally aged fabric samples indicated a reduction of the glass transition temperature of the other component of the blend, namely the PBI, a fact that suggests a decrease of molecular weight after thermal aging. Infrared spectroscopy analyses performed on samples exposed to high humidity

  17. O3 fast and simple treatment-enhanced p-doped in Spiro-MeOTAD for CH3NH3I vapor-assisted processed CH3NH3PbI3 perovskite solar cells

    Institute of Scientific and Technical Information of China (English)

    En-Dong Jia; Xi Lou; Chun-Lan Zhou; Wei-Chang Hao; Wen-Jing Wang

    2017-01-01

    We demonstrate a simple and fast post-deposition treatment with high process compatibility on the hole transport material (HTM) Spiro-MeOTAD in vapor-assisted solution processed methylammonium lead triiodide (CH3NH3PbI3)-based solar cells.The prepared Co-doped p-type Spiro-MeOTAD films are treated by O3 at room temperature for 5 min,10 min,and 20 min,respectively,prior to the deposition of the metal electrodes.Compared with the traditional oxidation of Spiro-MeOTAD films overnight in dry air,our fast O3 treatment of HTM at room temperature only needs just 10 min,and a relative 40.3% increment in the power conversion efficiency is observed with respect to the result of without-treated perovskite solar cells.This improvement of efficiency is mainly attributed to the obvious increase of the fill factor and short-circuit current density,despite a slight decrease in the open-circuit voltage.Ultraviolet photoelectron spectroscopy (UPS) and Hall effect measurement method are employed in our study to determine the changes of properties after O3 treatment in HTM.It is found that after the HTM is exposed to O3,its p-type doping level is enhanced.The enhancement of conductivity and Hall mobility of the film,resulting from the improvement in p-doping level of HTM,leads to better performances of perovskite solar cells.Best power conversion efficiencies (PCEs) of 13.05% and 16.39% are achieved with most properly optimized HTM via CH3NH3I vapor-assisted method and traditional single-step method respectively.

  18. Phase Engineering of Perovskite Materials for High-Efficiency Solar Cells: Rapid Conversion of CH3NH3PbI3 to Phase-Pure CH3NH3PbCl3 via Hydrochloric Acid Vapor Annealing Post-Treatment.

    Science.gov (United States)

    Zhou, Weiran; Zhou, Pengcheng; Lei, Xunyong; Fang, Zhimin; Zhang, Mengmeng; Liu, Qing; Chen, Tao; Zeng, Hualing; Ding, Liming; Zhu, Jun; Dai, Songyuan; Yang, Shangfeng

    2018-01-17

    Organometal halide CH 3 NH 3 PbI 3 (MAPbI 3 ) has been commonly used as the light absorber layer of perovskite solar cells (PSCs), and, especially, another halide element chlorine (Cl) has been often incorporated to assist the crystallization of perovskite film. However, in most cases, a predominant MAPbI 3 phase with trace of Cl - is obtained ultimately and the role of Cl involvement remains unclear. Herein, we develop a low-cost and facile method, named hydrochloric acid vapor annealing (HAVA) post-treatment, and realize a rapid conversion of MAPbI 3 to phase-pure MAPbCl 3 , demonstrating a new concept of phase engineering of perovskite materials toward efficiency enhancement of PSCs for the first time. The average grain size of perovskite film after HAVA post-treatment increases remarkably through an Ostwald ripening process, leading to a denser and smoother perovskite film with reduced trap states and enhanced crystallinity. More importantly, the generation of MAPbCl 3 secondary phase via phase engineering is beneficial for improving the carrier mobility with a more balanced carrier transport rate and enlarging the band gap of perovskite film along with optimized energy level alignment. As a result, under the optimized HAVA post-treatment time (2 min), we achieved a significant enhancement of the power conversion efficiency (PCE) of the MAPbI 3 -based planar heterojunction-PSC device from 14.02 to 17.40% (the highest PCE reaches 18.45%) with greatly suppressed hysteresis of the current-voltage response.

  19. Durability Issues and Status of PBI-Based Fuel Cells

    DEFF Research Database (Denmark)

    Jakobsen, Mark Tonny Dalsgaard; Jensen, Jens Oluf; Cleemann, Lars Nilausen

    2016-01-01

    This chapter briefly reviews durability and stability issues with key materials and components for HT-PEMFCs, including the polymer membrane, the doping acid, the electrocatalyst, the catalyst support and bipolar plates. Degradation mechanisms and their dependence on fuel cell operating condition...

  20. Properties, degradation and high temperature fuel cell test of different types of PBI and PBI blend membranes

    DEFF Research Database (Denmark)

    Li, Qingfeng; Rudbeck, Hans Christian; Chromik, Andreas

    2010-01-01

    Polybenzimidazoles (PBIs) with synthetically modified structures and their blends with a partially fluorinated sulfonated aromatic polyether have been prepared and characterized for high temperature proton exchange membrane fuel cells. Significant improvement in the polymer chemical stability...

  1. An anthropomorphic phantom study of visualisation of surgical clips for partial breast irradiation (PBI) setup verification

    International Nuclear Information System (INIS)

    Thomas, Carys W.; Nichol, Alan M.; Park, Julie E.; Hui, Jason F.; Giddings, Alison A.; Grahame, Sheri; Otto, Karl

    2009-01-01

    Surgical clips were investigated for partial breast image-guided radiotherapy (IGRT). Small titanium clips were insufficiently well visualised. Medium tantalum clips were best for megavoltage IGRT and small tantalum clips were best for floor mounted kilovoltage IGRT (ExacTrac TM ). Both small tantalum and medium titanium clips were suitable for isocentric kilovoltage IGRT

  2. Invited: A Stability Study of Alkali Doped PBI Membranes for Alkaline Electrolyzer Cells

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Aili, David; Hansen, Martin Kalmar

    2014-01-01

    Alkaline fuel cells and electrolyzers are attracting increasing interest. This is to a large extent due to the broad selection of catalyst materials not based on resource limited and expensive noble metals. The first fuel cells in practical use were Francis Thomas Bacon’s based on an alkaline...

  3. Maritime Patrol Innovation: USN PBY Catalina Squadrons in the Pacific Area of Operations, 1941-1945

    Science.gov (United States)

    2011-04-15

    particularly hazardous due to unpredictable swells and wind. Even the most experienced pilots popped rivets in the hull when landing at sea. Large enough...holes sometimes developed and threatened to sink the aircraft. Flying mechanics regularly used pencils as impromptu rivets ; thus, the navigator’s...need to learn new techniques with new equipment. For instance, consider a future battle-space in which the electromagnetic spectrum is unavailable

  4. Process for fabricating PBI hollow fiber asymmetric membranes for gas separation and liquid separation

    Science.gov (United States)

    Jayaweera, Indira; Krishnan, Gopala N.; Sanjurjo, Angel; Jayaweera, Palitha; Bhamidi, Srinivas

    2016-04-26

    The invention provides methods for preparing an asymmetric hollow fiber, the asymmetric hollow fibers prepared by such methods, and uses of the asymmetric hollow fibers. One method involves passing a polymeric solution through an outer annular orifice of a tube-in-orifice spinneret, passing a bore fluid though an inner tube of the spinneret, dropping the polymeric solution and bore fluid through an atmosphere over a dropping distance, and quenching the polymeric solution and bore fluid in a bath to form an asymmetric hollow fiber.

  5. Analisis Program Kerja Prodi Pbi Jurusan Tarbiyah STAIN Samarinda Tahun 2011-2015

    Directory of Open Access Journals (Sweden)

    Shafa Shafa

    2013-06-01

    Full Text Available The research is to analyze some aspects that are being the attention in the working program analysis, such as: Reinforcing of vision, mission, goal and target, also achievement strategy; Tutor arrangement, leadership, management system, and giving a guarantee of quality; Related to university student  and graduate; Human resource; Curriculum, teaching and learning, and academic situation; Funding, means and infrastructure, also information system; Research, servicing/ public service, and cooperation. The research goals are: (1 To dig what programs that has been arranged by English Department of STAIN Samarinda in academic year 20111-2015; (2 To know what steps that is taken by English Department in implementing the working program; (3 To analyze the strength/ opportunity and challenge that will be faced by English Department based on the working program that has been arranged. The research isdescriptive-qualitative that using some techniques of data collecting, namely: interview, observation, and documentation. The research respondents are Vice Chairmanof Student University Affairs,Chairman of Tarbiyah Department, and English Department coordinator. Then the data collection is analyzed by using analysis of SWOT. The research summary is: The steps that is taken by English Department in implementing the working program such as: socializing the vision, mission, and strategy of English Department through brochure and leaflet distribution, optimalizing the cooperation with stakeholder such as school and region government through the programs of Tarbiyah Department, building an intensive communication with the leadership party to back up the working program, maximizing the calculation every year that oriented on the increase of study of program quality from the managerial aspect or the human resource. Nevertheless, the working program of English Department implementation from the extend time of 2011 to 2013 the applicability is still minimized and does not achieve 50% of it.

  6. Quantification of in situ temperature measurements on a PBI-based high temperature PEMFC unit cell

    DEFF Research Database (Denmark)

    Lebæk, Jesper; Ali, Syed Talat; Møller, Per

    2010-01-01

    The temperature is a very important operating parameter for all types of fuel cells. In the present work distributed in situ temperature measurements are presented on a polybenzimidazole based high temperature PEM fuel cell (HT-PEM). A total of 16 T-type thermocouples were embedded on both the an...

  7. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.

    2009-01-01

    Roč. 34, č. 4 (2009), s. 249-266 ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  8. Gas transport properties of novel mixed matrix membranes made of titanate nanotubes and PBI or PPO

    Czech Academy of Sciences Publication Activity Database

    Giel, Verena; Galajdová, Barbora; Popelková, Daniela; Kredatusová, Jana; Trchová, Miroslava; Pavlova, Ewa; Beneš, Hynek; Válek, R.; Peter, Jakub

    2015-01-01

    Roč. 56, č. 12 (2015), s. 3285-3293 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] R&D Projects: GA ČR(CZ) GPP106/12/P643 Institutional support: RVO:61389013 Keywords : polybenzimidazole * poly(phenylene oxide) * titanate nanotubes Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.272, year: 2015

  9. A Stability Study of Alkali Doped PBI Membranes for Alkaline Electrolyzer Cells

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Aili, David; Hansen, Martin Kalmar

    2014-01-01

    conductivity was similar to a commercial Zirfon membrane and suitable for a water electrolyzer. Some chemical degradation was seen during the aging period, but the crosslinked and the cured materials were both integral after 176 days of aging. A simplified electrolyzer test cell was operated successfully....

  10. Partially fluorinated arylene polyethers and their ternary blend membranes with PBI and H3PO4

    DEFF Research Database (Denmark)

    Kerres, J.; Schonberger, F.; Chromik, A

    2008-01-01

    A partially fluorinated polyether ionomer from polycondensation of decafluorobiphenyl with 2,2-bis(4-hydroxyphenyl)-hexafluoropropane, followed by sulphonation with H2SO4 (60% SO3), has been prepared and optimised in terms of molecular weight and sulphonation degree. The partially fluorinated ion...

  11. Controllable Self-Assembly of Amphiphilic Zwitterionic PBI Towards Tunable Surface Wettability of the Nanostructures.

    Science.gov (United States)

    Ye, Yong; Lü, Baozhong; Cheng, Wenyu; Wu, Zhen; Wei, Jie; Yin, Meizhen

    2017-05-04

    Amphiphilic molecules have received wide attention as they possess both hydrophobic and hydrophilic properties, and can form diverse nanostructures in selective solvents. Herein, we report an asymmetric amphiphilic zwitterionic perylene bisimide (AZP) with an octyl chain and a zwitterionic group on the opposite imide positions of perylene tetracarboxylic dianhydride. The controllable nanostructures of AZP with tunable hydrophilic/hydrophobic surface have been investigated through solvent-dependent amphiphilic self-assembly as confirmed by SEM, TEM, and contact angle measurements. The planar perylene core of AZP contributes to strong π-π stacking, while the amphiphilic balance of asymmetric AZP adjusts the self-assembly property. Additionally, due to intermolecular π-π stacking and solvent-solute interactions, AZP could self-assemble into hydrophilic microtubes in a polar solvent (acetone) and hydrophobic nanofibers in an apolar solvent (hexane). This facile method provides a new pathway for controlling the surface properties based on an asymmetric amphiphilic zwitterionic perylene bisimide. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Synthesis of PbI(2) single-layered inorganic nanotubes encapsulated within carbon nanotubes.

    Science.gov (United States)

    Cabana, Laura; Ballesteros, Belén; Batista, Eudar; Magén, César; Arenal, Raúl; Oró-Solé, Judith; Rurali, Riccardo; Tobias, Gerard

    2014-04-02

    The template assisted growth of single-layered inorganic nanotubes is reported. Single-crystalline lead iodide single-layered nanotubes have been prepared using the inner cavities of carbon nanotubes as hosting templates. The diameter of the resulting inorganic nanotubes is merely dependent on the diameter of the host. This facile method is highly versatile opening up new horizons in the preparation of single-layered nanostructures. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. An anthropomorphic phantom study of visualisation of surgical clips for partial breast irradiation (PBI) setup verification.

    Science.gov (United States)

    Thomas, Carys W; Nichol, Alan M; Park, Julie E; Hui, Jason F; Giddings, Alison A; Grahame, Sheri; Otto, Karl

    2009-01-01

    Surgical clips were investigated for partial breast image-guided radiotherapy (IGRT). Small titanium clips were insufficiently well visualised. Medium tantalum clips were best for megavoltage IGRT and small tantalum clips were best for floor mounted kilovoltage IGRT (ExacTrac). Both small tantalum and medium titanium clips were suitable for isocentric kilovoltage IGRT.

  14. NVO combineert beste van DPS, DPST en PBI tot nieuwe totaalindex. DPS verdwijnt

    NARCIS (Netherlands)

    Arendonk, van J.A.M.

    2006-01-01

    De duurzameprestatiesom, DPS, gaat mogelijk nog dit jaar verdwijnen. Ervoor in de plaats komt een nieuwe totaalindex, waarin ook functioneel exterieur een onderdeel zal zijn. Fokkerijprofessor Johan van Arendonk licht de achtergronden toe van de nieuwe totaalindex

  15. Convergent validity of the short-EMBU and the parental bonding instrument (PBI) : Dutch findings

    NARCIS (Netherlands)

    Arrindell, W.A.; Engebretsen, A.A

    2000-01-01

    Using a large sample of Spanish students (N = 796), Livianos-Aldana and Rojo-Moreno (1999) found poor evidence of convergent validity of the homologous dimensions that underlie the EMBU and the Parental Bonding Instrument. The Spanish findings however are neither in line with previous ones that were

  16. Mesoscopic CH 3 NH 3 PbI 3 /TiO 2 Heterojunction Solar Cells

    KAUST Repository

    Etgar, Lioz; Gao, Peng; Xue, Zhaosheng; Peng, Qin; Chandiran, Aravind Kumar; Liu, Bin; Nazeeruddin, Md. K.; Grä tzel, Michael

    2012-01-01

    .1 mA/cm 2, open-circuit photovoltage V oc = 0.631 V, and a fill factor FF = 0.57, corresponding to a light to electric power conversion efficiency (PCE) of 5.5% under standard AM 1.5 solar light of 1000 W/m 2 intensity. At a lower light intensity

  17. Adaptação transcultural para o português brasileiro do Parental Bonding Instrument (PBI Cross-cultural adaptation of Parental Bonding Instrument (PBI to Brazilian Portuguese

    Directory of Open Access Journals (Sweden)

    Simone Hauck

    2006-08-01

    Full Text Available OBJETIVO: O artigo apresenta a adaptação transcultural do Parental Bonding Instrument, um questionário auto-aplicável desenvolvido em 1979 e usado desde então para avaliar a percepção da qualidade do vínculo com os pais até os 16 anos. MÉTODO: Foram realizadas as etapas de equivalência conceitual, equivalência dos itens, equivalência semântica, equivalência operacional, equivalência funcional e aprovação da versão final pelo autor original do instrumento. RESULTADOS: Os critérios de equivalência foram satisfeitos, tendo a versão final sido aprovada pelo autor do instrumento original. CONCLUSÃO: A adaptação do Parental Bonding Instrument disponibiliza para uso um instrumento que já demonstrou ser extremamente útil em pesquisas de risco e resiliência nas últimas décadas, ao avaliar a percepção de características do comportamento dos pais tradicionalmente associadas ao desenvolvimento da personalidade.OBJETIVE: This article aims to present a cross-cultural adaptation of the Parental Bonding Instrument to Brazilian Portuguese. It is a self-administered questionnaire developed in 1979, which has been used since then to measure the subjective experience of being parented to the age of 16 years. METHOD: The following steps were performed: conceptual equivalence, item equivalence, semantic equivalence, operational equivalence, functional equivalence, and approval of the final version by the author of the original instrument. RESULTS: The study has reached the objectives of equivalence, and the final Brazilian Portuguese version has been approved by the original author. CONCLUSION: The study provides a Brazilian Portuguese version of an instrument that has been proven extremely useful in risk and resilience researches over the past decades, assessing the perception of parental characteristics traditionally related to personality development.

  18. Ultrafast Terahertz Probes of Charge Transfer and Recombination Pathway of CH3NH3PbI3 Perovskites

    Science.gov (United States)

    Yan, Hui-Jie; Ku, Zhi-Liang; Hu, Xue-Feng; Zhao, Wan-Ying; Zhong, Min-Jian; Zhu, Qi-Biao; Lin, Xian; Jin, Zuan-Ming; Ma, Guo-Hong

    2018-02-01

    Not Available Supported by the National Natural Science Foundation of China under Grant Nos 11674213, 11604202 and 61735010, the Young Eastern Scholar at Shanghai Institutions of Higher Learning under Grant No QD2015020, the Universities Young Teachers Training Funding Program under Grant No ZZSD15098, and the ‘Chen Guang’ Project of Shanghai Municipal Education Commission and Shanghai Education Development Foundation under Grant No 16CG45.

  19. Effect of lead content on nonstoichiometric Bi2-xPbySr2Ca2Cu3Oδ ceramic superconductors

    International Nuclear Information System (INIS)

    Diaz-Valdes, E.; Pacheco-Malagon, G.; Contreras-Puente, G.; Mejia-Garcia, C.; Andrade-Garay, G.; Ortiz-Lopez, J.; Conde-Gallardo, A.; Falcony, C.

    1993-01-01

    Ceramic superconducting samples of the type Bi 2-x Pb y Sr 2 Ca 2 Cu 3 O δ were processed with a nonstoichiometric content of Bi and Pb (x≠y) with respect to the 2223 phase in this system. The resistance vs. temperature characteristics and the presence of the 2223 and 2212 phases as a function of the sample preparation conditions and the lead content (Bi/Pb ratio) are reported. The growth of unwanted phases such as PbO was observed for those samples with a high content of Pb (y=0.9) and Bi (x=0.1). (orig.)

  20. Low resistivity ZnO-GO electron transport layer based CH3NH3PbI3 solar cells

    Directory of Open Access Journals (Sweden)

    Muhammad Imran Ahmed

    2016-06-01

    Full Text Available Perovskite based solar cells have demonstrated impressive performances. Controlled environment synthesis and expensive hole transport material impede their potential commercialization. We report ambient air synthesis of hole transport layer free devices using ZnO-GO as electron selective contacts. Solar cells fabricated with hole transport layer free architecture under ambient air conditions with ZnO as electron selective contact achieved an efficiency of 3.02%. We have demonstrated that by incorporating GO in ZnO matrix, low resistivity electron selective contacts, critical to improve the performance, can be achieved. We could achieve max efficiency of 4.52% with our completed devices for ZnO: GO composite. Impedance spectroscopy confirmed the decrease in series resistance and an increase in recombination resistance with inclusion of GO in ZnO matrix. Effect of temperature on completed devices was investigated by recording impedance spectra at 40 and 60 oC, providing indirect evidence of the performance of solar cells at elevated temperatures.

  1. EIS Characterization of the Poisoning Effects of CO and CO2 on a PBI based HT-PEM Fuel Cell

    DEFF Research Database (Denmark)

    Andreasen, Søren Juhl; Mosbæk, Rasmus; Vang, Jakob Rabjerg

    2010-01-01

    . All operational parameters as well as data acquisition are controlled by two LabView programs, running on two separate computers. The impedance spectrum of the fuel cell is recorded at different operating points and then an Equivalent Circuit (EC), proposed for modelling the cell impedance, is fitted...

  2. Long-Term Durability of PBI-Based HT-PEM Fuel Cells: Effect of Operating Parameters

    DEFF Research Database (Denmark)

    Søndergaard, Tonny; Cleemann, Lars Nilausen; Becker, Hans

    2018-01-01

    -term operation. Durability is assessed for 16 identically fabricated membrane electrode assemblies (MEAs), and evaluations are carried out using operating parameters as stressors with gas stoichiometries ranging from 2 to 25, current densities from 200 to 800 mA cm(-2), and temperatures of 160 or 180 degrees C...

  3. SU-E-T-322: A Dosimetric Comparison of PBI Brachytherapy Techniques: SAVI, Contura, and Tube and Button Applicators.

    Science.gov (United States)

    Park, S; Kamrava, M; Demanes, J

    2012-06-01

    To evaluate the dosimetry of partial breast irradiation brachytherapy techniques using the Strut Adjusted Volume Implant (SAVI), Contura, and Tube and Button (T&B) applicators. A total of 51 breast-cancer patients (23 SAVI, 6 Contura, and 22 T&B) were treated. The target was delineated following NSABP B-39 guidelines. 3D plans were optimized using the Inverse Planning Simulated Annealing algorithm to deliver 3.4 Gy per fraction to the target and minimize dose to organs at risk (OARs). Graphical optimization was then used to fine tune the final dose distribution. The minimum cavity-to-skin distance was measured. Target coverage (V90 and V95) and maximum dose (D0.1cc) to the OARs were evaluated. Dose homogeneity index (DHI = 1-V150/V100) was calculated. The average cavity-to-skin distances were 4.1 mm (0.5-9.6 mm, SAVI) and 11.7 mm (7.1-15.4 mm, Contura). The target-to-skin distance for the T&B cases was 8.7 mm (5.0-13.7 mm). The average V90 and V95 to the target were 96.8% and 94.5% (SAVI), 97.0% and 93.0% (Contura), 98.6% and 97.3% (T&B). The mean D0.1cc to the skin, ribs, and lung was 91.5%, 58.8%, 44.5% (SAVI), 93.1%, 51.3%, 40.5% (Contura), 69.1%, 41.5%, and 31.9% (T&B). The average V150 and V200 to the normal breast tissue were 30.4 cc and 14.9 cc (SAVI), 29.5 cc and 7.3 cc (Contura), 18.3 cc and 7.1 cc (T&B). The average DHI for the SAVI, Contura, and T&B cases was 0.55 (0.50-0.60), 0.70 (0.63-0.78), and 0.76 (0.74-0.79). All techniques provided clinically acceptable target coverage and dose to the OARs. The SAVI device provided a lower skin dose at close cavity-to-skin distances while providing excellent target coverage. However, the T&B and Contura applicators produced more homogeneous dose distribution (higher DHI) in the target than the SAVI. The correlations between dosimetric properties and follow-up mammogram results are under investigation. © 2012 American Association of Physicists in Medicine.

  4. Cross-sections for dissociative excitation of lead atom in collisions of slow electrons with PbI2 molecules

    International Nuclear Information System (INIS)

    Smirnov, Yu.M.

    2006-01-01

    The dissociative excitation of the lead atom in e-PbI 2 collisions has been studied experimentally. 27 excitation cross-sections are measured at an exciting-electron energy of 100 eV. Nine optical excitation functions are recorded at the electron energy varying in the 0-100 eV range. The most possible reaction channels at low electron energies along with the relation of the dissociative-excitation cross-sections of the lead atom both in e-PbI 2 and e-PbCl 2 collisions are discussed. (authors)

  5. Crosslinked Hexafluoropropylidene Polybenzimidazole Membranes with Chloromethyl Polysulfone for Fuel Cell Applications

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Li, Qingfeng; Cleemann, Lars Nilausen

    2013-01-01

    Hexafluoropropylidene polybenzimidazole (F6PBI) was synthesized with excellent chemical stability and improved solubility. When doped with phosphoric acid, however, the F6PBI membranes showed plastic deformation at elevated temperatures. Further efforts were made to covalently crosslink F6PBI...... membranes with chloromethyl polysulfone as a polymeric crosslinker. Comparing with linear F6PBI and mPBI membranes, the polymer crosslinked F6PBI membranes exhibited little organo solubility, excellent stability towards the radical oxidation, high resistance to swelling in concentrated phosphoric acid...... with the linear F6PBI and mPBI membranes....

  6. Phosphoric acid doped membranes based on Nafion®, PBI and their blends – Membrane preparation, characterization and steam electrolysis testing

    DEFF Research Database (Denmark)

    Aili, David; Hansen, Martin Kalmar; Pan, Chao

    2011-01-01

    Proton exchange membrane steam electrolysis at temperatures above 100 °C has several advantages from thermodynamic, kinetic and engineering points of view. A key material for this technology is the high temperature proton exchange membrane. In this work a novel procedure for preparation of Nafion......® and polybenzimidazole blend membranes was developed. Homogeneous binary membranes covering the whole composition range were prepared and characterized with respect to chemical and physiochemical properties such as water uptake, phosphoric acid doping, oxidative stability, mechanical strength and proton conductivity...

  7. Influence of the Preparation Method on Planar Perovskite CH3NH3PbI3-xClx Solar Cell Performance and Hysteresis

    Science.gov (United States)

    Ivanova, A.; Tokmakov, A.; Lebedeva, K.; Roze, M.; Kaulachs, I.

    2017-08-01

    Organometal halide perovskites are promising materials for lowcost, high-efficiency solar cells. The method of perovskite layer deposition and the interfacial layers play an important role in determining the efficiency of perovskite solar cells (PSCs). In the paper, we demonstrate inverted planar perovskite solar cells where perovskite layers are deposited by two-step modified interdiffusion and one-step methods. We also demonstrate how PSC parameters change by doping of charge transport layers (CTL). We used dimethylsupoxide (DMSO) as dopant for the hole transport layer (PEDOT:PSS) but for the electron transport layer [6,6]-phenyl C61 butyric acid methyl ester (PCBM)) we used N,N-dimethyl-N-octadecyl(3-aminopropyl)trimethoxysilyl chloride (DMOAP). The highest main PSC parameters (PCE, EQE, VOC) were obtained for cells prepared by the one-step method with fast crystallization and doped CTLs but higher fill factor (FF) and shunt resistance (Rsh) values were obtained for cells prepared by the two-step method with undoped CTLs.

  8. The effect of Bi{sub In} hetero-antisite defects in In{sub 1–x}PBi{sub x} alloy

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Liyuan [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, P.O. Box 72, Beijing 100876 (China); Lu, Pengfei, E-mail: photon.bupt@gmail.com [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, P.O. Box 72, Beijing 100876 (China); State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Yang, Chuanghua [School of Physics and Telecommunication Engineering, Shanxi University of Technology (SNUT), Hanzhong 723001, Shaanxi (China); Liang, Dan [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, P.O. Box 72, Beijing 100876 (China); Zhang, Chunfang [Beijing Computational Science Research Center, Beijing 100094 (China); Wang, Shumin [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Photonics Laboratory, Department of Microtechnology and Nanoscience, Chalmers University of Technology, 41296 Gothenburg (Sweden)

    2016-07-25

    Bi{sub In} hetero-antisite defects in InP:Bi alloy is performed by using first-principle calculations. It is found that the hetero-antisite defect Bi{sub In} is energetically easier than Bi{sub P}. This Bi{sub In} defect is a deep level donor, and the related defect band is introduced by the sp-hybridization mainly between the 6s state of Bi{sub In} and 3p states of the nearest P atoms. The band gap of InP:Bi alloy increases slightly with the increase of Bi compositions, and the relative position of the defect level remains almost unchanged. These results represent that hetero-antisite defect Bi{sub In} does not contribute to the reduction of the band gap of InP:Bi alloy. The calculations of optical properties show that hetero-antisite defect Bi{sub In} can contribute to the red shift phenomena observed in experiment as the Bi composition increases. In addition, the interaction of two Bi{sub In} atoms can result in the split of the impurity band and cause a strong absorption in near-infrared region, indicating it can be a potential candidate for optoelectronics application. - Highlights: • The effects of Bi{sub In} hetero-antisite defects in InP:Bi alloy are studied. • The appearance and origin of Bi{sub In} related impurity band are discovered. • Bi{sub In} defects can contribute to the red shift phenomena observed in experiment. • A strong absorption in near-infrared region caused by two Bi{sub In} atoms is found.

  9. Experimental investigation of carbon monoxide poisoning effect on a PBI/H3PO4 high temperature polymer electrolyte membrane fuel cell

    DEFF Research Database (Denmark)

    Zhou, Fan; Andreasen, Søren Juhl; Kær, Søren Knudsen

    2015-01-01

    humidity level reduced the cell performance loss caused by CO poisoning. When the fuel cell was operated with pure H2, the cell performance was not significantly affect by the change in anode dew point temperature in the range of room temperature and 60 °C. CO2 in anode stream resulted in slight decrease...

  10. Engineering of CH 3 NH 3 PbI 3 Perovskite Crystals by Alloying Large Organic Cations for Enhanced Thermal Stability and Transport Properties

    KAUST Repository

    Peng, Wei

    2016-07-28

    The number of studies on organic–inorganic hybrid perovskites has soared in recent years. However, the majority of hybrid perovskites under investigation are based on a limited number of organic cations of suitable sizes, such as methylammonium and formamidinium. These small cations easily fit into the perovskite\\'s three-dimensional (3D) lead halide framework to produce semiconductors with excellent charge transport properties. Until now, larger cations, such as ethylammonium, have been found to form 2D crystals with lead halide. Here we show for the first time that ethylammonium can in fact be incorporated coordinately with methylammonium in the lattice of a 3D perovskite thanks to a balance of opposite lattice distortion strains. This inclusion results in higher crystal symmetry, improved material stability, and markedly enhanced charge carrier lifetime. This crystal engineering strategy of balancing opposite lattice distortion effects vastly increases the number of potential choices of organic cations for 3D perovskites, opening up new degrees of freedom to tailor their optoelectronic and environmental properties.

  11. A close examination of the structure and dynamics of HC(NH2)2PbI3by MD simulations and group theory

    KAUST Repository

    Carignano, M. A.

    2016-06-22

    The formamidinium lead iodide hybrid perovskite is studied using first principles molecular dynamics simulations and further analyzed using group theory. The simulations are performed on large supercells containing 768 atoms under isothermal and fully anisotropic isobaric conditions. Two trajectories, one at 300 K and another at 450 K, were extended for over 50 ps in order to perform a detailed assessment of the rotational dynamics of organic cations. The characteristic rotations of the cation are analyzed by defining two rotation axes. It is found that the formamidinium molecules rotate preferentially around the direction parallel to the line connecting the two nitrogen atoms. The rotational dynamics shows some characteristics already observed in methylammonium lead iodide, like the heterogeneous dynamics at room temperature that disappears at 450 K. The orientational probability of the molecules is explored in terms of an expansion in cubic harmonics up to the 12th order. It reveals a strong directionality at room temperature that relaxes when increasing the temperature. These findings are further rationalized using Landau and group theories suggesting a mixed displacive/order-disorder structural instability at lower temperatures.

  12. Search for negative U in the Ba1-xKxBi1-yPbyO3 system using constrained density-functional theory

    International Nuclear Information System (INIS)

    Vielsack, G.; Weber, W.

    1996-01-01

    Calculations using constrained density-functional theory have been carried out for the Ba 1-x K x Bi 1-y Pb y O 3 system, using a full-potential linearized-augmented-plane-wave method and employing fcc supercell geometries with two formula units. The results have been mapped onto Hubbard-type models in order to extract values of interaction parameters U at the Bi sites. Two different mapping procedures have been utilized. The first one is the standard method, based on the comparison of total-energy curvatures. The second method, proposed in the present work, relies on the analysis of single particle energies and yields much smaller numerical errors. For BaBiO 3 interaction parameters are obtained for the following models: (i) s and p orbitals at Bi and p orbitals at O sites. Here, U s =3.1±0.4 eV, U sp =1.4±0.2 eV, U p =2.2±0.4 eV are found, (ii) s(Bi) and p(O) orbitals, yielding U s =1.9±0.7 eV, and (iii) an effective one-band model, leading to U s =0.6±0.4 eV. Further studies have been performed for breathing distorted BaBiO 3 and for various Ba 1-x K x Bi 1-y Pb y O 3 alloys using virtual crystal approximations. The resulting U values are somewhat larger than for pure BaBiO 3 . Thus, in all cases, the values of Bi U parameters are found to be positive. There is no indication of a negative U of electronic origin. copyright 1996 The American Physical Society

  13. Validez y confiabilidad del instrumento de vínculo parental (Parental Bonding Instrument, PBI en una muestra de varones mexicanos

    Directory of Open Access Journals (Sweden)

    Erika Robles Estrada

    2016-01-01

    Full Text Available El objetivo de esta investigación fue obtener la validez y confiabilidad del instrumento de vínculo parental en una muestra de varones mexicanos. En total fueron 125 participantes. El instrumento original es de Parker, Tupling y Brown (1979; mide la percepción de la conducta y actitud de los padres hacia sus hijos hasta los 16 años. La aplicación se llevó de manera colectiva con consentimiento informado. Los datos se analizaron con análisis factorial y Alfa de Cronbach. Los resultados arrojaron la permanencia de los factores del instrumento: sobreprotección y cuidado. La confiabilidad fue de .900. Se puede concluir que el instrumento es válido y confiable para muestras mexicanas de varones. Abstract The objective of this research was to obtain the validity and reliability of the Parental Bonding Instrument in sample of Mexican males. In total there were 125 participants. The original instrument is Parker, Tupling & Brown (1979; it measures the perception of the conduct and attitude of parents until the age of 16. The application took collectively with informed consent. Data were analyzed with analysis, factorial and Cronbach Alpha. The results threw the permanence of the factors of the instrument: care and overprotection. Reliability was of .900. It can be concluded that the instrument is valid and reliable for Mexican males.

  14. Direct and inverse neural networks modelling applied to study the influence of the gas diffusion layer properties on PBI-based PEM fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Lobato, Justo; Canizares, Pablo; Rodrigo, Manuel A.; Linares, Jose J. [Chemical Engineering Department, University of Castilla-La Mancha, Campus Universitario s/n, 13004 Ciudad Real (Spain); Piuleac, Ciprian-George; Curteanu, Silvia [Faculty of Chemical Engineering and Environmental Protection, Department of Chemical Engineering, ' ' Gh. Asachi' ' Technical University Iasi Bd. D. Mangeron, No. 71A, 700050 IASI (Romania)

    2010-08-15

    This article shows the application of a very useful mathematical tool, artificial neural networks, to predict the fuel cells results (the value of the tortuosity and the cell voltage, at a given current density, and therefore, the power) on the basis of several properties that define a Gas Diffusion Layer: Teflon content, air permeability, porosity, mean pore size, hydrophobia level. Four neural networks types (multilayer perceptron, generalized feedforward network, modular neural network, and Jordan-Elman neural network) have been applied, with a good fitting between the predicted and the experimental values in the polarization curves. A simple feedforward neural network with one hidden layer proved to be an accurate model with good generalization capability (error about 1% in the validation phase). A procedure based on inverse neural network modelling was able to determine, with small errors, the initial conditions leading to imposed values for characteristics of the fuel cell. In addition, the use of this tool has been proved to be very attractive in order to predict the cell performance, and more interestingly, the influence of the properties of the gas diffusion layer on the cell performance, allowing possible enhancements of this material by changing some of its properties. (author)

  15. Vapor and healing treatment for CH3NH3PbI3-xClx films toward large-area perovskite solar cells

    Science.gov (United States)

    Gouda, Laxman; Gottesman, Ronen; Tirosh, Shay; Haltzi, Eynav; Hu, Jiangang; Ginsburg, Adam; Keller, David A.; Bouhadana, Yaniv; Zaban, Arie

    2016-03-01

    Hybrid methyl-ammonium lead trihalide perovskites are promising low-cost materials for use in solar cells and other optoelectronic applications. With a certified photovoltaic conversion efficiency record of 20.1%, scale-up for commercial purposes is already underway. However, preparation of large-area perovskite films remains a challenge, and films of perovskites on large electrodes suffer from non-uniform performance. Thus, production and characterization of the lateral uniformity of large-area films is a crucial step towards scale-up of devices. In this paper, we present a reproducible method for improving the lateral uniformity and performance of large-area perovskite solar cells (32 cm2). The method is based on methyl-ammonium iodide (MAI) vapor treatment as a new step in the sequential deposition of perovskite films. Following the MAI vapor treatment, we used high throughput techniques to map the photovoltaic performance throughout the large-area device. The lateral uniformity and performance of all photovoltaic parameters (Voc, Jsc, Fill Factor, Photo-conversion efficiency) increased, with an overall improved photo-conversion efficiency of ~100% following a vapor treatment at 140 °C. Based on XRD and photoluminescence measurements, We propose that the MAI treatment promotes a ``healing effect'' to the perovskite film which increases the lateral uniformity across the large-area solar cell. Thus, the straightforward MAI vapor treatment is highly beneficial for large scale commercialization of perovskite solar cells, regardless of the specific deposition method.Hybrid methyl-ammonium lead trihalide perovskites are promising low-cost materials for use in solar cells and other optoelectronic applications. With a certified photovoltaic conversion efficiency record of 20.1%, scale-up for commercial purposes is already underway. However, preparation of large-area perovskite films remains a challenge, and films of perovskites on large electrodes suffer from non-uniform performance. Thus, production and characterization of the lateral uniformity of large-area films is a crucial step towards scale-up of devices. In this paper, we present a reproducible method for improving the lateral uniformity and performance of large-area perovskite solar cells (32 cm2). The method is based on methyl-ammonium iodide (MAI) vapor treatment as a new step in the sequential deposition of perovskite films. Following the MAI vapor treatment, we used high throughput techniques to map the photovoltaic performance throughout the large-area device. The lateral uniformity and performance of all photovoltaic parameters (Voc, Jsc, Fill Factor, Photo-conversion efficiency) increased, with an overall improved photo-conversion efficiency of ~100% following a vapor treatment at 140 °C. Based on XRD and photoluminescence measurements, We propose that the MAI treatment promotes a ``healing effect'' to the perovskite film which increases the lateral uniformity across the large-area solar cell. Thus, the straightforward MAI vapor treatment is highly beneficial for large scale commercialization of perovskite solar cells, regardless of the specific deposition method. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr08658b

  16. A close examination of the structure and dynamics of HC(NH2)2PbI3by MD simulations and group theory

    KAUST Repository

    Carignano, M. A.; Saeed, Y.; Aravindh, S. Assa; Roqan, Iman S.; Even, J.; Katan, C.

    2016-01-01

    The formamidinium lead iodide hybrid perovskite is studied using first principles molecular dynamics simulations and further analyzed using group theory. The simulations are performed on large supercells containing 768 atoms under isothermal

  17. Formation and Diffusion of Metal Impurities in Perovskite Solar Cell Material CH3NH3PbI3: Implications on Solar Cell Degradation and Choice of Electrode.

    Science.gov (United States)

    Ming, Wenmei; Yang, Dongwen; Li, Tianshu; Zhang, Lijun; Du, Mao-Hua

    2018-02-01

    Solar cells based on methylammonium lead triiodide (MAPbI 3 ) have shown remarkable progress in recent years and have demonstrated efficiencies greater than 20%. However, the long-term stability of MAPbI 3 -based solar cells has yet to be achieved. Besides the well-known chemical and thermal instabilities, significant native ion migration in lead halide perovskites leads to current-voltage hysteresis and photoinduced phase segregation. Recently, it is further revealed that, despite having excellent chemical stability, the Au electrode can cause serious solar cell degradation due to Au diffusion into MAPbI 3 . In addition to Au, many other metals have been used as electrodes in MAPbI 3 solar cells. However, how the external metal impurities introduced by electrodes affect the long-term stability of MAPbI 3 solar cells has rarely been studied. A comprehensive study of formation energetics and diffusion dynamics of a number of noble and transition metal impurities (Au, Ag, Cu, Cr, Mo, W, Co, Ni, Pd) in MAPbI 3 based on first-principles calculations is reported herein. The results uncover important general trends of impurity formation and diffusion in MAPbI 3 and provide useful guidance for identifying the optimal metal electrodes that do not introduce electrically active impurity defects in MAPbI 3 while having low resistivities and suitable work functions for carrier extraction.

  18. Catalyst Degradation Under Potential Cycling as an Accelerated Stress Test for PBI-Based High-Temperature PEM Fuel Cells - Effect of Humidification

    DEFF Research Database (Denmark)

    Søndergaard, Tonny; Cleemann, Lars Nilausen; Zhong, Lijie

    2018-01-01

    In the present work, high-temperature polymer electrolyte membrane fuel cells were subjected to accelerated stress tests of 30,000 potential cycles between 0.6 and 1.0 V at 160 textdegreeC (133 h cycling time). The effect that humidity has on the catalyst durability was studied by testing either...... with or without humidification of the nitrogen that was used as cathode gas during cycling segments. Pronounced degradation was seen from the polarization curves in both cases, though permanent only in the humidified case. In the unhumidified case, the performance loss was more or less recoverable following 24 h...

  19. Engineering of CH 3 NH 3 PbI 3 Perovskite Crystals by Alloying Large Organic Cations for Enhanced Thermal Stability and Transport Properties

    KAUST Repository

    Peng, Wei; Miao, Xiaohe; Adinolfi, Valerio; Alarousu, Erkki; El Tall, Omar; Emwas, Abdul-Hamid M.; Zhao, Chao; Walters, Grant; Liu, Jiakai; Ouellette, Olivier; Pan, Jun; Banavoth, Murali; Sargent, Edward H.; Mohammed, Omar F.; Bakr, Osman

    2016-01-01

    The number of studies on organic–inorganic hybrid perovskites has soared in recent years. However, the majority of hybrid perovskites under investigation are based on a limited number of organic cations of suitable sizes, such as methylammonium and formamidinium. These small cations easily fit into the perovskite's three-dimensional (3D) lead halide framework to produce semiconductors with excellent charge transport properties. Until now, larger cations, such as ethylammonium, have been found to form 2D crystals with lead halide. Here we show for the first time that ethylammonium can in fact be incorporated coordinately with methylammonium in the lattice of a 3D perovskite thanks to a balance of opposite lattice distortion strains. This inclusion results in higher crystal symmetry, improved material stability, and markedly enhanced charge carrier lifetime. This crystal engineering strategy of balancing opposite lattice distortion effects vastly increases the number of potential choices of organic cations for 3D perovskites, opening up new degrees of freedom to tailor their optoelectronic and environmental properties.

  20. Nanostructured TiO2/CH3NH3PbI3 heterojunction solar cells employing spiro-OMeTAD/Co-complex as hole-transporting material

    KAUST Repository

    Noh, Jun Hong; Jeon, Nam Joong; Choi, Yong Chan; Nazeeruddin, Md. K.; Grä tzel, Michael; Seok, Sang Il

    2013-01-01

    For using 2,2′,7,7′-tetrakis(N,N′-di-p- methoxyphenylamine)-9,9′-spirobifluorene (spiro-OMeTAD) as a hole conductor in solar cells, it is necessary to improve its charge-transport properties through electrochemical doping. With the aim

  1. Degradation of H3PO4/PBI High Temperature Polymer Electrolyte Membrane Fuel Cell under Stressed Operating Conditions

    DEFF Research Database (Denmark)

    Zhou, Fan

    performance loss caused by CO poisoning can be alleviated by the presence of water vapor. The CO oxidation via the water gas shift reaction is the main reason for the mitigated CO poisoning with the presence of water vapor. Meanwhile, the CO poisoning can deteriorate with the presence of CO2, although the CO2...... for HT-PEM fuel cell based micro-CHP units for households, the daily startup/shutdown operation is necessary. Moreover, the faults in the H2 supply system or in controlling the reformer can cause the H2 starvation of the HT-PEM fuel cell. The effects of these operating conditions to the degradation...... results in the degradation in cell performance of the HT-PEM fuel cell by increasing the charge transfer resistance and mass transfer resistance. The CO with volume fraction of 1% – 3% can cause significant performance loss to the HT-PEM fuel cell at the operating temperature of 150 oC. The cell...

  2. Elucidating the charge carrier separation and working mechanism of CH3NH3PbI(3-x)Cl(x) perovskite solar cells.

    Science.gov (United States)

    Edri, Eran; Kirmayer, Saar; Mukhopadhyay, Sabyasachi; Gartsman, Konstantin; Hodes, Gary; Cahen, David

    2014-03-11

    Developments in organic-inorganic lead halide-based perovskite solar cells have been meteoric over the last 2 years, with small-area efficiencies surpassing 15%. We address the fundamental issue of how these cells work by applying a scanning electron microscopy-based technique to cell cross-sections. By mapping the variation in efficiency of charge separation and collection in the cross-sections, we show the presence of two prime high efficiency locations, one at/near the absorber/hole-blocking-layer, and the second at/near the absorber/electron-blocking-layer interfaces, with the former more pronounced. This 'twin-peaks' profile is characteristic of a p-i-n solar cell, with a layer of low-doped, high electronic quality semiconductor, between a p- and an n-layer. If the electron blocker is replaced by a gold contact, only a heterojunction at the absorber/hole-blocking interface remains.

  3. Simulation calculations of efficiencies and silicon consumption for CH3NH3PbI3−x−y Brx Cly/crystalline silicon tandem solar cells

    International Nuclear Information System (INIS)

    Zhang, Lili; Xie, Ziang; Qin, Guogang; Tian, Fuyang

    2017-01-01

    Much attention has been paid to two-subcell tandem solar cells (TSCs) with crystalline silicon (c-Si) as the bottom cell (TSC-Si). Previous works have pointed out that the optimal band gap, E g , of the top cell material for a TSC-Si is around 1.75 eV. With a tunable E g and better stability than MAPbI 3 (MA  =  CH 3 NH 3 ), MAPbI 3−x−y Br x Cl y is a promising candidate for the top cell material of a TSC-Si. In this work, calculations concerning the E g , refractive index and extinction coefficient of MAPbI 3−x−y Br x Cl y are performed using first-principles calculations including the spin–orbit coupling (SOC) effect. MAPbI 3−x−y Br x Cl y with five sets of x and y , which have a E g around 1.75 eV, are obtained. On this basis, absorption of the perovskite top cell is calculated applying the Lambert–Beer model (LBM) and the transfer matrix model (TMM), respectively. Considering the Auger recombination in the c-Si bottom cell and radiation coupling between the two subcells, the efficiencies for MAPbI 3−x−y Br x Cl y/ c-Si TSCs with the five sets of x and y are calculated. Among them, the MAPbI 2.375 Br 0.5 Cl 0.125 /c-Si TSC achieves the highest efficiency of 35.1% with a 440 nm thick top cell and 50 µ m thick c-Si when applying the LBM. When applying the TMM, the highest efficiency of 32.5% is predicted with a 580 nm thick MAPbI 2.375 Br 0.5 Cl 0.125 top cell and 50 µ m thick c-Si. Compared with the limiting efficiency of 27.1% for a 190 µ m thick c-Si single junction solar cell (SC), the MAPbI 2.375 Br 0.5 Cl 0.125 /c-Si TSC shows a superior performance of high efficiency and low c-Si consumption. (paper)

  4. First determination of the valence band dispersion of CH3NH3PbI3 hybrid organic-inorganic perovskite

    Science.gov (United States)

    Lee, Min-I.; Barragán, Ana; Nair, Maya N.; Jacques, Vincent L. R.; Le Bolloc'h, David; Fertey, Pierre; Jemli, Khaoula; Lédée, Ferdinand; Trippé-Allard, Gaëlle; Deleporte, Emmanuelle; Taleb-Ibrahimi, Amina; Tejeda, Antonio

    2017-07-01

    The family of hybrid organic-inorganic halide perovskites is in the limelight because of their recently discovered high photovoltaic efficiency. These materials combine photovoltaic energy conversion efficiencies exceeding 22% and low-temperature and low-cost processing in solution; a breakthrough in the panorama of renewable energy. Solar cell operation relies on the excitation of the valence band electrons to the conduction band by solar photons. One factor strongly impacting the absorption efficiency is the band dispersion. The band dispersion has been extensively studied theoretically, but no experimental information was available. Herein, we present the first experimental determination of the valence band dispersion of methylammonium lead halide in the tetragonal phase. Our results pave the way for contrasting the electronic hopping or the electron effective masses in different theories by comparing to our experimental bands. We also show a significant broadening of the electronic states, promoting relaxed conditions for photon absorption, and demonstrate that the tetragonal structure associated to the octahedra network distortion below 50 °C induces only a minor modification of the electronic bands, with respect to the cubic phase at high temperature, thus minimizing the impact of the cubic-tetragonal transition on solar cell efficiencies.

  5. Pressure-Induced Metallization of the Halide Perovskite (CH 3 NH 3 )PbI 3

    Energy Technology Data Exchange (ETDEWEB)

    Jaffe, Adam; Lin, Yu [Photon; Mao, Wendy L. [Photon; Karunadasa, Hemamala I.

    2017-03-10

    We report the metallization of the hybrid perovskite semiconductor (MA)PbI3 (MA = CH3NH3+) with no apparent structural transition. We tracked its bandgap evolution during compression in diamond-anvil cells using absorption spectroscopy and observed strong absorption over both visible and IR wavelengths at pressures above ca. 56 GPa, suggesting the imminent closure of its optical bandgap. The metallic character of (MA)PbI3 above 60 GPa was confirmed using both IR reflectivity and variable-temperature dc conductivity measurements. The impressive semiconductor properties of halide perovskites have recently been exploited in a multitude of optoelectronic applications. Meanwhile, the study of metallic properties in oxide perovskites has revealed diverse electronic phenomena. Importantly, the mild synthetic routes to halide perovskites and the templating effects of the organic cations allow for fine structural control of the inorganic lattice. Pressure-induced closure of the 1.6 eV bandgap in (MA)PbI3 demonstrates the promise of the continued study of halide perovskites under a range of thermodynamic conditions, toward realizing wholly new electronic properties.

  6. TASK BASED APPROACH IN WRITING ARTICLE (A Field Study: The Seventh Semester Students of PBI 2008 D of STKIP Ponorogo in Academic Year 2011/2012

    Directory of Open Access Journals (Sweden)

    Tintin Susilowati

    2012-06-01

    Full Text Available Abstrak: Menulis adalah salah satu skill dari keterampilan bahasa yang masih menjadi masalah serius  bagi mahasiswa secara umum bahkan bagi mahasiswa semester tujuh jurusan pendidikan bahasa Inggris. Berdasarkan data ditemukan bahwa banyak mahasiswa semester tujuh memiliki keterbatasan pengetahuan tentang struktur paragrap terkait dengan esensi dan proposi dalam penulisan pendahuluan, tubuh dari paragrap untuk mengembangkan ide, serta kesimpulan bahkan mereka juga masih mengalami kesulitan dalam menulis sebuah paragrap. Paragrap seharusnya telah dikuasai oleh mahasiswa semester atas. Sebagai mahasiswa semester tujuh, mereka seharusnya telah mampu untuk menghasilkan tulisan jurnalistik seperti artikel. Penulisan artikel artikel, diterapkan dalam pembelajaran di kelas  menulis. Dalam materi menulis, diuraikan melalui serangkaian kegiatan dari langkah awal sampai produk akhir secara sisematis menggunakan “Task-Based Approach”. Implementasi dari pembelajaran ini menggunakan pendekatan kualitatif. Data diambil dari hasil tulisan mahasiswa dan di analisa menggunakan skala rubrik. Dengan Task-Based Approach, mahasiswa diarahkan untuk mampu menulis artikel. Pembelajaran dilakukan berbasis tugas dengan fokus yang berbeda untuk tiap pertemuan namun tujuan akhirnya mahasiswa mampu menulis artikel secara utuh setelah melakukan  tugas-tugas yang diberikan.

  7. Large-Scale Quantum Many-Body Perturbation on Spin and Charge Separation in the Excited States of the Synthesized Donor-Acceptor Hybrid PBI-Macrocycle Complex.

    Science.gov (United States)

    Ziaei, Vafa; Bredow, Thomas

    2017-03-17

    The reliable calculation of the excited states of charge-transfer (CT) compounds poses a major challenge to the ab initio community because the frequently employed method, time-dependent density functional theory (TD-DFT), massively relies on the underlying density functional, resulting in heavily Hartree-Fock (HF) exchange-dependent excited-state energies. By applying the highly sophisticated many-body perturbation approach, we address the encountered unreliabilities and inconsistencies of not optimally tuned (standard) TD-DFT regarding photo-excited CT phenomena, and present results concerning accurate vertical transition energies and the correct energetic ordering of the CT and the first visible singlet state of a recently synthesized thermodynamically stable large hybrid perylene bisimide-macrocycle complex. This is a large-scale application of the quantum many-body perturbation approach to a chemically relevant CT system, demonstrating the system-size independence of the quality of the many-body-based excitation energies. Furthermore, an optimal tuning of the ωB97X hybrid functional can well reproduce the many-body results, making TD-DFT a suitable choice but at the expense of introducing a range-separation parameter, which needs to be optimally tuned. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Water-resistance of macromolecules adsorbed on CH3NH3PbI3 surfaces: A first-principles study

    Science.gov (United States)

    Chen, Po-Tuan; Yung, Tung-Yuan; Liu, Ting-Yu; Sher, Chin-Wei; Hayashi, Michitoshi

    2017-10-01

    Encapsulation within resin films is a promising approach for isolating perovskite materials from water. To gain fundamental insight into these systems, we performed first-principles calculations of macromolecule (polymerized siloxane; epoxy cured by phthalic anhydride; graphene sheet) coatings for the waterproofing of methylammonium lead iodide perovskite (MAPbI3) surfaces. Our calculations reveal that alternating attractive/resistant functional groups on the siloxane- or epoxy-modified MAPbI3 surfaces hinder the water diffusion process. Moreover, we examined a no-defect graphene sheet for its ability to isolate MAPbI3 from water molecules. The hydrophobicity of the graphene resulted in water molecules forming clusters, rather than dispersing, upon the sheet.

  9. Comparison of clinical outcome parameters, the Patient Benefit Index (PBI-k) and patient satisfaction after ablative fractional laser treatment of peri-orbital rhytides.

    Science.gov (United States)

    Karsai, Syrus; Raulin, Christian

    2010-03-01

    Laser treatment of facial rhytides has evolved as a major modality of aesthetic surgery. Published results, while generally encouraging, feature highly diverse evaluation methods, which makes an evidence-based assessment of treatment efficacy and safety all but impossible. To compare the results of different instruments of measurement. Twenty-eight patients were enrolled and completed the entire study. They received a single ablative fractional treatment of the peri-orbital region. The evaluation included the Fitzpatrick wrinkle score, the profilometric measurement of wrinkle depth and the Patient Benefit Index (both before and 3 months after treatment) as well as the assessment of patient satisfaction (1, 3, 6 days and 3 months after treatment). All assessment instruments showed a significant, albeit moderate, improvement. The agreement between assessment methods was poor. Despite claiming to assess basically the same parameter, the Fitzpatrick wrinkle score and profilometry differed significantly, and neither assessment instrument showed any appreciable correlation with any other. The outcome assessment of rhytide therapy-regardless of the method used-shows substantial room for improvement. Strict methodological precautions ought to be applied for 'objective' evaluation methods like photographic scoring and profilometry. Subjective methods of assessment are essential and might serve as a main outcome parameter. Finally, critical reappraisal of published treatment results seems warranted to review the quality of their methodology.

  10. Proton conductivity of phosphoric acid doped polybenzimidazole and its composites with inorganic proton conductors

    DEFF Research Database (Denmark)

    He, Ronghuan; Qingfeng, Li; Gang, Xiao

    2003-01-01

    Phosphoric acid doped polybenzimidazole (PBI) and PBI composite membranes have been prepared in the present work. The PBI composites contain inorganic proton conductors including zirconium phosphate (ZrP), (Zr(HPO4)2·nH2O), phosphotungstic acid (PWA), (H3PW12O40·nH2O) and silicotungstic acid (Si...

  11. Credible evidence for the passivation effect of remnant PbI₂ in CH₃NHCH₃PbICH₃ films in improving the performance of perovskite solar cells.

    Science.gov (United States)

    Wang, Shimao; Dong, Weiwei; Fang, Xiaodong; Zhang, Qingli; Zhou, Shu; Deng, Zanhong; Tao, Ruhua; Shao, Jingzhen; Xia, Rui; Song, Chao; Hu, Linhua; Zhu, Jun

    2016-03-28

    The role of remnant PbI2 in CH3NH3PbI3 films is still controversial, some investigations have revealed that the remnant PbI2 plays a passivation role, reduces the charge recombination in perovskite solar cells (PSCs), and improves the performance of PSCs, but the opposing views state that remnant PbI2 has no passivation effect and it would deteriorate the stability of the devices. In our investigation, the CH3NH3PbI3 films have been prepared by a two-step spin-coating method and the content of the remnant PbI2 in CH3NH3PbI3 films has been tuned by varying the preparation temperature. It has been found that increasing the heating temperature could increase the coverage of spin-coated PbI2 films, which has led to high coverage CH3NH3PbI3 films and more remnant PbI2 in CH3NH3PbI3 films, and as a result, the performance of PSCs was enhanced obviously and the maximum power conversion efficiency of 14.32 ± 0.28% was achieved by the PSCs prepared at 130/120 °C (PbI2 films were heated at 130 °C and CH3NH3PbI3 films were heated at 120 °C). Furthermore, the dark current, electrochemical impedance spectroscopy and time-resolved fluorescence emission decay measurements revealed that the charge recombination in PSCs has been gradually suppressed and the fluorescence emission lifetime has gradually increased with the content of remnant PbI2 increasing. Thus, the passivation effects of the unreacted and decomposed PbI2 in improving the performance of PSCs have been confirmed unquestionably.

  12. Micron-sized columnar grains of CH3NH3PbI3 grown by solvent-vapor assisted low-temperature (75 °C) solid-state reaction: The role of non-coordinating solvent-vapor

    Science.gov (United States)

    Zheng, Huifeng; Liu, Yangqiao; Sun, Jing

    2018-04-01

    The preparation of hybrid perovskite films with large columnar grains via low-temperature solid-state reaction remains a big challenge. Conventional solvent annealing using DMF, DMSO and ethanol, etc. fails to work effectively at low temperature (solar cells based on benzyl-alcohol-vapor annealing (75 °C), delivered much higher photovoltaic performance, better stability and smaller hysteresis than those based on conventional thermal annealing. Additionally, a champion power conversion efficiency (PCE) of 15.1% was obtained and the average PCE reached 12.2% with a tiny deviation. Finally, the mechanism of solvent annealing with non-coordinating solvent was discussed. Moreover, we revealed that high polarity and high boiling point of the solvent used for generating vapor, was critical to grow micron-sized columnar grains at such a low temperature (75 °C). This work will contribute to understanding the mechanism of grain growth in solvent annealing and improving its facility and effectiveness.

  13. Separation of α-tocotrienol oxidation products and eight tocochromanols by HPLC with DAD and fluorescence detection and identification of unknown peaks by DAD, PBI-EIMS, FTIR, and NMR.

    Science.gov (United States)

    Büsing, Anne; Ternes, Waldemar

    2011-11-01

    Tocotrienols, like tocopherols, are members of the vitamin E family. While tocopherols (T) have been studied intensively, only recently have tocotrienols (T3) received increased attention due to their special health benefits. However, these positive attributes of T3 are probably lost as a result of degradation during food storage and processing, and there is little information about their oxidation products. Of particular interest are the oxidation products of α-tocotrienol (α-T3) as this is the least thermostable T3 isomer with the highest rate of degradation. The objective of this study was therefore to develop a reliable method for the determination of the most important oxidation products of α-T3 along with other tocochromanol isomers. We developed a high-performance liquid chromatography method with diode array detection, fluorescence detection, and a particle beam interface electron impact mass spectroscopy in order to separate the most important oxidation products of α-T3 (α-T3 spirodimers/spirotrimers, α-tocotrienoldihydroxy dimer, 7-formyl-β-tocotrienol (7-FβT3), 5-formyl-γ-tocotrienol (5-FγT3), α-tocotrienolquinone (α-T3Q), and α-T3Q dimers and α-tocotrienolquinone epoxides (α-T3QE)) from eight tocochromanol isomers. Furthermore, we sought to identify the as yet unknown oxidation products 5-FγT3, 7-FβT3, α-T3Q-dimer, and α-T3QE. Of these, 5-FγT3 was fully characterized by Fourier transform infrared spectroscopy and (1)H and (13)C nuclear magnetic resonance spectroscopy.

  14. Could the eventual results of the NSABP* 39/RTOG** 0413 trial for partial breast irradiation (PBI) be improved by combining spherical applicators and whole breast irradiation? Radiobiology suggests it may.

    Science.gov (United States)

    Smit, B J

    2010-01-01

    There may be unacceptable risks associated with the relatively large single doses of irradiation prescribed over five days instead of over six weeks for three of the four trial arms of the NSABP39/RTOG 0413 clinical trial seeking to enlist 4,300 patients. The first arm prescribes 60 Gray (Gy) in two Gy fractions over six weeks, which is the present standard. The dose implications of the other three arms with reference to this standard were examined using the ID2 formalism. Particularly poor (non-homogeneous) dose distributions characterise spherical applicators like "MammoSite" used as a sole device for accelerated partial breast irradiation (APBI). The alternative treatment, APBI done by 3-D conformal radiation, may also have a drawback, namely a sudden sharp cut-off in dose which may cause cosmetic problems due to circumscribed fibrosis and edema. Some recently published results from this trial reveal an alarming level of complications. The possible causes of these complications and poor cosmetic outcomes and how to avoid them are examined. An obstacle to the more widespread use of the "MammoSite type of device is that the device is not allowed closer than 5-7 mm from the skin or ribs; a possible remedy for this restriction is offered. It is also intended to make the relevant radiobiological principles usable for surgical oncologists.

  15. J-V and C-V investigation of the effect of small molecular fullerene and non-fullerene acceptors for CH3NH3PbI3 perovskite solar cell

    Science.gov (United States)

    Zheng, Yanqiong; Wang, Chao; Yu, Junle; Yang, Fang; Zhang, Jing; Wei, Bin; Li, Weishi

    2017-11-01

    To find the ideal acceptors for perovskite solar cells (PSCs) and get insight into the dielectric property at the interface between perovskite and acceptor, series of small molecular fullerene and non-fullerene acceptors were comparatively investigated. Fullerene acceptors based PSCs show higher performance than non-fullerene acceptors based PSCs. However, the perylene tetracarboxylic diimide based PSC has achieved a η PCE of 4.70%, implying that it is a promising acceptor candidate for PSCs because of its suitable energy level, high electron mobility, and smooth surface. By employing double acceptors of (6,6)-phenyl-C61-butyric acid methyl ester (PCBM)/C60 or PCBM/3,4,9,10-perylenetetracarboxylic bisbenzimidazole, the PSC stability is greatly improved even without performance enhancement. The perovskite (Pero)/PCBM film shows smooth surface, suggesting that PCBM penetrates into the Pero layer. The hydrophobicity trend of Pero/acceptor composite films is same as the device performance by judging from the water contact angle, and Pero/PCBM as well as Pero/C60 show higher hydrophobicity than other Pero/small-molecular-acceptor composite films. Capacitance-voltage characteristics of the series of single and double acceptor based PSCs were measured. The double acceptor based PSCs show larger depletion layer width (W d) than single acceptor based PSCs. Meanwhile, the defect density (N A) in Pero layer for single acceptor based PSCs is larger than that for double acceptor based PSCs, implying better n-doping of Pero layer by using a single acceptor.

  16. Cross-linked polybenzimidazole membranes for high temperature proton exchange membrane fuel cells with dichloromethyl phosphinic acid as a cross-linker

    DEFF Research Database (Denmark)

    Noye, Pernille; Li, Qingfeng; Pan, Chao

    2008-01-01

    Phosphoric acid doped polybenzimidazole (PBI) membranes have been covalently cross-linked with dichloromethyl phosphinic acid (DCMP). FT-IR measurements showed new bands originating from bonds between the hydrogen bearing nitrogen in the imidazole group of PBI and the CH2 group in DCMP. The produ......Phosphoric acid doped polybenzimidazole (PBI) membranes have been covalently cross-linked with dichloromethyl phosphinic acid (DCMP). FT-IR measurements showed new bands originating from bonds between the hydrogen bearing nitrogen in the imidazole group of PBI and the CH2 group in DCMP.......e. within the temperature range of operation of PBI-based fuel cells....

  17. Electron-Rotor Interaction in Organic-Inorganic Lead Iodide Perovskites Discovered by Isotope Effects.

    Science.gov (United States)

    Gong, Jue; Yang, Mengjin; Ma, Xiangchao; Schaller, Richard D; Liu, Gang; Kong, Lingping; Yang, Ye; Beard, Matthew C; Lesslie, Michael; Dai, Ying; Huang, Baibiao; Zhu, Kai; Xu, Tao

    2016-08-04

    We report on the carrier-rotor coupling effect in perovskite organic-inorganic hybrid lead iodide (CH3NH3PbI3) compounds discovered by isotope effects. Deuterated organic-inorganic perovskite compounds including CH3ND3PbI3, CD3NH3PbI3, and CD3ND3PbI3 were synthesized. Devices made from regular CH3NH3PbI3 and deuterated CH3ND3PbI3 exhibit comparable performance in band gap, current-voltage, carrier mobility, and power conversion efficiency. However, a time-resolved photoluminescence (TRPL) study reveals that CH3NH3PbI3 exhibits notably longer carrier lifetime than that of CH3ND3PbI3, in both thin-film and single-crystal formats. Furthermore, the comparison in carrier lifetime between CD3NH3PbI3 and CH3ND3PbI3 single crystals suggests that vibrational modes in methylammonium (MA(+)) have little impact on carrier lifetime. In contrast, the fully deuterated compound CD3ND3PbI3 reconfirmed the trend of decreasing carrier lifetime upon the increasing moment of inertia of cationic MA(+). Polaron model elucidates the electron-rotor interaction.

  18. Accelerated partial breast irradiation utilizing balloon brachytherapy techniques

    International Nuclear Information System (INIS)

    Strauss, Jonathan B.; Dickler, Adam

    2009-01-01

    To overcome the barriers to BCT, methods of PBI in the setting of breast conservation have been explored. The method of PBI with the longest published follow-up is multi-catheter interstitial brachytherapy. Balloon-based brachytherapy with the MammoSite brachytherapy applicator was designed to simplify the brachytherapy procedure for PBI, enhance the reproducibility of the dosimetry, and improve patient comfort. The rates of local recurrence following PBI with the MammoSite applicator have been low, but there are few published reports and follow-up has been relatively short. The cosmetic outcomes and toxicity of MammoSite PBI are comparable to those seen after multicatheter-based PBI. Additional methods of balloon brachytherapy, including Xoft and SenoRx Contura have been developed. Finally, long-term follow-up after PBI is important for the welfare of individual patients and in order to establish the efficacy, late toxicity and cosmetic outcomes of this technique.

  19. Vanadium Redox Flow Batteries Using meta-Polybenzimidazole-Based Membranes of Different Thicknesses.

    Science.gov (United States)

    Noh, Chanho; Jung, Mina; Henkensmeier, Dirk; Nam, Suk Woo; Kwon, Yongchai

    2017-10-25

    15, 25, and 35 μm thick meta-polybenzimidazole (PBI) membranes are doped with H 2 SO 4 and tested in a vanadium redox flow battery (VRFB). Their performances are compared with those of Nafion membranes. Immersed in 2 M H 2 SO 4 , PBI absorbs about 2 mol of H 2 SO 4 per mole of repeat unit. This results in low conductivity and low voltage efficiency (VE). In ex-situ tests, meta-PBI shows a negligible crossover of V 3+ and V 4+ ions, much lower than that of Nafion. This is due to electrostatic repulsive forces between vanadium cations and positively charged protonated PBI backbones, and the molecular sieving effect of PBI's nanosized pores. It turns out that charge efficiency (CE) of VRFBs using meta-PBI-based membranes is unaffected by or slightly increases with decreasing membrane thickness. Thick meta-PBI membranes require about 100 mV larger potentials to achieve the same charging current as thin meta-PBI membranes. This additional potential may increase side reactions or enable more vanadium ions to overcome the electrostatic energy barrier and to enter the membrane. On this basis, H 2 SO 4 -doped meta-PBI membranes should be thin to achieve high VE and CE. The energy efficiency of 15 μm thick PBI reaches 92%, exceeding that of Nafion 212 and 117 (N212 and N117) at 40 mA cm -2 .

  20. Light-Induced Cytotoxicity and Genotoxicity of a Sunscreen Agent, 2-Phenylbenzimidazole in Salmonella typhimurium TA 102 and HaCaT Keratinocytes

    Directory of Open Access Journals (Sweden)

    Hongtao Yu

    2007-06-01

    Full Text Available 2-Phenylbenzimidazole (PBI is an ingredient found in sunscreen agents. PBI can absorb the UV portion of the solar light and undergo a series of light-induced reactions to cause adverse effects in humans. Therefore, chemical and photochemical toxicity of PBI were investigated in the bacteria Salmonella typhimurium TA 102 and human skin keratinocyte cells. There is no appreciable bacteria death due to the exposure to PBI alone, indicating that PBI is not chemically toxic to the bacteria at a dose as high as 625μM. However, exposure to PBI and a solar simulator light (300-W Xe/Hg lamp, 30 min, 18.6 J/cm2, equivalent to 30 min outdoor sunlight causes significant bacteria death: 35% at 25μM and 55% at 625μM PBI. Exposure of the bacteria to light and PBI at doses 5-25μM causes the bacteria to revert, an indication of mutation. In the presence of PBI but without light irradiation, the number of revertant bacteria colonies is around 200 due to spontaneous mutation. Combination of light irradiation and PBI causes the number of revertant TA 102 colonies to increase in a dose dependent manner, reaching a maximum of around 1700 revertant colonies at 25 μM PBI. At higher PBI concentrations, the number of revertant colonies remains constant. This result clearly indicates that PBI is photomutagenic in TA 102. Exposure of the human skin HaCaT keratinocytes in aqueous solution in the presence of PBI causes the cell to lose its viability with or without light irradiation. There is no significant difference in cell viability for the light irradiated or non-irradiated groups, indication PBI is not photocytotoxic. However, exposure of the cells to both PBI and light irradiation causes cellular DNA damage, while exposure to PBI alone does not cause DNA damage.

  1. Synthesis and properties of poly(aryl sulfone benzimidazole) and its copolymers for high temperature membrane electrolytes for fuel cells

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Li, Qingfeng; Cleemann, Lars Nilausen

    2012-01-01

    Poly(aryl sulfone benzimidazole) (SO2PBI) and its copolymers with poly[2,2′-p-(phenylene)-5,5′-bibenzimidazole] (pPBI), termed as Co-SO2PBI, were synthesized with varied feeding ratios of 4,4′-sulfonyldibenzoic acid (SDBA) to terephthalic acid (TPA). Incorporation of the stiff para-phenylene and ......Poly(aryl sulfone benzimidazole) (SO2PBI) and its copolymers with poly[2,2′-p-(phenylene)-5,5′-bibenzimidazole] (pPBI), termed as Co-SO2PBI, were synthesized with varied feeding ratios of 4,4′-sulfonyldibenzoic acid (SDBA) to terephthalic acid (TPA). Incorporation of the stiff para...

  2. Partial-Breast Irradiation Versus Whole-Breast Irradiation for Early-Stage Breast Cancer: A Cost-Effectiveness Analysis

    International Nuclear Information System (INIS)

    Sher, David J.; Wittenberg, Eve; Suh, W. Warren; Taghian, Alphonse G.; Punglia, Rinaa S.

    2009-01-01

    Purpose: Accelerated partial-breast irradiation (PBI) is a new treatment paradigm for patients with early-stage breast cancer. Although PBI may lead to greater local recurrence rates, it may be cost-effective because of better tolerability and lower cost. We aim to determine the incremental cost-effectiveness of PBI compared with whole-breast radiation therapy (WBRT) for estrogen receptor-positive postmenopausal women treated for early-stage breast cancer. Methods and Materials: We developed a Markov model to describe health states in the 15 years after radiotherapy for early-stage breast cancer. External beam (EB) and MammoSite (MS) PBI were considered and assumed to be equally effective, but carried different costs. Patients received tamoxifen, but not chemotherapy. Utilities, recurrence risks, and costs were adapted from the literature; the baseline utility for no disease after radiotherapy was set at 0.92. Probabilistic sensitivity analyses were performed to model uncertainty in the PBI hazard ratio, recurrence pattern, and patient utilities. Costs (in 2004 US dollars) and quality-adjusted life-years were discounted at 3%/y. Results: The incremental cost-effectiveness ratio for WBRT compared with EB-PBI was $630,000/quality-adjusted life-year; WBRT strongly dominated MS-PBI. One-way sensitivity analysis found that results were sensitive to PBI hazard ratio, recurrence pattern, baseline recurrence risk, and no evidence of disease PBI utility values. Probabilistic sensitivity showed that EB-PBI was the most cost-effective technique over a wide range of assumptions and societal willingness-to-pay values. Conclusions: EB-PBI was the most cost-effective strategy for postmenopausal women with early-stage breast cancer. Unless the quality of life after MS-PBI proves to be superior, it is unlikely to be cost-effective.

  3. Sythesis and investigation of m-carborane-containing polybenzimidazoles

    International Nuclear Information System (INIS)

    Korshak, V.V.; Vagin, V.V.; Izyneev, A.A.; Bekasova, N.I.

    1975-01-01

    New m-carborane-containing polybenzimidazoles (PBI) have been obtained by chemical cyclization of m-carborane-containing polyaminoamides (PAA) with the N-methyl-2-pyrrolidone-sulphuric anhydride complex or polyphosphoric acid esters being used as the cyclodehydrating reagents. The obtained m-carborane-containing PAA and PBI have been tested for solubility, heat resistance and chemical stability. The structure of m-carborane-containing PBI has been determined by abalysis of their infrared spectra

  4. Construction of proton exchange membranes under ultrasonic irradiation based on novel fluorine functionalizing sulfonated polybenzimidazole/cellulose/silica bionanocomposite.

    Science.gov (United States)

    Esmaielzadeh, Sheida; Ahmadizadegan, Hashem

    2018-03-01

    Novel sulfonated polybenzimidazole (s-PBI)/cellulose/silica bionanocomposite membranes were prepared from fluorine-containing s-PBI copolymer with a cellulose/silica precursor and a bonding agent. The introduction of the bonding agent results in the reinforcing interfacial interaction between s-PBI chains and the cellulose/silica nanoparticles. Commercially available silica nanoparticles were modified with biodegradable nanocellolose through ultrasonic irradiation technique. Transmission electron microscopy (TEM) analyses showed that the cellulose/silica composites were well dispersed in the s-PBI matrix on a nanometer scale. The mechanical properties and the methanol barrier ability of the s-PBI films were improved by the addition of cellulose/silica. The modulus of the s-PBI/10 wt% cellulose/silica nanocomposite membranes had a 45% increase compared to the pure s-PBI films, and the methanol permeability decreased by 62% with respect to the pure s-PBI membranes. The conductivities of the s-PBI/cellulose/silica nanocomposites were slightly lower than the pure s-PBI. The antibacterial activity of (s-PBI)/cellulose/silica was investigated against Gram-positive bacteria, ie, Staphylococcus aureus and methicillin-resistant S. aureus and Gram-negative bacteria, ie, Escherichia coli, E. coli O157:H7 and Pseudomonas aeruginosa by the disc diffusion method using Mueller Hinton agar at different sizes of cellulose/silica. All of the synthesized (s-PBI)/cellulose/silica were found to have high antibacterial activity. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Sythesis and investigation of m-carborane-containing polybenzimidazoles

    Energy Technology Data Exchange (ETDEWEB)

    Korshak, V V; Vagin, V V; Izyneev, A A; Bekasova, N I [AN SSSR, Moscow. Inst. Ehlementoorganicheskikh Soedinenij

    1975-09-01

    New m-carborane-containing polybenzimidazoles (PBI) have been obtained by chemical cyclization of m-carborane-containing polyaminoamides (PAA) with the N-methyl-2-pyrrolidone-sulphuric anhydride complex or polyphosphoric acid esters being used as the cyclodehydrating reagents. The obtained m-carborane-containing PAA and PBI have been tested for solubility, heat resistance and chemical stability. The structure of m-carborane-containing PBI has been determined by abalysis of their infrared spectra.

  6. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ma and ... tau [Borrelia garinii PBi] ... Length = 279 ... Query: 22 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK 81 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK Sbjct: 1 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARCLNCKNGPTVMPCGECNNCK 60 ... Quer

  7. A new anhydrous proton conductor based on polybenzimidazole and tridecyl phosphate

    International Nuclear Information System (INIS)

    Jiang Fengjing; Pu Hongting; Meyer, Wolfgang H.; Guan Yisi; Wan Decheng

    2008-01-01

    Most of the anhydrous proton conducting membranes are based on inorganic or partially inorganic materials, like SrCeO 3 membranes or polybenzimidazole (PBI)/H 3 PO 4 composite membranes. In present work, a new kind of anhydrous proton conducting membrane based on fully organic components of PBI and tridecyl phosphate (TP) was prepared. The interaction between PBI and TP is discussed. The temperature dependence of the proton conductivity of the composite membranes can be modeled by an Arrhenius relation. Thermogravimetric analysis (TGA) illustrates that these composite membranes are chemically stable up to 145 deg. C. The weight loss appearing at 145 deg. C is attributed to the selfcondensation of phosphate, which results in the proton conductivity drop of the membranes occurring at the same temperature. The DC conductivity of the composite membranes can reach ∼10 -4 S/cm for PBI/1.8TP at 140 deg. C and increases with increasing TP content. The proton conductivity of PBI/TP and PBI/H 3 PO 4 composite membranes is compared. The former have higher proton conductivity, however, the proton conductivity of the PBI/H 3 PO 4 membranes increases with temperature more significantly. Compared with PBI/H 3 PO 4 membranes, the migration stability of TP in PBI/TP membranes is improved significantly

  8. Partial Breast Irradiation Versus Whole Breast Radiotherapy for Early-Stage Breast Cancer: A Decision Analysis

    International Nuclear Information System (INIS)

    Sher, David J.; Wittenberg, Eve; Taghian, Alphonse G.; Bellon, Jennifer R.; Punglia, Rinaa S.

    2008-01-01

    Purpose: To compare the quality-adjusted life expectancy between women treated with partial breast irradiation (PBI) vs. whole breast radiotherapy (WBRT) for estrogen receptor-positive early-stage breast cancer. Methods and Materials: We developed a Markov model to describe health states in the 15 years after radiotherapy for estrogen receptor-positive early-stage breast cancer. Breast cancer recurrences were separated into local recurrences and elsewhere failures. Ipsilateral breast tumor recurrence (IBTR) risk was extracted from the Oxford overview, and rates and utilities were adapted from the literature. We studied two cohorts of women (aged 40 and 55 years), both of whom received adjuvant tamoxifen. Results: Assuming a no evidence of disease (NED)-PBI utility of 0.93, quality-adusted life expectancy after PBI (and WBRT) was 12.61 (12.57) and 12.10 (12.06) years for 40-year-old and 55-year-old women, respectively. The NED-PBI utility thresholds for preferring PBI over WBRT were 0.923 and 0.921 for 40-year-old and 55-year-old women, respectively, both slightly greater than the NED-WBRT utility. Outcomes were sensitive to the utility of NED-PBI, the PBI hazard ratio for local recurrence, the baseline IBTR risk, and the percentage of IBTRs that were local. Overall the degree of superiority of PBI over WBRT was greater for 55-year-old women than for 40-year-old women. Conclusions: For most utility values of the NED-PBI health state, PBI was the preferred treatment modality. This result was highly sensitive to patient preferences and was also dependent on patient age, PBI efficacy, IBTR risk, and the fraction of IBTRs that were local

  9. Patient Preferences and Physician Practice Patterns Regarding Breast Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Hoopes, David J., E-mail: david.hoopes@wpafb.af.mil [Uniformed Services University of the Health Sciences, Department of Radiology and Radiological Sciences, WPAFB, OH (United States); Kaziska, David; Chapin, Patrick [Air Force Institute of Technology, WPAFB, OH (United States); Weed, Daniel [Clarian Healthcare, Methodist Hospital, Department of Radiation Oncology, Indianapolis, IN (United States); Smith, Benjamin D. [M.D. Anderson Cancer Center, Department of Radiation Oncology, Houston, TX (United States); Hale, E. Ronald [Wright-Patterson Medical Center, Department of Radiation Oncology, WPAFB, OH (United States); Johnstone, Peter A. [Indiana University School of Medicine, Department of Radiation Oncology, Indianapolis, IN (United States)

    2012-02-01

    Purpose: There are multiple current strategies for breast radiotherapy (RT). The alignment of physician practice patterns with best evidence and patient preferences will enhance patient autonomy and improve cancer care. However, there is little information describing patient preferences for breast RT and physician practice patterns. Methods and Materials: Using a reliable and valid instrument, we assessed the preferences of 5,000 randomly selected women (with or without cancer) undergoing mammography. To assess practice patterns, 2,150 randomly selected physician-members of American Society for Radiation Oncology were surveyed. Results: A total of 1,807 women (36%) and 363 physicians (17%) provided usable responses. The 95% confidence interval is < {+-}2.3% for patients and < {+-}5.3% for physicians. Patient preferences were hypofractionated whole breast irradiation (HF-WBI) 62%, partial breast irradiation (PBI) 28%, and conventionally fractionated whole breast irradiation (CF-WBI) 10%. By comparison, 82% of physicians use CF-WBI for more than 2/3 of women and 56% never use HF-WBI. With respect to PBI, 62% of women preferred three-dimensional (3D)-PBI and 38% favor brachytherapy-PBI, whereas 36% of physicians offer 3D-PBI and 66% offer brachytherapy-PBI. 70% of women prefer once-daily RT over 10 days vs. twice-daily RT over 5 days. 55% of physicians who use PBI do not offer PBI on clinical trial. Conclusions: HF-WBI, while preferred by patients and supported by evidence, falls behind the unproven and less preferred strategy of PBI in clinical practice. There is a discrepancy between women's preferences for PBI modality and type of PBI offered by physicians. Further alignment is needed between practice patterns, patient preferences, and clinical evidence.

  10. Revisiting Biomarkers of Total-Body and Partial-Body Exposure in a Baboon Model of Irradiation.

    Directory of Open Access Journals (Sweden)

    Marco Valente

    Full Text Available In case of a mass casualty radiation event, there is a need to distinguish total-body irradiation (TBI and partial-body irradiation (PBI to concentrate overwhelmed medical resources to the individuals that would develop an acute radiation syndrome (ARS and need hematologic support (i.e., mostly TBI victims. To improve the identification and medical care of TBI versus PBI individuals, reliable biomarkers of exposure could be very useful. To investigate this issue, pairs of baboons (n = 18 were exposed to different situations of TBI and PBI corresponding to an equivalent of either 5 Gy 60Co gamma irradiation (5 Gy TBI; 7.5 Gy left hemibody/2.5 right hemibody TBI; 5.55 Gy 90% PBI; 6.25 Gy 80% PBI; 10 Gy 50% PBI, 15 Gy 30% PBI or 2.5 Gy (2.5 Gy TBI; 5 Gy 50% PBI. More than fifty parameters were evaluated before and after irradiation at several time points up to 200 days. A partial least square discriminant analysis showed a good distinction of TBI from PBI situations that were equivalent to 5 Gy. Furthermore, all the animals were pooled in two groups, TBI (n = 6 and PBI (n = 12, for comparison using a logistic regression and a non parametric statistical test. Nine plasmatic biochemical markers and most of hematological parameters turned out to discriminate between TBI and PBI animals during the prodromal phase and the manifest illness phase. The most significant biomarkers were aspartate aminotransferase, creatine kinase, lactico dehydrogenase, urea, Flt3-ligand, iron, C-reactive protein, absolute neutrophil count and neutrophil-to-lymphocyte ratio for the early period, and Flt3-ligand, iron, platelet count, hemoglobin, monocyte count, absolute neutrophil count and neutrophil-to-lymphocyte ratio for the ARS phase. These results suggest that heterogeneity could be distinguished within a range of 2.5 to 5 Gy TBI.

  11. Patient Preferences and Physician Practice Patterns Regarding Breast Radiotherapy

    International Nuclear Information System (INIS)

    Hoopes, David J.; Kaziska, David; Chapin, Patrick; Weed, Daniel; Smith, Benjamin D.; Hale, E. Ronald; Johnstone, Peter A.

    2012-01-01

    Purpose: There are multiple current strategies for breast radiotherapy (RT). The alignment of physician practice patterns with best evidence and patient preferences will enhance patient autonomy and improve cancer care. However, there is little information describing patient preferences for breast RT and physician practice patterns. Methods and Materials: Using a reliable and valid instrument, we assessed the preferences of 5,000 randomly selected women (with or without cancer) undergoing mammography. To assess practice patterns, 2,150 randomly selected physician-members of American Society for Radiation Oncology were surveyed. Results: A total of 1,807 women (36%) and 363 physicians (17%) provided usable responses. The 95% confidence interval is < ±2.3% for patients and < ±5.3% for physicians. Patient preferences were hypofractionated whole breast irradiation (HF-WBI) 62%, partial breast irradiation (PBI) 28%, and conventionally fractionated whole breast irradiation (CF-WBI) 10%. By comparison, 82% of physicians use CF-WBI for more than 2/3 of women and 56% never use HF-WBI. With respect to PBI, 62% of women preferred three-dimensional (3D)-PBI and 38% favor brachytherapy-PBI, whereas 36% of physicians offer 3D-PBI and 66% offer brachytherapy-PBI. 70% of women prefer once-daily RT over 10 days vs. twice-daily RT over 5 days. 55% of physicians who use PBI do not offer PBI on clinical trial. Conclusions: HF-WBI, while preferred by patients and supported by evidence, falls behind the unproven and less preferred strategy of PBI in clinical practice. There is a discrepancy between women’s preferences for PBI modality and type of PBI offered by physicians. Further alignment is needed between practice patterns, patient preferences, and clinical evidence.

  12. Efficiency enhancement of perovskite solar cells by fabricating as-prepared film before sequential spin-coating procedure

    International Nuclear Information System (INIS)

    Jiang, Jiajia; Tao, Hai jun; Chen, Shanlong; Tan, Bin; Zhou, Ning; Zhu, Lumin; Zhao, Yuan; Wang, Yuqiao; Tao, Jie

    2016-01-01

    Graphical abstract: Schematic illustration of modified two-step spin-coating procedure for MAPbI 3 perovskite thin films. - Highlights: • An as-prepared CH 3 NH 3 PbI 3 and PbI 2 film was introduced before the traditional two-step process. • Smooth morphology and trace amount of remaining PbI 2 benefit the performance of solar cell. • The optimal as-prepared film introduced improves the efficiency of CH 3 NH 3 PbI 3 solar cells from 9.11% to 11.16%. - Abstract: Sequential spin-coating procedure is a widely adopted strategy to prepare CH 3 NH 3 PbI 3 on mesostructured TiO 2 electrode for organolead halide perovskite-based solar cells. However, this method suffers from the rough surface and excessively residual PbI 2 in the resulting perovskite film, deteriorating the device performance seriously. Herein, a facial modified sequential solution deposition method, by introducing an as-prepared CH 3 NH 3 PbI 3 and PbI 2 film before the traditional two-step process, was proposed to fabricate the perovskite-based solar cell with smooth morphology and trace amount of remaining PbI 2 . The optimal as-prepared film introduced improves the efficiency of CH 3 NH 3 PbI 3 solar cells from 9.11% to 11.16%. The enhancement of device performance can be attributed to the increased light absorption ability and decreased recombination rate of carriers in CH 3 NH 3 PbI 3 absorber.

  13. Water Infiltration in Methylammonium Lead Iodide Perovskite : Fast and Inconspicuous

    NARCIS (Netherlands)

    Mueller, Christian; Glaser, Tobias; Plogmeyer, Marcel; Sendner, Michael; Doering, Sebastian; Bakulin, Artem A.; Brzuska, Carlo; Scheer, Roland; Pshenichnikov, Maxim S.; Kowalsky, Wolfgang; Pucci, Annemarie; Lovrincic, Robert

    2015-01-01

    While the susceptibility of CH3NH3PbI3 to water is well-documented, the influence of water on device performance is not well-understood. Herein, we use infrared spectroscopy to show that water infiltration into CH3NH3PbI3 occurs much faster and at a humidity much lower than previously thought. We

  14. A Comparison of Two Measures of Parental Behavior

    Science.gov (United States)

    Safford, Scott M.; Alloy, Lauren B.; Pieracci, Antonia

    2007-01-01

    We compared two common measures of parenting behavior, the Children's Report of Parental Behavior Inventory (CRPBI) and the Parental Bonding Instrument (PBI), evaluating their psychometric properties and predictive ability. One hundred sixty seven college students completed the CRPBI, PBI, and measures of depression and anxiety with 123…

  15. Hydroxyl pyridine containing polybenzimidazole membranes for proton exchange membrane fuel cells

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Xu, Yixin; Zhou, Lu

    2013-01-01

    A polybenzimidazole variant polymer containing hydroxyl pyridine groups, termed as OHPyPBI, was synthesized from 3,3'-diaminobenzidine tetrahydrochloride and 4-hydroxy-2,6-pyridinedicarboxylic acid. The thermal-oxidative stability of the OHPyPBI polymer was as high as that of poly[2,2'-(m-phenyle...

  16. Target volume delineation in external beam partial breast irradiation: Less inter-observer variation with preoperative- compared to postoperative delineation

    International Nuclear Information System (INIS)

    Leij, Femke van der; Elkhuizen, Paula H.M.; Janssen, Tomas M.; Poortmans, Philip; Sangen, Maurice van der; Scholten, Astrid N.; Vliet-Vroegindeweij, Corine van; Boersma, Liesbeth J.

    2014-01-01

    The challenge of adequate target volume definition in external beam partial breast irradiation (PBI) could be overcome with preoperative irradiation, due to less inter-observer variation. We compared the target volume delineation for external beam PBI on preoperative versus postoperative CT scans of twenty-four breast cancer patients

  17. Validity of the Parental Burnout Inventory among Dutch employees

    NARCIS (Netherlands)

    van Bakel, H.J.A.; van Engen, M.L.; Peters, P.

    2018-01-01

    The purpose of this study was to validate the Parental Burnout Inventory (PBI) in a Dutch sample of working parents. The Dutch version of the PBI and questionnaires about work were administered to 627 working parents, with at least one child living at home. We investigated whether the

  18. An Instructional Theory for the Post-Industrial Age

    Science.gov (United States)

    Reigeluth, Charles M.

    2011-01-01

    This article describes instructional theory that supports post-industrial education and training systems--ones that are customized and learner-centered, in which student progress is based on learning rather than time. The author discusses the importance of problem-based instruction (PBI), identifies some problems with PBI, overviews an…

  19. Water Uptake and Acid Doping of Polybenzimidazoles as Electrolyte Membranes for Fuel Cells

    DEFF Research Database (Denmark)

    Qingfeng, Li; He, R.; Berg, Rolf W.

    2004-01-01

    Acid-doped polybenzimidazole (PBI) membranes have been demonstrated for fuel cell applications with advanced features such as high operating temperatures, little humidification, excellent CO tolerance, and promising durability. The water uptake and acid doping of PBI membranes have been studied...

  20. Electronic and optical properties of lead iodide

    DEFF Research Database (Denmark)

    Ahuja, R.; Arwin, H.; Ferreira da Silva, A.

    2002-01-01

    The electronic properties and the optical absorption of lead iodide (PbI2) have been investigated experimentally by means of optical absorption and spectroscopic ellipsometry, and theoretically by a full-potential linear muffin-tin-orbital method. PbI2 has been recognized as a very promising...

  1. Electrochemical gate-controlled electron transport of redox-active single perylene bisimide molecular junctions

    International Nuclear Information System (INIS)

    Li, C; Mishchenko, A; Li, Z; Pobelov, I; Wandlowski, Th; Li, X Q; Wuerthner, F; Bagrets, A; Evers, F

    2008-01-01

    We report a scanning tunneling microscopy (STM) experiment in an electrochemical environment which studies a prototype molecular switch. The target molecules were perylene tetracarboxylic acid bisimides modified with pyridine (P-PBI) and methylthiol (T-PBI) linker groups and with bulky tert-butyl-phenoxy substituents in the bay area. At a fixed bias voltage, we can control the transport current through a symmetric molecular wire Au|P-PBI(T-PBI)|Au by variation of the electrochemical 'gate' potential. The current increases by up to two orders of magnitude. The conductances of the P-PBI junctions are typically a factor 3 larger than those of T-PBI. A theoretical analysis explains this effect as a consequence of shifting the lowest unoccupied perylene level (LUMO) in or out of the bias window when tuning the electrochemical gate potential VG. The difference in on/off ratios reflects the variation of hybridization of the LUMO with the electrode states with the anchor groups. I T -E S(T) curves of asymmetric molecular junctions formed between a bare Au STM tip and a T-PBI (P-PBI) modified Au(111) electrode in an aqueous electrolyte exhibit a pronounced maximum in the tunneling current at -0.740, which is close to the formal potential of the surface-confined molecules. The experimental data were explained by a sequential two-step electron transfer process

  2. Post-boosting of classification boundary for imbalanced data using geometric mean.

    Science.gov (United States)

    Du, Jie; Vong, Chi-Man; Pun, Chi-Man; Wong, Pak-Kin; Ip, Weng-Fai

    2017-12-01

    In this paper, a novel imbalance learning method for binary classes is proposed, named as Post-Boosting of classification boundary for Imbalanced data (PBI), which can significantly improve the performance of any trained neural networks (NN) classification boundary. The procedure of PBI simply consists of two steps: an (imbalanced) NN learning method is first applied to produce a classification boundary, which is then adjusted by PBI under the geometric mean (G-mean). For data imbalance, the geometric mean of the accuracies of both minority and majority classes is considered, that is statistically more suitable than the common metric accuracy. PBI also has the following advantages over traditional imbalance methods: (i) PBI can significantly improve the classification accuracy on minority class while improving or keeping that on majority class as well; (ii) PBI is suitable for large data even with high imbalance ratio (up to 0.001). For evaluation of (i), a new metric called Majority loss/Minority advance ratio (MMR) is proposed that evaluates the loss ratio of majority class to minority class. Experiments have been conducted for PBI and several imbalance learning methods over benchmark datasets of different sizes, different imbalance ratios, and different dimensionalities. By analyzing the experimental results, PBI is shown to outperform other imbalance learning methods on almost all datasets. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Oxygen reduction on carbon supported platinum catalysts in high temperature polymer electrolytes

    DEFF Research Database (Denmark)

    Qingfeng, Li; Bergqvist, R. S.; Hjuler, H. A.

    1999-01-01

    Oxygen reduction on carbon supported platinum catalysts has been investigated in H3PO4, H3PO4-doped Nafion and PBI polymer electrolytes in a temperature range from 80 to 190°C. Compared with pure H3PO4, using the H3PO4 doped Nafion and PBI polymer electrolytes can significantly improve the oxygen...

  4. Ground- and excited-state pinched cone equilibria in calix[4]arenes bearing two perylene bisimide dyes

    NARCIS (Netherlands)

    Hippius, C.; van Stokkum, I.H.M.; Zangrando, E.; Williams, R.M.; Wykes, M.; Beljonne, D.; Wurthner, F.

    2008-01-01

    We report on a series of bis-chromophoric compounds o2c, g2c, and r2c, afforded by linking two identical orange, green, or red perylene bisimide (PBI) units, respectively, through a calix[4]arene spacer unit. The PBI units are characterized by their increasing sterical demand from a planar

  5. SKPM study on organic-inorganic perovskite materials

    Science.gov (United States)

    Song, Kena; Wu, Yinghui; Chen, Xi; He, Yi; Liu, Liyu; Chen, Guo; Liu, Ruchuan

    2018-03-01

    We report Atomic Force Microscopy (AFM) and Scanning Kelvin Probe Microscopy (SKPM) studies on the surface morphology and surface potential properties of CH3NH3PbI3, CH3NH3PbI3-xClx, CH3NH3PbI3-xBrx and CH3NH3PbBr3-xClx, respectively. For CH3NH3PbI3 rod structure, its surface potential is independent of the precursor concentration, suggesting a robust electronic feature. Surface potential studies of CH3NH3PbI3 particle reveal that the Fermi level within CH3NH3PbI3 is strongly influenced by the substrate. In the case of CH3NH3PbI3-xClx, its surface potential depends on precursor concentrations and we suspect that chlorine concentrated solutions might lead to more chlorine incorporation in the final products, thus lowering its Fermi level. Also, we studied the surface potentials of CH3NH3PbI3-xBrx and CH3NH3PbBr3-xClxwith specified halide ratios. The surface potential differences between different samples are related to their work function variations. These results are helpful to the understanding of the structural and electronic properties of perovskite materials.

  6. Target volume delineation in external beam partial breast irradiation: less inter-observer variation with preoperative- compared to postoperative delineation

    NARCIS (Netherlands)

    Leij, F. van der; Elkhuizen, P.H.M.; Janssen, T.M.; Poortmans, P.M.P.; Sangen, M. van der; Scholten, A.N.; Vliet-Vroegindeweij, C. van; Boersma, L.J.

    2014-01-01

    The challenge of adequate target volume definition in external beam partial breast irradiation (PBI) could be overcome with preoperative irradiation, due to less inter-observer variation. We compared the target volume delineation for external beam PBI on preoperative versus postoperative CT scans of

  7. Epoxides cross-linked hexafluoropropylidene polybenzimidazole membranes for application as high temperature proton exchange membranes

    International Nuclear Information System (INIS)

    Yang, Jingshuai; Xu, Yixin; Liu, Peipei; Gao, Liping; Che, Quantong; He, Ronghuan

    2015-01-01

    Covalently cross-linked hexafluoropropylidene polybenzimidazole (F 6 PBI) was prepared and used to fabricate high temperature proton exchange membranes with enhanced mechanical strength against thermoplastic distortion. Three different epoxides, i.e. bisphenol A diglycidyl ether (R 1 ), bisphenol A propoxylate diglycidyl ether (R 2 ) and poly(ethylene glycol) diglycidyl ether (R 3 ), were chosen as the cross-linkers to investigate the influence of their structures on the properties of the cross-linked F 6 PBI membranes. All the cross-linked F 6 PBI membranes displayed excellent stability towards the radical oxidation. Comparing with the pure F 6 PBI membrane, the cross-linked F 6 PBI membranes showed high acid doping level but less swelling after doping phosphoric acid at elevated temperatures. The mechanical strength at 130 °C was improved from 0.4 MPa for F 6 PBI membrane to a range of 0.8–2.0 MPa for the cross-linked F 6 PBI membranes with an acid doping level as high as around 14, especially for that crosslinking with the epoxide (R 3 ), which has a long linear structure of alkyl ether. The proton conductivity of the cross-linked membranes was increased accordingly due to the high acid doping levels. Fuel cell tests demonstrated the technical feasibility of the acid doped cross-linked F 6 PBI membranes for high temperature proton exchange membrane fuel cells

  8. Organic/inorganic composite membranes based on polybenzimidazole and nano-SiO2

    International Nuclear Information System (INIS)

    Pu Hongting; Liu Lu; Chang Zhihong; Yuan Junjie

    2009-01-01

    Organic/inorganic composite membranes based on polybenzimidazole (PBI) and nano-SiO 2 were prepared in this work. However, the preparation of PBI/SiO 2 composite membrane is not easy since PBI is insoluble in water, while nano-SiO 2 is hydrophilic due to the hydrophilicity of nano-SiO 2 and water-insolubility of PBI. Thus, a solvent-exchange method was employed to prepare the composite membrane. The morphology of the composite membranes was studied by scanning electron microscopy (SEM). It was revealed that inorganic particles were dispersed homogenously in the PBI matrix. The thermal stability of the composite membrane is higher than that of pure PBI, both for doped and undoped membranes. PBI/SiO 2 composite membranes with up to 15 wt% SiO 2 exhibited improved mechanical properties compared with PBI membranes. The proton conductivity of the composite membranes containing phosphoric acid was studied. The nano-SiO 2 in the composite membranes enhanced the ability to trap phosphoric acid, which improved the proton conductivity of the composite membranes. The membrane with 15 wt% of inorganic material is oxidatively stable and has a proton conductivity of 3.9 x 10 -3 S/cm at 180 deg. C.

  9. Interface electronic properties of co-evaporated MAPbI3 on ZnO(0001): In situ X-ray photoelectron spectroscopy and ultraviolet photoelectron spectroscopy study

    International Nuclear Information System (INIS)

    Zhou, Xianzhong; Li, Xiaoli; Huang, Feng; Zhong, Dingyong; Liu, Yuan

    2016-01-01

    In this work, the interface electronic properties of ZnO(0001)/CH 3 NH 3 PbI 3 were investigated by both X-ray and ultraviolet photoelectron spectroscopy. The CH 3 NH 3 PbI 3 thin films were grown on single crystalline ZnO(0001) substrate in situ by co-evaporation of PbI 2 and CH 3 NH 3 I at room temperature with various thickness from 1.5 nm to 190 nm. It was found that the conduction band minimum of ZnO lies 0.3 eV below that of CH 3 NH 3 PbI 3 , while the valence band maximum of ZnO lies 2.1 eV below that of CH 3 NH 3 PbI 3 , implying that the electrons can be effectively transported from CH 3 NH 3 PbI 3 to ZnO, and the holes can be blocked in the same time. A PbI 2 rich layer was initially formed at the interface of ZnO(0001)/CH 3 NH 3 PbI 3 during the growth. As a consequence, an interface barrier was built up which may prevent the electron transport at the interface.

  10. Ground- and excited-state pinched cone equilibria in calix[4]arenes bearing two perylene bisimide dyes

    NARCIS (Netherlands)

    Hippius, C.; van Stokkum, I.H.M.; Zangrando, E.; Williams, R.M.; Wykes, M.; Beljonne, D.; Würthner, F.

    2008-01-01

    We report oil a series of bis-chromophoric compounds o2c, g2c, and r2c, afforded by linking two identical orange, green, or red perylene bisimide (PBI) units, respectively, through a calix[4]arene spacer unit. The PBI units are characterized by their increasing sterical demand from a planar

  11. Comparing the Effectiveness of Processing Instruction and Production-Based Instruction on L2 Grammar Learning: The Role of Explicit Information

    Science.gov (United States)

    Soruç, Adem; Qin, Jingjing; Kim, YouJin

    2017-01-01

    This article reports on a study that investigated whether processing instruction(PI) or production-based instruction (PBI) is more effective for the teaching of regular past simple verb forms in English. In addition, this study examined whether explicit grammatical information (EI) mediates the effectiveness of PI or PBI. A total of 194 Turkish…

  12. Photocurrent Spectroscopy of Perovskite Layers and Solar Cells: A Sensitive Probe of Material Degradation

    KAUST Repository

    Holovský , Jakub; De Wolf, Stefaan; Werner, Jé ré mie; Remeš, Zdeněk; Mü ller, Martin; Neykova, Neda; Ledinský , Martin; Černá , Ladislava; Hrzina, Pavel; Lö per, Philipp; Niesen, Bjoern; Ballif, Christophe

    2017-01-01

    Optical absorptance spectroscopy of polycrystalline CHNHPbI films usually indicates the presence of a PbI phase, either as a preparation residue or due to film degradation, but gives no insight on how this may affect electrical properties. Here, we apply photocurrent spectroscopy to both perovskite solar cells and coplanar-contacted layers at various stages of degradation. In both cases, we find that the presence of a PbI phase restricts charge-carrier transport, suggesting that PbI encapsulates CHNHPbI grains. We also find that PbI injects holes into the CHNHPbI grains, increasing the apparent photosensitivity of PbI. This phenomenon, known as modulation doping, is absent in the photocurrent spectra of solar cells, where holes and electrons have to be collected in pairs. This interpretation provides insights into the photogeneration and carrier transport in dual-phase perovskites.

  13. In Situ Formed Phosphoric Acid/Phosphosilicate Nanoclusters in the Exceptional Enhancement of Durability of Polybenzimidazole Membrane Fuel Cells at Elevated High Temperatures

    DEFF Research Database (Denmark)

    Zhang, Jin; Aili, David; Bradley, John

    2017-01-01

    -meso-silica. The results indicate that the optimum limit of PWA-meso-silica loading in the PA/PBI membranes is 15 wt%. Detaled analysis indicates that the mesoporous structure of the PWA-meso-silica framework disintegrates, forming phosphosilicate phases within the PBI polymeric matrix during fuel cell operation at 200°C......Most recently, we developed a phosphotungstic acid impregnated mesoporous silica (PWA-meso-silica) and phosphoric acid doped polybenzimidazole (PA/PBI) composite membrane for use in high temperature fuel cells and achieved exceptional durability under a constant current load of 200 mA cm−2 at 200°C...... for over 2700 h. In this work, the fundamental role of PWA-meso-silica in enhancing the stability of the PA/PBI membrane has been investigated. The microstructure, the PA uptake, swelling ratio, mechanical property and conductivity of PA/PBI/PWA-meso-silica composite membranes depend on the loading of PWA...

  14. Tailoring Mixed-Halide, Wide-Gap Perovskites via Multistep Conversion Process

    DEFF Research Database (Denmark)

    Bae, Dowon; Palmstrom, Axel; Roelofs, Katherine

    2016-01-01

    Wide-band-gap mixed-halide CH3NH3PbI3–XBrX-based solar cells have been prepared by means of a sequential spin-coating process. The spin-rate for PbI2 as well as its repetitive deposition are important in determining the cross-sectional shape and surface morphology of perovskite, and, consequently......, J–V performance. A perovskite solar cell converted from PbI2 with a dense bottom layer and porous top layer achieved higher device performance than those of analogue cells with a dense PbI2 top layer. This work demonstrates a facile way to control PbI2 film configuration and morphology simply...

  15. Photocurrent Spectroscopy of Perovskite Layers and Solar Cells: A Sensitive Probe of Material Degradation

    KAUST Repository

    Holovský, Jakub

    2017-01-25

    Optical absorptance spectroscopy of polycrystalline CHNHPbI films usually indicates the presence of a PbI phase, either as a preparation residue or due to film degradation, but gives no insight on how this may affect electrical properties. Here, we apply photocurrent spectroscopy to both perovskite solar cells and coplanar-contacted layers at various stages of degradation. In both cases, we find that the presence of a PbI phase restricts charge-carrier transport, suggesting that PbI encapsulates CHNHPbI grains. We also find that PbI injects holes into the CHNHPbI grains, increasing the apparent photosensitivity of PbI. This phenomenon, known as modulation doping, is absent in the photocurrent spectra of solar cells, where holes and electrons have to be collected in pairs. This interpretation provides insights into the photogeneration and carrier transport in dual-phase perovskites.

  16. Case Report and Dosimetric Analysis of an Axillary Recurrence After Partial Breast Irradiation with Mammosite Catheter

    International Nuclear Information System (INIS)

    Shah, Anand P.; Dickler, Adam; Kirk, Michael C.; Chen, Sea S.; Strauss, Jonathan B.; Coon, Alan B.; Turian, Julius V.; Siziopikou, Kalliopi; Dowlat, Kambiz; Griem, Katherine L.

    2008-01-01

    Partial breast irradiation (PBI) was designed in part to decrease overall treatment times associated with whole breast radiation therapy (WBRT). WBRT treats the entire breast and usually portions of the axilla. The goal of PBI is to treat a smaller volume of breast tissue in less time, focusing the dose around the lumpectomy cavity. The following is a case of a 64-year-old woman with early-stage breast cancer treated with PBI who failed regionally in the ipsilateral axilla. With our dosimetric analysis, we found that the entire area of this axillary failure would have likely received at least 45 Gy if WBRT had been used, enough to sterilize microscopic disease. With PBI, this area received a mean dose of only 2.8 Gy, which raises the possibility that this regional failure may have been prevented had WBRT been used instead of PBI

  17. Synergistic extraction of trivalent lanthanoids with 3-phenyl-4-benzoyl-5-isoxazolone and various sulphoxides

    International Nuclear Information System (INIS)

    Sahu, S.K.; Chakravortty, V.; Reddy, M.L.P.; Ramamohan, T.R.

    1999-01-01

    Synergistic extraction of trivalent lanthanoids Nd, Tb and Tm with mixtures of 3-phenyl-4-benzoyl-5-isoxazolone (HPBI) and dioctyl sulphoxide (DOSO), bis-2-ethylhexyl sulphoxide (B2EHSO) or diphenyl sulphoxide (DPhSO) in xylene from perchlorate solution was investigated. Lanthanoids were found to be extracted as Ln(PBI) 3 with HPBI alone. In the presence of sulphoxides, Nd(III) was found to be extracted as Nd(PBI) 3 . S and Nd(PBI) 3 . 2 S (where S = sulphoxide). On the other hand, Tb(III) and Tm(III) were extracted as Tb(PBI) 3 . S and Tm(PBI) 3 . S respectively. The equilibrium constants of the synergistic species were found to increase monotonically with decreasing ionic radii of these metal ions. The addition of a sulphoxide to the metal chelate system not only enhances the extraction efficiency but also improves the selectivities among these trivalent lanthanoids. (orig.)

  18. Validation of the Malay Version of the Parental Bonding Instrument among Malaysian Youths Using Exploratory Factor Analysis.

    Science.gov (United States)

    Muhammad, Noor Azimah; Shamsuddin, Khadijah; Omar, Khairani; Shah, Shamsul Azhar; Mohd Amin, Rahmah

    2014-01-01

    Parenting behaviour is culturally sensitive. The aims of this study were (1) to translate the Parental Bonding Instrument into Malay (PBI-M) and (2) to determine its factorial structure and validity among the Malaysian population. The PBI-M was generated from a standard translation process and comprehension testing. The validation study of the PBI-M was administered to 248 college students aged 18 to 22 years. Participants in the comprehension testing had difficulty understanding negative items. Five translated double negative items were replaced with five positive items with similar meanings. Exploratory factor analysis showed a three-factor model for the PBI-M with acceptable reliability. Four negative items (items 3, 4, 8, and 16) and item 19 were omitted from the final PBI-M list because of incorrect placement or low factor loading (parenting style. Confirmatory factor analysis may further support this finding. Malaysia, parenting, questionnaire, validity.

  19. Polybenzimidazole Membranes Containing Benzimidazole Side Groups for High Temprature Polymer Electrolyte Membrane Fuel Cells

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Li, Xueyuan; Xu, Yizin

    2013-01-01

    Polybenzimidazole (PBI) with a high molecular weight of 69,000 was first synthesized. It was afterwards grafted with benzimidazole pendant groups on the backbones. The acid doped benzimidaozle grafted PBI membranes were investigated and characterized including fuel cell tests at elevated temperat......Polybenzimidazole (PBI) with a high molecular weight of 69,000 was first synthesized. It was afterwards grafted with benzimidazole pendant groups on the backbones. The acid doped benzimidaozle grafted PBI membranes were investigated and characterized including fuel cell tests at elevated...... temperatures without humidification. At an acid doping level of 13.1 mol H3PO4 per average molar repeat unit, the PBI membranes with a benzimidazole grafting degree of 10.6% demonstrated a conductivity of 0.15 S cm-1 and a H2-air fuel cell peak power density of 378 mW cm-2 at 180 oC at ambient pressure without...

  20. Polybenzimidazole block copolymers for fuel cell: synthesis and studies of block length effects on nanophase separation, mechanical properties, and proton conductivity of PEM.

    Science.gov (United States)

    Maity, Sudhangshu; Jana, Tushar

    2014-05-14

    A series of meta-polybenzimidazole-block-para-polybenzimidazole (m-PBI-b-p-PBI), segmented block copolymers of PBI, were synthesized with various structural motifs and block lengths by condensing the diamine terminated meta-PBI (m-PBI-Am) and acid terminated para-PBI (p-PBI-Ac) oligomers. NMR studies and existence of two distinct glass transition temperatures (Tg), obtained from dynamical mechanical analysis (DMA) results, unequivocally confirmed the formation of block copolymer structure through the current polymerization methodology. Appropriate and careful selection of oligomers chain length enabled us to tailor the block length of block copolymers and also to make varieties of structural motifs. Increasingly distinct Tg peaks with higher block length of segmented block structure attributed the decrease in phase mixing between the meta-PBI and para-PBI blocks, which in turn resulted into nanophase segregated domains. The proton conductivities of proton exchange membrane (PEM) developed from phosphoric acid (PA) doped block copolymer membranes were found to be increasing substantially with increasing block length of copolymers even though PA loading of these membranes did not alter appreciably with varying block length. For example when molecular weight (Mn) of blocks were increased from 1000 to 5500 then the proton conductivities at 160 °C of resulting copolymers increased from 0.05 to 0.11 S/cm. Higher block length induced nanophase separation between the blocks by creating less morphological barrier within the block which facilitated the movement of the proton in the block and hence resulting higher proton conductivity of the PEM. The structural varieties also influenced the phase separation and proton conductivity. In comparison to meta-para random copolymers reported earlier, the current meta-para segmented block copolymers were found to be more suitable for PBI-based PEM.

  1. Validation of the Malay Version of the Parental Bonding Instrument among Malaysian Youths Using Exploratory Factor Analysis

    Science.gov (United States)

    MUHAMMAD, Noor Azimah; SHAMSUDDIN, Khadijah; OMAR, Khairani; SHAH, Shamsul Azhar; MOHD AMIN, Rahmah

    2014-01-01

    Background: Parenting behaviour is culturally sensitive. The aims of this study were (1) to translate the Parental Bonding Instrument into Malay (PBI-M) and (2) to determine its factorial structure and validity among the Malaysian population. Methods: The PBI-M was generated from a standard translation process and comprehension testing. The validation study of the PBI-M was administered to 248 college students aged 18 to 22 years. Results: Participants in the comprehension testing had difficulty understanding negative items. Five translated double negative items were replaced with five positive items with similar meanings. Exploratory factor analysis showed a three-factor model for the PBI-M with acceptable reliability. Four negative items (items 3, 4, 8, and 16) and item 19 were omitted from the final PBI-M list because of incorrect placement or low factor loading (overprotection factor. All the items loaded positively on their respective factors. Conclusion: The Malaysian population favoured positive items in answering questions. The PBI-M confirmed the three-factor model that consisted of care, autonomy and overprotection. The PBI-M is a valid and reliable instrument to assess the Malaysian parenting style. Confirmatory factor analysis may further support this finding. Keywords: Malaysia, parenting, questionnaire, validity PMID:25977634

  2. Bonding and expressed emotion: two interlinked concepts?

    Science.gov (United States)

    Duclos, Jeanne; Maria, Anne-Solène; Dorard, Géraldine; Curt, Florence; Apfel, Alexandre; Vibert, Sarah; Rein, Zoé; Perdereau, Fabienne; Godart, Nathalie

    2013-01-01

    Bonding and expressed emotion (EE) are two concepts modeling family relationships. Two studies, with contradictory results, have explored whether these concepts and their corresponding instruments [the Parental Bonding Instrument (PBI) and the Camberwell Family Interview] do indeed measure the same aspects of family relationships. Our first objective was to compare the adolescents' perceptions of family relationships using the PBI, and the parental viewpoint using the Five-Minute Speech Sample (FMSS-EE). Secondly, we compared the PBI scores and EE levels of the parents. Sixty adolescent girls with anorexia nervosa completed the PBI. The FMSS and a modified version of the PBI were administered to parents separately. No significant link was identified between adolescent PBI scores and parental EE levels. However, a link between maternal 'modified' PBI scores and maternal EE was observed: when mothers registered a high Final EE, they were more likely to deny their daughter's psychological autonomy compared to mothers with lower EE. Our empirical results do not support the hypothesis of an overlap between the two concepts. Indeed bonding and EE measure the same object, i.e. the quality of family relationships, but time scales differ and so do the perspectives (patient vs. parental viewpoint). Copyright © 2012 S. Karger AG, Basel.

  3. Exciton versus Free Carrier Photogeneration in Organometal Trihalide Perovskites Probed by Broadband Ultrafast Polarization Memory Dynamics

    Science.gov (United States)

    Sheng, ChuanXiang; Zhang, Chuang; Zhai, Yaxin; Mielczarek, Kamil; Wang, Weiwei; Ma, Wanli; Zakhidov, Anvar; Vardeny, Z. Valy

    2015-03-01

    We studied the ultrafast transient response of photoexcitations in two hybrid organic-inorganic perovskite films used for high efficiency photovoltaic cells, namely, CH3NH3PbI3 and CH3NH3PbI1.1Br1.9 using polarized broadband pump-probe spectroscopy in the spectral range of 0.3-2.7 eV with 300 fs time resolution. For CH3NH3PbI3 with above-gap excitation we found both photogenerated carriers and excitons, but only carriers are photogenerated with below-gap excitation. In contrast, mainly excitons are photogenerated in CH3NH3PbI1.1Br1.9 . Surprisingly, we also discovered in CH3NH3PbI3 , but not in CH3NH3PbI1.1Br1.9 , transient photoinduced polarization memory for both excitons and photocarriers, which is also reflected in the steady state photoluminescence. From the polarization memory dynamics we obtained the excitons diffusion constant in CH3NH3PbI3 , D ≈0.01 cm2 s-1 .

  4. Does Three-Dimensional External Beam Partial Breast Irradiation Spare Lung Tissue Compared With Standard Whole Breast Irradiation?

    International Nuclear Information System (INIS)

    Jain, Anudh K.; Vallow, Laura A.; Gale, Ashley A.; Buskirk, Steven J.

    2009-01-01

    Purpose: To determine whether three-dimensional conformal partial breast irradiation (3D-PBI) spares lung tissue compared with whole breast irradiation (WBI) and to include the biologically equivalent dose (BED) to account for differences in fractionation. Methods and Materials: Radiotherapy treatment plans were devised for WBI and 3D-PBI for 25 consecutive patients randomized on the NSABP B-39/RTOG 0413 protocol at Mayo Clinic in Jacksonville, Florida. WBI plans were for 50 Gy in 25 fractions, and 3D-PBI plans were for 38.5 Gy in 10 fractions. Volume of ipsilateral lung receiving 2.5, 5, 10, and 20 Gy was recorded for each plan. The linear quadratic equation was used to calculate the corresponding dose delivered in 10 fractions and volume of ipsilateral lung receiving these doses was recorded for PBI plans. Ipsilateral mean lung dose was recorded for each plan and converted to BED. Results: There was a significant decrease in volume of lung receiving 20 Gy with PBI (median, 4.4% vs. 7.5%; p 3 vs 4.85 Gy 3 , p = 0.07). PBI plans exposed more lung to 2.5 and 5 Gy. Conclusions: 3D-PBI exposes greater volumes of lung tissue to low doses of radiation and spares the amount of lung receiving higher doses when compared with WBI.

  5. Fluorescent labelling of DNA on superparamagnetic nanoparticles by a perylene bisimide derivative for cell imaging

    Energy Technology Data Exchange (ETDEWEB)

    Maltas, Esra, E-mail: maltasesra@gmail.com [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey); Malkondu, Sait [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey); Uyar, Pembegul [Selcuk University, Faculty of Science, Department of Biology, 42075 Konya (Turkey); Selcuk University, Advanced Technology Research and Application Center, Konya (Turkey); Ozmen, Mustafa [Selcuk University, Faculty of Science, Department of Chemistry, 42075 Konya (Turkey)

    2015-03-01

    N,N′-Bis[tris-(2-aminoethyl) amine]-3,4,9,10-perylenetetracarboxylic diimide (PBI-TRIS), nonfluorescent dye was used to fluorescent labelling of DNA. For this aim, (3-aminopropyl) triethoxysilane (APTS) modified superparamagnetic iron oxide nanoparticles (SPIONs) were synthesized to provide a suitable surface for binding of DNA. Amine functionalized nanoparticles showed a high immobilization capacity (82.70%) at 25 mg of nanoparticle concentration for Calf thymus DNA. Binding capacity of PBI-TRIS to DNA-SPION was also found as 1.93 μM on 25 mg of nanoparticles by using UV–vis spectroscopy. Binding of PBI-TRIS to DNA onto nanoparticles was also characterized by scanning electron microscopy and infrared spectroscopy. The confocal images of PBI-TRIS labelled DNA-SPION and breast cells were taken at 488 and 561.7 nm of excitation wavelengths. Cell image was also compared with a commercial dye, DAPI at 403.7 nm of excitation wavelength. Results showed that PBI-TRIS can be used for cell staining. - Highlights: • Functionalized SPIONs were synthesized and treated with DNA. • The binding of PBI-TRIS with DNA was studied. • The image of PBI-TRIS labelled DNA-SPION was detected by a confocal microscope.

  6. Fluorescent labelling of DNA on superparamagnetic nanoparticles by a perylene bisimide derivative for cell imaging

    International Nuclear Information System (INIS)

    Maltas, Esra; Malkondu, Sait; Uyar, Pembegul; Ozmen, Mustafa

    2015-01-01

    N,N′-Bis[tris-(2-aminoethyl) amine]-3,4,9,10-perylenetetracarboxylic diimide (PBI-TRIS), nonfluorescent dye was used to fluorescent labelling of DNA. For this aim, (3-aminopropyl) triethoxysilane (APTS) modified superparamagnetic iron oxide nanoparticles (SPIONs) were synthesized to provide a suitable surface for binding of DNA. Amine functionalized nanoparticles showed a high immobilization capacity (82.70%) at 25 mg of nanoparticle concentration for Calf thymus DNA. Binding capacity of PBI-TRIS to DNA-SPION was also found as 1.93 μM on 25 mg of nanoparticles by using UV–vis spectroscopy. Binding of PBI-TRIS to DNA onto nanoparticles was also characterized by scanning electron microscopy and infrared spectroscopy. The confocal images of PBI-TRIS labelled DNA-SPION and breast cells were taken at 488 and 561.7 nm of excitation wavelengths. Cell image was also compared with a commercial dye, DAPI at 403.7 nm of excitation wavelength. Results showed that PBI-TRIS can be used for cell staining. - Highlights: • Functionalized SPIONs were synthesized and treated with DNA. • The binding of PBI-TRIS with DNA was studied. • The image of PBI-TRIS labelled DNA-SPION was detected by a confocal microscope

  7. Synthesis, structural, thermal and optical studies of inorganic-organic hybrid semiconductors, R-PbI4

    Science.gov (United States)

    Pradeesh, K.; Nageswara Rao, K.; Vijaya Prakash, G.

    2013-02-01

    Wide varieties of naturally self-assembled two-dimensional inorganic-organic (IO) hybrid semiconductors, (4-ClC6H4NH3)2PbI4, (C6H9C2H4NH3)2PbI4, (CnH2n+1NH3)2PbI4 (where n = 12, 16, 18), (CnH2n-1NH3)2PbI4 (where n = 3, 4, 5), (C6H5C2H4NH3)2PbI4, NH3(CH2)12NH3PbI4, and (C4H3SC2H4NH3)2PbI4, were fabricated by intercalating structurally diverse organic guest moieties into lead iodide perovskite structure. The crystal packing of all these fabricated IO-hybrids comprises of well-ordered organic and inorganic layers, stacked-up alternately along c-axis. Almost all these hybrids are thermally stable upto 200 °C and show strong room-temperature exciton absorption and photoluminescence features. These strongly confined optical excitons are highly influenced by structural deformation of PbI matrix due to the conformation of organic moiety. A systematic correlation of optical exciton behavior of IO-hybrids with the organic/inorganic layer thicknesses, intercalating organic moieties, and various structural disorders were discussed. This systematic study clearly suggests that the PbI layer crumpling is directly responsible for the tunability of optical exciton energy.

  8. Development and validation of the Patient Benefit Index for peripheral arterial disease.

    Science.gov (United States)

    Zander, Nicole; Demirel, Ebru-Berrin; Augustin, Matthias; Sommer, Rachel; Debus, Eike Sebastian; Breuer, Peter; Blome, Christine

    2018-01-25

    The aim of this study was to develop and validate a specific Patient Benefit Index (PBI) version for the treatment of peripheral arterial disease (PAD). A non-interventional longitudinal development study was conducted. The first phase comprised a qualitative pre-study with n = 50 patients, in which the PBI was adapted for peripheral arterial disease. The resulting Patient Benefit Index for peripheral arterial disease (PBI-PAD) was validated in the second phase at two points of measurement. The total PBI-PAD score was calculated by weighting item-wise the achievement of treatment goals with the initially assessed needs. Feasibility, internal consistency, and construct validity were analysed and the generic three level version of the EuroQol five-dimensional questionnaire (EQ-5D-3L) and the disease-specific instrument Vascular Quality of Life Questionnaire (VascuQoL) were used for convergent validation. In the pre-study, the PBI-PAD, consisting of 12 items, was developed. N = 103 patients participated in the main study. At T2, data were available for n = 57 patients. Mean age was 71.0 years ± 9.1 and 66.7 % of the participants were male. The amount of missing values of the PBI-PAD score was low (PBI (needs at T1 and benefits at T2) were internally consistent with Cronbach's alpha > 0.7. PBI-PAD total score correlated significantly with the T2-T1-differences of the EuroQol-visual analogue scale (EQ VAS) (r = 0.4, p = 0.007) and the Vascular Quality of Life Questionnaire (r = 0.5, p PBI-PAD is a feasible, internally consistent, and valid instrument to assess patient-relevant benefits in PAD patients receiving minimally invasive treatment or surgical procedures. It can be recommended for use in routine care as well as in clinical studies.

  9. PyMEs y crecimiento económico : Estado de situación de Argentina y su comparación con Brasil y Canadá

    OpenAIRE

    De Simone Martin, Mara

    2017-01-01

    Descripción del estado de situación en Argentina, Brasil y Canadá respecto de la contribución de las PyMES al PBI y Empleo. Organismos o políticas de Apoyo a las PyMES. Incubadoras de Negocios. Durante los últimos 15 años, Argentina muestra muy pocas PyMES y bajo PBI comparada con Brasil y Canadá aún cuando se contemplen paralelismos geopolíticos, similitudes en PBI per Cápita (Argentina-Brasil) o PEA (Argentina-Canadá), entre otras muchas otras variables. Argentina no cuenta con un...

  10. Effect of rapid thermal annealing on InP1−xBix grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    Wu, X Y; Wang, K; Pan, W W; Wang, P; Li, Y Y; Song, Y X; Gu, Y; Yue, L; Xu, H; Zhang, Z P; Cui, J; Gong, Q; Wang, S M

    2015-01-01

    The effect of post-growth rapid thermal annealing on structural and optical properties of InP 1−x Bi x thin films was investigated. InPBi shows good thermal stability up to 500 °C and a modest improvement in photoluminescence (PL) intensity with an unchanged PL spectral feature. Bismuth outdiffusion from InPBi and strain relaxation are observed at about 600 °C. The InPBi sample annealed at 800 °C shows an unexpected PL spectrum with different energy transitions. (paper)

  11. Crosslinking of polybenzimidazolemembranes by divinylsulfone post-treatment for high-temperature proton exchange membrane fuel cell applications

    DEFF Research Database (Denmark)

    Aili, David; Li, Qingfeng; Christensen, Erik

    2011-01-01

    Phosphoric acid-doped polybenzimidazole (PBI) has been suggested as a promising electrolyte for proton exchangemembrane fuel cells operating at temperatures up to 200 ◦C. This paper describes the development of a crosslinking procedure for PBI membranes by post-treatment with divinylsulfone....... The crosslinking chemistry was studied and optimized on a low-molecularweight model system and the results were used to optimize the crosslinking conditions of PBI membranes. The crosslinked membraneswere characterized with respect to chemical and physiochemical properties, showing improved mechanical strength...

  12. Intercalation crystallization of phase-pure α-HC(NH₂)₂PbI₃ upon microstructurally engineered PbI₂ thin films for planar perovskite solar cells.

    Science.gov (United States)

    Zhou, Yuanyuan; Yang, Mengjin; Kwun, Joonsuh; Game, Onkar S; Zhao, Yixin; Pang, Shuping; Padture, Nitin P; Zhu, Kai

    2016-03-28

    The microstructure of the solid-PbI2 precursor thin film plays an important role in the intercalation crystallization of the formamidinium lead triiodide perovskite (α-HC(NH2)2PbI3). It is shown that microstructurally engineered PbI2 thin films with porosity and low crystallinity are the most favorable for conversion into uniform-coverage, phase-pure α-HC(NH2)2PbI3 perovskite thin films. Planar perovskite solar cells fabricated using these thin films deliver power conversion efficiency (PCE) up to 13.8%.

  13. Absorption spectra of thin films of triple compounds in the system RbIPbI2

    International Nuclear Information System (INIS)

    Yunakova, O.N.; Miloslavskij, V.K.; Ksenofontova, E.V.; Kovalenko, E.N.

    2012-01-01

    A formation of compounds RbPbI 3 and Rb 4 PbI 6 in the system RbI-PbI 2 is revealed and their absorption spectra are investigated in an energy interval 2-6 eV and a temperatures range 90-500 K. It is established that the low-frequency exciton excitations are localized in PbI 6 4- structural elements of the crystal lattice, they are classified as excitons of intermediate coupling and are of a three-dimensional character in RbPbI 3 and a quasi-two-dimensional one in Rb 4 PbI 6 .

  14. Benzimidazole grafted polybenzimidazoles for proton exchange membrane fuel cells

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Aili, David; Li, Qingfeng

    2013-01-01

    High molecular weight polybenzimidazole (PBI) was synthesized and grafted with benzimidazole pendant groups. The high molecular weight of PBI resulted in good film-forming properties and superior tensile strength. With a phosphoric acid doping level (ADL) of 13.1, a tensile strength of 16 MPa...... was achieved at room temperature. Grafting of benzimidazole moieties onto the PBI macromolecular chain introduced additional basic sites which allowed the membrane to achieve higher phosphoric acid uptakes. A molar acid conductivity, defined as the specific conductivity of each mole of doping acid...

  15. Passenger bus industry weather information application.

    Science.gov (United States)

    2011-03-21

    Adverse weather significantly affects the United States national transportation system, including commercial companies : that rely on highways to support their enterprises. The Passenger Bus (Motorcoach) Industry (PBI) is one such affected : user who...

  16. Gypsum (CaSO42H2O) scaling on polybenzimidazole and cellulose acetate hollow fiber membranes under forward osmosis

    KAUST Repository

    Chen, Si Cong; Su, Jincai; Fu, Feng-Jiang; Mi, Baoxia; Chung, Neal Tai-Shung

    2013-01-01

    We have examined the gypsum (CaSO42H2O) scaling phenomena on membranes with different physicochemical properties in forward osmosis (FO) processes. Three hollow fiber membranes made of (1) cellulose acetate (CA), (2) polybenzimidazole (PBI

  17. 75 FR 7264 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-02-18

    ... Institutions Program. Frequency: Annually. Affected Public: Business or other for profit; Not-for-profit... programs in the science, technology, engineering and mathematics (STEM) fields, the PBI program authorized...

  18. Perovskite-fullerene hybrid materials suppress hysteresis in planar diodes.

    KAUST Repository

    Xu, Jixian; Buin, Andrei; Ip, Alexander H; Li, Wei; Voznyy, Oleksandr; Comin, Riccardo; Yuan, Mingjian; Jeon, Seokmin; Ning, Zhijun; McDowell, Jeffrey J; Kanjanaboos, Pongsakorn; Sun, Jon-Paul; Lan, Xinzheng; Quan, Li Na; Kim, Dong Ha; Hill, Ian G; Maksymovych, Peter; Sargent, Edward H

    2015-01-01

    passivates the key PbI3(-) antisite defects during the perovskite self-assembly, as revealed by theory and experiment. Photoluminescence transient spectroscopy proves that the PCBM phase promotes electron extraction. We showcase this mixed material in planar

  19. 75 FR 49484 - Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving...

    Science.gov (United States)

    2010-08-13

    ... DEPARTMENT OF EDUCATION Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving Institutions (AANAPISI), Native American-Serving Nontribal Institutions (NASNTI), Hispanic Serving Institutions-STEM and Articulation (HSI-STEM), and Predominantly Black Institutions (PBI...

  20. Performance Evaluation of Polybenzimidazole for Potential Aerospace Applications

    NARCIS (Netherlands)

    Iqbal, H.M.S.

    2014-01-01

    With the increasing use of polymer based composite materials, there is an increasing demand of polymeric resins with high glass transition temperature, high thermal stability and excellent mechanical properties at high temperature. Polybenzimidazole (PBI) is a recently emerged high performance

  1. Doping phosphoric acid in polybenzimidazole membranes for high temperature proton exchange membrane fuel cells

    DEFF Research Database (Denmark)

    He, Ronghuan; Li, Qingfeng; Jensen, Jens Oluf

    2007-01-01

    Polybenzimidazole (PBI) membranes were doped in phosphoric acid solutions of different concentrations at room temperature. The doping chemistry was studied using the Scatchard method. The energy distribution of the acid complexation in polymer membranes is heterogeneous, that is, there are two...... different types of sites in PBI for the acid doping. The protonation constants of PBI by phosphoric acid are found to be 12.7 L mol(-1) (K-1) for acid complexing sites with higher affinity, and 0.19 L mol(-1) (K-2) for the sites with lower affinity. The dissociation constants for the complexing acid onto...... these two types of PBI sites are found to be 5.4 X 10(-4) and 3.6 X 10(-2), respectively, that is, about 10 times smaller than that of aqueous phosphoric acid in the first case but 5 times higher in the second. The proton conducting mechanism is also discussed....

  2. The use of polybenzimidazole membranes in vanadium redox flow batteries leading to increased coulombic efficiency and cycling performance

    International Nuclear Information System (INIS)

    Zhou, X.L.; Zhao, T.S.; An, L.; Wei, L.; Zhang, C.

    2015-01-01

    An issue with conventional vanadium redox flow batteries (VRFB) with Nafion membranes is the crossover of vanadium ions, resulting in low coulombic efficiency and rapid decay in capacity. In this work, a VRFB with a polybenzimidazole (PBI) membrane is tested and compared with the Nafion system. Results show that the PBI-based VRFB exhibits a substantially higher coulombic efficiency of up to 99% at current densities ranging from 20 mA cm −2 to 80 mA cm −2 . More importantly, it is demonstrated that the PBI-based VRFB has a capacity decay rate of as low as 0.3% per cycle, which is four times lower than that of the Nafion system (1.3% per cycle). The improved coulombic efficiency and cycling performance are attributed to the low crossover of vanadium ions through the PBI membrane

  3. Material Exchange Property of Organo Lead Halide Perovskite with Hole-Transporting Materials

    Directory of Open Access Journals (Sweden)

    Seigo Ito

    2015-10-01

    Full Text Available Using X-ray diffraction (XRD, it was confirmed that the deposition of hole-transporting materials (HTM on a CH3NH3PbI3 perovskite layer changed the CH3NH3PbI3 perovskite crystal, which was due to the material exchanging phenomena between the CH3NH3PbI3 perovskite and HTM layers. The solvent for HTM also changed the perovskite crystal. In order to suppress the crystal change, doping by chloride ion, bromide ion and 5-aminovaleric acid was attempted. However, the doping was unable to stabilize the perovskite crystal against HTM deposition. It can be concluded that the CH3NH3PbI3 perovskite crystal is too soft and flexible to stabilize against HTM deposition.

  4. Growth and characterisation of lead iodide single crystals

    International Nuclear Information System (INIS)

    Tonn, Justus

    2012-01-01

    The work in hand deals with the growth and characterisation of lead iodide (PbI 2 ) single crystals. PbI 2 is regarded as a promising candidate for low-noise X- and gamma ray detection at room temperature. Its benefits if compared to conventional materials like HgI 2 , CdTe, Si, or GaAs lie in a band gap energy of 2.32 eV, an excellent ability to absorb radiation, and a high electrical resistivity. For an application of PbI 2 as detector material the growth and characterisation of crystals with high chemical and structural quality is extremely challenging. In light of this, the effectiveness of zone purification of the PbI 2 used for crystal growth was confirmed by spectroscopic analysis. Furthermore, technological aspects during processing of purified PbI 2 were investigated. With the help of thermal analysis, a correlation was found between the degree of exposing the source material to oxygen from the air and the structural quality of the resulting crystals. A hydrogen treatment was applied to PbI 2 as an effective method for the removal of oxidic pollutions, which resulted in a significant reduction of structural defects like polytypic growth and stress-induced cracking. The growth of PbI 2 single crystals was, among others, carried out by the Bridgman-Stockbarger method. In this context, much effort was put on the investigation of influences resulting from the design and preparation of ampoules. For the first time, crystal growth of PbI 2 was also carried out by the Czochralski method. If compared to the Bridgman-Stockbarger method, the Czochralski technique allowed a significantly faster growth of nearly crack-free crystals with a reproducible predetermination of crystallographic orientation. By an optimised sample preparation of PbI 2 , surface orientations perpendicular to the usually cleaved (0001) plane were realised. It is now possible to determine the material properties along directions which were so far not accessible. Thus, for example, the ratio of

  5. Proton conductivity of phosphoric acid doped polybenzimidazole and its composites with inorganic protontic conductors

    DEFF Research Database (Denmark)

    Li, Qingfeng

    2003-01-01

    contain inorganic protonic conductors including zirconium phosphate (ZrP), (Zr(HPO4)2. nH2O); phosphotungstic acid (PWA), (H3PW12O40. nH2O); and silicotungstic acid (SiWA), (H4SiW12O40 . nH2O). The conductivity of phosphoric acid doped PBI and PBI composite membranes was found to be dependent on the acid...

  6. Perovskite Thin Films via Atomic Layer Deposition

    KAUST Repository

    Sutherland, Brandon R.; Hoogland, Sjoerd; Adachi, Michael M.; Kanjanaboos, Pongsakorn; Wong, Chris T. O.; McDowell, Jeffrey J.; Xu, Jixian; Voznyy, Oleksandr; Ning, Zhijun; Houtepen, Arjan J.; Sargent, Edward H.

    2014-01-01

    © 2014 Wiley-VCH Verlag GmbH & Co. KGaA. (Graph Presented) A new method to deposit perovskite thin films that benefit from the thickness control and conformality of atomic layer deposition (ALD) is detailed. A seed layer of ALD PbS is place-exchanged with PbI2 and subsequently CH3NH3PbI3 perovskite. These films show promising optical properties, with gain coefficients of 3200 ± 830 cm-1.

  7. Polybenzimidazole membranes for zero gap alkaline electrolysis cells

    DEFF Research Database (Denmark)

    Kraglund, Mikkel Rykær; Aili, David; Christensen, Erik

    Membranes of m-PBI doped in KOH (aq), 15-35 wt%, show high ionic conductivity in the temperature range 20-80 ºC. In electrolysis cells with nickel foam electrodes m-PBI membranesprovide low internal resistance. With a 60 µm membraneat 80ºC in 20 wt% KOH,1000 mA/cm2 is achieved at 2.25....

  8. Classification System for Identifying Women at Risk for Altered Partial Breast Irradiation Recommendations After Breast Magnetic Resonance Imaging

    International Nuclear Information System (INIS)

    Kowalchik, Kristin V.; Vallow, Laura A.; McDonough, Michelle; Thomas, Colleen S.; Heckman, Michael G.; Peterson, Jennifer L.; Adkisson, Cameron D.; Serago, Christopher; McLaughlin, Sarah A.

    2013-01-01

    Purpose: To study the utility of preoperative breast MRI for partial breast irradiation (PBI) patient selection, using multivariable analysis of significant risk factors to create a classification rule. Methods and Materials: Between 2002 and 2009, 712 women with newly diagnosed breast cancer underwent preoperative bilateral breast MRI at Mayo Clinic Florida. Of this cohort, 566 were retrospectively deemed eligible for PBI according to the National Surgical Adjuvant Breast and Bowel Project Protocol B-39 inclusion criteria using physical examination, mammogram, and/or ultrasound. Magnetic resonance images were then reviewed to determine their impact on patient eligibility. The patient and tumor characteristics were evaluated to determine risk factors for altered PBI eligibility after MRI and to create a classification rule. Results: Of the 566 patients initially eligible for PBI, 141 (25%) were found ineligible because of pathologically proven MRI findings. Magnetic resonance imaging detected additional ipsilateral breast cancer in 118 (21%). Of these, 62 (11%) had more extensive disease than originally noted before MRI, and 64 (11%) had multicentric disease. Contralateral breast cancer was detected in 28 (5%). Four characteristics were found to be significantly associated with PBI ineligibility after MRI on multivariable analysis: premenopausal status (P=.021), detection by palpation (P<.001), first-degree relative with a history of breast cancer (P=.033), and lobular histology (P=.002). Risk factors were assigned a score of 0-2. The risk of altered PBI eligibility from MRI based on number of risk factors was 0:18%; 1:22%; 2:42%; 3:65%. Conclusions: Preoperative bilateral breast MRI altered the PBI recommendations for 25% of women. Women who may undergo PBI should be considered for breast MRI, especially those with lobular histology or with 2 or more of the following risk factors: premenopausal, detection by palpation, and first-degree relative with a history of

  9. Ultralow Self-Doping in 2D Hybrid Perovskite Single Crystals

    KAUST Repository

    Peng, Wei; Yin, Jun; Ho, Kang-Ting; Ouellette, Olivier; de Bastiani, Michele; Banavoth, Murali; El Tall, Omar; Shen, Chao; Miao, Xiaohe; Pan, Jun; Alarousu, Erkki; He, Jr-Hau; Ooi, Boon S.; Mohammed, Omar F.; Sargent, Edward H.; Bakr, Osman

    2017-01-01

    -processed semiconductors, including hybrid perovskites, which are usually high in defects due to rapid crystallization. Here, we uncover extremely low self-doping concentrations in single crystals of (C6H5C2H4NH3)2PbI4・(CH3NH3PbI3)n-1 (n=1, 2, and 3)—over three orders

  10. Benchtop evaluation of pressure barrier insufflator and standard insufflator systems.

    Science.gov (United States)

    Nepple, Kenneth G; Kallogjeri, Dorina; Bhayani, Sam B

    2013-01-01

    Previous experimental research has reported minimal differences in pressure maintenance between different versions of standard insufflators (SI). However, a recent report identified potential clinical benefits with a valveless pressure barrier insufflator (PBI). We sought to perform a benchtop objective evaluation of SI and PBI systems. A rigid box system with continuous pressure manometry was used to evaluate a PBI (Surgiquest Airseal) and two SIs (SI1 = Stryker PneumoSure High Flow Insufflator and SI2 = Storz SCB Thermoflator). Pressure maintenance of 15 mmHg was evaluated during experimental conditions of leakage from a 5 mm port site, leakage from a 12 mm port site, and continuous suction. With leakage from the 5 mm port site, the PBI maintained pressure of >13 mmHg whereas the pressures dropped moderately with the SI1 (7-13 mmHg) and SI2 insufflators (3-7 mmHg) and did not regain goal pressure until leakage was stopped. With leakage from 12 mm port site, the PBI pressure decreased to 9-11 mmHg, whereas the SI1 and SI2 lost insufflation pressures completely. The PBI maintained pressure of >11 mmHg during continuous suction while the SI1 and SI2 lost pressure entirely, and actually showed negative pressure from air suction into the rigid box system. When evaluated statistically with the mixed model repeated measures ANOVA, the SI1 and SI2 performed similarly while the PBI maintained increased pressure. In the experimental rigid box system, the PBI more successfully maintained pressure in response to leakage and suction than SIs.

  11. Tailoring Mixed-Halide, Wide-Gap Perovskites via Multistep Conversion Process

    NARCIS (Netherlands)

    Bae, D.; Palmstrom, A.; Roelofs, K.; Mei, Bastian Timo; Chorkendorf, I.; Bent, S.F.; Vesborg, P.C.

    2016-01-01

    Wide-band-gap mixed-halide CH3NH3PbI3–XBrX-based solar cells have been prepared by means of a sequential spin-coating process. The spin-rate for PbI2 as well as its repetitive deposition are important in determining the cross-sectional shape and surface morphology of perovskite, and, consequently,

  12. Isolation of the endosperm-specific LPAAT gene promoter from coconut (Cocos nucifera L.) and its functional analysis in transgenic rice plants.

    Science.gov (United States)

    Xu, Li; Ye, Rongjian; Zheng, Yusheng; Wang, Zhekui; Zhou, Peng; Lin, Yongjun; Li, Dongdong

    2010-09-01

    As one of the key tropical crops, coconut (Cocos nucifera L.) is a member of the monocotyledonous family Aracaceae (Palmaceae). In this study, we amplified the upstream region of an endosperm-specific expression gene, Lysophosphatidyl acyltransferase (LPAAT), from the coconut genomic DNA by chromosome walking. In this sequence, we found several types of promoter-related elements including TATA-box, CAAT-box and Skn1-motif. In order to further examine its function, three different 5'-deletion fragments were inserted into pBI101.3, a plant expression vector harboring the LPAAT upstream sequence, leading to pBI101.3-L1, pBI101.3-L2 and pBI101.3-L3, respectively. We obtained transgenic plants of rice by Agrobacterium-mediated callus transformation and plant regeneration and detected the expression of gus gene by histochemical staining and fluorometric determination. We found that gus gene driven by the three deletion fragments was specifically expressed in the endosperm of rice seeds, but not in the empty vector of pBI101.3 and other tissues. The highest expression level of GUS was at 15 DAF in pBI101.3-L3 and pBI101.3-L2 transgenic lines, while the same level was detected at 10 DAF in pBI101.3-L1. The expression driven by the whole fragment was up to 1.76- and 2.8-fold higher than those driven by the -817 bp and -453 bp upstream fragments, and 10.7-fold higher than that driven by the vector without the promoter. Taken together, our results strongly suggest that these promoter fragments from coconut have a significant potential in genetically improving endosperm in main crops.

  13. Perovskite Thin Films via Atomic Layer Deposition

    KAUST Repository

    Sutherland, Brandon R.

    2014-10-30

    © 2014 Wiley-VCH Verlag GmbH & Co. KGaA. (Graph Presented) A new method to deposit perovskite thin films that benefit from the thickness control and conformality of atomic layer deposition (ALD) is detailed. A seed layer of ALD PbS is place-exchanged with PbI2 and subsequently CH3NH3PbI3 perovskite. These films show promising optical properties, with gain coefficients of 3200 ± 830 cm-1.

  14. Quantitative Assessment of Degenerative Cartilage and Subchondral Bony Lesions in a Preserved Cadaveric Knee: Propagation-Based Phase-Contrast CT Versus Conventional MRI and CT.

    Science.gov (United States)

    Geith, Tobias; Brun, Emmanuel; Mittone, Alberto; Gasilov, Sergei; Weber, Loriane; Adam-Neumair, Silvia; Bravin, Alberto; Reiser, Maximilian; Coan, Paola; Horng, Annie

    2018-04-09

    The aim of this study was to quantitatively assess hyaline cartilage and subchondral bone conditions in a fully preserved cadaveric human knee joint using high-resolution x-ray propagation-based phase-contrast imaging (PBI) CT and to compare the performance of the new technique with conventional CT and MRI. A cadaveric human knee was examined using an x-ray beam of 60 keV, a detector with a 90-mm 2 FOV, and a pixel size of 46 × 46 μm 2 . PBI CT images were reconstructed with both the filtered back projection algorithm and the equally sloped tomography method. Conventional 3-T MRI and CT were also performed. Measurements of cartilage thickness, cartilage lesions, International Cartilage Repair Society scoring, and detection of subchondral bone changes were evaluated. Visual inspection of the specimen akin to arthroscopy was conducted and served as a standard of reference for lesion detection. Loss of cartilage height was visible on PBI CT and MRI. Quantification of cartilage thickness showed a strong correlation between the two modalities. Cartilage lesions appeared darker than the adjacent cartilage on PBI CT. PBI CT showed similar agreement to MRI for depicting cartilage substance defects or lesions compared with the visual inspection. The assessment of subchondral bone cysts showed moderate to strong agreement between PBI CT and CT. In contrast to the standard clinical methods of MRI and CT, PBI CT is able to simultaneously depict cartilage and bony changes at high resolution. Though still an experimental technique, PBI CT is a promising high-resolution imaging method to evaluate comprehensive changes of osteoarthritic disease in a clinical setting.

  15. Oxygen reduction on carbon supported platinum catalysts in high temperature polymer electrolytes

    DEFF Research Database (Denmark)

    Qingfeng, Li; Hjuler, Hans Aage; Bjerrum, Niels

    2000-01-01

    Oxygen reduction on carbon supported platinum catalysts has been investigated in H3PO4, H3PO4-doped Nafion and polybenzimidazole (PBI) polymer electrolytes in a temperature range up to 190 degrees C. Compared with pure H3PO4, the combination of H3PO4 and polymer electrolytes can significantly...... membrane fuel cell based on H3PO4-doped PBI for operation at temperatures between 150 and 200 degrees C. (C) 2000 Elsevier Science Ltd. All rights reserved....

  16. Nanostructured polyurethane perylene bisimide ester assemblies with tuneable morphology and enhanced stability

    Science.gov (United States)

    Zhang, Xiaoxiao; Gong, Tingyuan; Chi, Hong; Li, Tianduo

    2018-03-01

    Size control has been successfully achieved in inorganic materials, but it remains a challenge in polymer nanomaterials due to their polydispersity. Here, we report a facile approach to tailor the diameters of polyurethane (PU) nanoparticles (490 nm, 820 nm and 2.1 µm) via perylene bisimide (PBI) assisted self-assembly. The formed morphologies such as spindle, spherical and core-shell structures depend on the ratio of PBI and polymer concentrations. It is shown that the formation of PU nanoparticles is directed by π-π stacking of PBI and the morphology transition is not only affected by the amount of PBI incorporated, but also influenced by solvent, which controls the initial evaporation balance. Furthermore, the prepared PUs exhibit retained optical stability and enhanced thermal stability. The PUs, designed to have conjugated PBI segments in backbones, were synthesized via ring-opening and condensation reactions. Compared with the neat PU, gel permeation chromatography shows narrower molecular weight distribution. Fluorescence spectra and ultraviolet-visible spectra indicate retained maximum emission wavelength of PBI at 574 nm and 5.2% quantum yields. Thermo-gravimetric analysis and differential scanning calorimetry reveal 79°C higher decomposition temperature and 22°C higher glass transition temperature. This study provides a new way to fabricate well-defined nanostructures of functionalized PUs.

  17. Gypsum (CaSO4·2H2O) Scaling on Polybenzimidazole and Cellulose Acetate Hollow Fiber Membranes under Forward Osmosis

    Science.gov (United States)

    Chen, Si Cong; Su, Jincai; Fu, Feng-Jiang; Mi, Baoxia; Chung, Tai-Shung

    2013-01-01

    We have examined the gypsum (CaSO4·2H2O) scaling phenomena on membranes with different physicochemical properties in forward osmosis (FO) processes. Three hollow fiber membranes made of (1) cellulose acetate (CA), (2) polybenzimidazole (PBI)/polyethersulfone (PES) and (3) PBI-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) were studied. For the first time in FO processes, we have found that surface ionic interactions dominate gypsum scaling on the membrane surface. A 70% flux reduction was observed on negatively charged CA and PBI membrane surfaces, due to strong attractive forces. The PBI membrane surface also showed a slightly positive charge at a low pH value of 3 and exhibited a 30% flux reduction. The atomic force microscopy (AFM) force measurements confirmed a strong repulsive force between gypsum and PBI at a pH value of 3. The newly developed PBI-POSS/PAN membrane had ridge morphology and a contact angle of 51.42° ± 14.85° after the addition of hydrophilic POSS nanoparticles and 3 min thermal treatment at 95 °C. Minimal scaling and an only 1.3% flux reduction were observed at a pH value of 3. Such a ridge structure may reduce scaling by not providing a locally flat surface to the crystallite at a pH value of 3; thus, gypsum would be easily washed away from the surface. PMID:24957062

  18. A Persian version of the parental bonding instrument: factor structure and psychometric properties.

    Science.gov (United States)

    Behzadi, Behnaz; Parker, Gordon

    2015-02-28

    The Parental Bonding Instrument (PBI) is a widely used self-report measure for quantifying key parenting styles as perceived by the child during its first 16 years. While its development study identified two key parental dimensions, subsequent studies have variably confirmed those two or argued for one or more additional parental constructs. We developed a Persian translation of the PBI and administered it to a sample of 340 high school students. The construct validity of the Persian PBI was examined by Exploratory Factor Analysis while Confirmatory Factor Analysis was used to identify the most adequate model. Analyses of the Persian PBI favored a four-factor model for both parental forms. The Persian PBI has a factorial structure consistent with constructs identified in western cultures, as well as high internal consistency and test-retest reliability. Multivariate analyses indicated significant differences between boys and girls across some factors. The PBI appears an acceptable and appropriate measure for quantifying parent-child bonding in Iranian samples. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  19. CD64 on monocytes and granulocytes in severe acute bronchiolitis: Pilot study on its usefulness as a bacterial infection biomarker.

    Science.gov (United States)

    García-Salido, Alberto; Serrano-González, Ana; Casado-Flores, Juan; Sierra-Colomina, Montserrat; de Azagra-Garde, Amelia Martínez; García-Teresa, María Ángeles; Melen, Gustavo J; Ramírez-Orellana, Manuel

    2018-02-27

    The CD64 receptor has been described as a biomarker of bacterial infection. We speculated that CD64 surface expression on monocytes and granulocytes of children with severe acute bronchiolitis (SAB) could be altered in cases of probable bacterial infection (PBI) determined using classical biomarkers (procalcitonin and C-reactive protein, leukocyte count, and radiographic findings). A prospective observational pilot study was conducted from October 2015 to February 2016 in children admitted for pediatric critical care. A blood sample was taken in the first 24 hours of admission, and CD64 was measured by flow cytometry. The values obtained were analyzed and correlated with traditional biomarkers of PBI. Thirty-two children were included; a correlation was found between CD64 expression and the PBI criteria. CD64 surface expression was higher in children with PBI (area under the receiver operating characteristic curve of 0.73; P = 0.042) and the percentage of CD64 + granulocytes was higher in children with PBI. This is the first study to describe CD64 surface expression on monocytes and granulocytes in SAB, finding CD64 values to be higher in children with PBI. Larger clinical studies are needed to elucidate the real accuracy of CD64 as a biomarker of bacterial infection. ©2018 Society for Leukocyte Biology.

  20. Role of ligand basicity and stereochemistry in the extraction of plutonium(IV) isoxazolonates

    International Nuclear Information System (INIS)

    Mohapatra, P.K.; Manchanda, V.K.

    2003-01-01

    The extraction behaviour of plutonium (IV) was investigated from nitric acid and perchloric acid using 3-phenyl-4-benzoyl-5-isoxazolone (HPBI) as well as a mixture of HPBI and tri-n-octyl phosphine oxide (TOPO) in xylene. Studies on the binary extraction system Pu(IV)-HPBI indicated extraction of species of the type Pu(PBI) 4 . In the presence of TOPO, while species of the type Pu(PBI) 3 (ClO 4 ).(TOPO) and Pu(PBI) 4 .TOPO were co-extracted from perchloric acid medium, a mixture of Pu(PBI) 2 (NO 3 ) 2 .2TOPO, Pu(PBI) 3 (NO 3 ).(TOPO) and Pu(PBI) 4 .TOPO were co-extracted from nitric acid medium. In addition to the electronic factors, steric factors were found to play a significant role during the formation of binary/ternary/quaternary complexes. The steric hindrance due to the unusual conformation of the isoxazolone led to lowering of the equilibrium constants for both the binary and ternary extraction systems. Possible steric factor influences are explained with the help of molecular modelling. (orig.)

  1. Nanostructured polyurethane perylene bisimide ester assemblies with tuneable morphology and enhanced stability.

    Science.gov (United States)

    Zhang, Xiaoxiao; Gong, Tingyuan; Chi, Hong; Li, Tianduo

    2018-03-01

    Size control has been successfully achieved in inorganic materials, but it remains a challenge in polymer nanomaterials due to their polydispersity. Here, we report a facile approach to tailor the diameters of polyurethane (PU) nanoparticles (490 nm, 820 nm and 2.1 µm) via perylene bisimide (PBI) assisted self-assembly. The formed morphologies such as spindle, spherical and core-shell structures depend on the ratio of PBI and polymer concentrations. It is shown that the formation of PU nanoparticles is directed by π-π stacking of PBI and the morphology transition is not only affected by the amount of PBI incorporated, but also influenced by solvent, which controls the initial evaporation balance. Furthermore, the prepared PUs exhibit retained optical stability and enhanced thermal stability. The PUs, designed to have conjugated PBI segments in backbones, were synthesized via ring-opening and condensation reactions. Compared with the neat PU, gel permeation chromatography shows narrower molecular weight distribution. Fluorescence spectra and ultraviolet-visible spectra indicate retained maximum emission wavelength of PBI at 574 nm and 5.2% quantum yields. Thermo-gravimetric analysis and differential scanning calorimetry reveal 79°C higher decomposition temperature and 22°C higher glass transition temperature. This study provides a new way to fabricate well-defined nanostructures of functionalized PUs.

  2. Porous polybenzimidazole membranes doped with phosphoric acid: Preparation and application in high-temperature proton-exchange-membrane fuel cells

    International Nuclear Information System (INIS)

    Li, Jin; Li, Xiaojin; Yu, Shuchun; Hao, Jinkai; Lu, Wangting; Shao, Zhigang; Yi, Baolian

    2014-01-01

    Highlights: • Porous polybenzimidazole membrane was prepared with glucose as porogen. • Phosphoric acid content was as high as 15.7 mol H 3 PO 4 per PBI repeat unit. • 200 h Constant current density test was carried out at 150 °C. • Degradation was due to the gap between membrane and catalyst layer. - Abstract: In this paper, the preparation and characterization of porous polybenzimidazole membranes doped with phosphoric acid were reported. For the preparation of porous polybenzimidazole membranes, glucose and saccharose were selected as porogen and added into PBI resin solution before solvent casting. The prepared porous PBI membranes had high proton conductivity and high content of acid doping at room temperature with 15.7 mol H 3 PO 4 per PBI repeat unit, much higher than pure PBI membrane at the same condition. Further, the performance and stability of the porous PBI membrane in high-temperature proton-exchange-membrane fuel cells was tested. It was found that the cell performance remained stable during 200 h stability test under a constant current discharge of 0.5 A cm −2 except for the last fifty hours. The decay in the last fifty hours was ascribed to the delamination between the catalyst layer and membrane increasing the charge-transfer resistance

  3. Variable sources for Cretaceous to recent HIMU and HIMU-like intraplate magmatism in New Zealand

    DEFF Research Database (Denmark)

    van der Meer, Quinten; Waight, Tod Earle; Scott, James

    2017-01-01

    –100Ma) calc-alkaline lamprophyres are compositionally similar to the preceding arc-magmatism (206Pb/204Pb(i)=18.6, 207Pb/204Pb(i)=15.62, 208Pb/204Pb(i)=38.6, 87Sr/86Sr(i)=0.7063–0.7074, εNd(i)=−2.1 −+0.1 and εHf(i)=−0.2 −+2.3) and are interpreted as melts originating from subduction-modified lithosphere....... Alkaline dikes erupted on the inboard Gondwana margin shortly after cessation of subduction (92–84Ma) have heterogeneous isotopic properties: 206Pb/204Pb(i)=18.7 to 19.4, 207Pb/204Pb(i)=15.60 to 15.65, 208Pb/204Pb(i)=38.6 to 39.4, 87Sr/86Sr(i)=0.7031 to 0.7068, εNd(i)=+4.5 to +8.0 and εHf(i)=+5.1 to +8...... from the complex local subduction history. A coeval episode of alkaline magmatism (mainly 98–82Ma) occurred outboard of Gondwana’s former active margin and on the Hikurangi oceanic plateau (accreted to Zealandia in the Early Cretaceous) with compositions closer to true HIMU (206Pb/204Pb(i)≈20.5, 207Pb...

  4. Biologic comparison of partial breast irradiation protocols

    International Nuclear Information System (INIS)

    Rosenstein, Barry S.; Lymberis, Stella C.; Formenti, Silvia C.

    2004-01-01

    Purpose: To analyze the dose/fractionation schedules currently used in ongoing clinical trials of partial breast irradiation (PBI) by comparing their biologically effective dose (BED) values to those of three standard whole breast protocols commonly used after segmental mastectomy in the treatment of breast cancer. Methods and materials: The BED equation derived from the linear-quadratic model for radiation-induced cell killing was used to calculate the BEDs for three commonly used whole breast radiotherapy regimens, in addition to a variety of external beam radiotherapy, as well as high-dose-rate and low-dose-rate brachytherapy, PBI protocols. Results: The BED values of most PBI protocols resulted in tumor control BEDs roughly equivalent to a 50-Gy standard treatment, but consistently lower than the BEDs for regimens in which the tumor bed receives a total dose of either 60 Gy or 66 Gy. The BED values calculated for the acute radiation responses of erythema and desquamation were nearly all lower for the PBI schedules, and the late-response BEDs for most PBI regimens were in a similar range to the BEDs for the standard treatments. Conclusion: Biologically effective dose modeling raises the concern that inadequate doses might be delivered by PBI to ensure optimal in-field tumor control

  5. Gypsum (CaSO42H2O) scaling on polybenzimidazole and cellulose acetate hollow fiber membranes under forward osmosis

    KAUST Repository

    Chen, Si Cong

    2013-11-08

    We have examined the gypsum (CaSO42H2O) scaling phenomena on membranes with different physicochemical properties in forward osmosis (FO) processes. Three hollow fiber membranes made of (1) cellulose acetate (CA), (2) polybenzimidazole (PBI)/polyethersulfone (PES) and (3) PBI-polyhedral oligomeric silsesquioxane (POSS)/polyacrylonitrile (PAN) were studied. For the first time in FO processes, we have found that surface ionic interactions dominate gypsum scaling on the membrane surface. A 70% flux reduction was observed on negatively charged CA and PBI membrane surfaces, due to strong attractive forces. The PBI membrane surface also showed a slightly positive charge at a low pH value of 3 and exhibited a 30% flux reduction. The atomic force microscopy (AFM) force measurements confirmed a strong repulsive force between gypsum and PBI at a pH value of 3. The newly developed PBI-POSS/PAN membrane had ridge morphology and a contact angle of 51.42 14.85 after the addition of hydrophilic POSS nanoparticles and 3 min thermal treatment at 95 C. Minimal scaling and an only 1.3% flux reduction were observed at a pH value of 3. Such a ridge structure may reduce scaling by not providing a locally flat surface to the crystallite at a pH value of 3; thus, gypsum would be easily washed away from the surface. 2013 by the authors; licensee MDPI, Basel, Switzerland.

  6. A Prospective Study of the Utility of Magnetic Resonance Imaging in Determining Candidacy for Partial Breast Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Dorn, Paige L.; Al-Hallaq, Hania A.; Haq, Farah; Goldberg, Mira [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States); Abe, Hiroyuki [Department of Radiology, University of Chicago Medical Center, Chicago, Illinois (United States); Hasan, Yasmin [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States); Chmura, Steven J., E-mail: schmura@radonc.uchicago.edu [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States)

    2013-03-01

    Purpose: Retrospective data have demonstrated that breast magnetic resonance imaging (MRI) may change a patient's eligibility for partial breast irradiation (PBI) by identifying multicentric, multifocal, or contralateral disease. The objective of the current study was to prospectively determine the frequency with which MRI identifies occult disease and to establish clinical factors associated with a higher likelihood of MRI prompting changes in PBI eligibility. Methods and Materials: At The University of Chicago, women with breast cancer uniformly undergo MRI in addition to mammography and ultrasonography. From June 2009 through May 2011, all patients were screened prospectively in a multidisciplinary conference for PBI eligibility based on standard imaging, and the impact of MRI on PBI eligibility according to National Surgical Adjuvant Breast and Bowel Project protocol B-39/Radiation Therapy Oncology Group protocol 0413 entry criteria was recorded. Univariable analysis was performed using clinical characteristics in both the prospective cohort and in a separate cohort of retrospectively identified patients. Pooled analysis was used to derive a scoring index predictive of the risk that MRI would identify additional disease. Results: A total of 521 patients were screened for PBI eligibility, and 124 (23.8%) patients were deemed eligible for PBI based on standard imaging. MRI findings changed PBI eligibility in 12.9% of patients. In the pooled univariable analysis, tumor size ≥2 cm on mammography or ultrasonography (P=.02), age <50 years (P=.01), invasive lobular histology (P=.01), and HER-2/neu amplification (P=.01) were associated with a higher likelihood of MRI changing PBI eligibility. A predictive score was generated by summing the number of significant risk factors. Patients with a score of 0, 1, 2, and 3 had changes to eligibility based on MRI findings in 2.8%, 13.2%, 38.1%, and 100%, respectively (P<.0001). Conclusions: MRI identified additional

  7. Novel polybenzimidazole derivatives for high temperature polymer electrolyte membrane fuel cell applications

    Science.gov (United States)

    Xiao, Lixiang

    Recent advances have made polymer electrolyte membrane fuel cells (PEMFCs) a leading alternative to internal combustion engines for both stationary and transportation applications. In particular, high temperature polymer electrolyte membranes operational above 120°C without humidification offer many advantages including fast electrode kinetics, high tolerance to fuel impurities and simple thermal and water management systems. A series of polybenzimidazole (PBI) derivatives including pyridine-based PBI (PPBI) and sulfonated PBI (SPBI) homopolymers and copolymers have been synthesized using polyphosphoric acid (PPA) as both solvent and polycondensation agent. High molecular weight PBI derivative polymers were obtained with well controlled backbone structures in terms of pyridine ring content, polymer backbone rigidity and degree of sulfonation. A novel process, termed the PPA process, has been developed to prepare phosphoric acid (PA) doped PBI membranes by direct-casting of the PPA polymerization solution without isolation or re-dissolution of the polymers. The subsequent hydrolysis of PPA to PA by moisture absorbed from the atmosphere usually induced a transition from the solution-like state to a gel-like state and produced PA doped PBI membranes with a desirable suite of physiochemical properties characterized by the PA doping levels, mechanical properties and proton conductivities. The effects of the polymer backbone structure on the polymer characteristics and membrane properties, i.e., the structure-property relationships of the PBI derivative polymers have been studied. The incorporation of additional basic nitrogen containing pyridine rings and sulfonic acid groups enhanced the polymer solubility in acid and dipolar solvents while retaining the inherently high thermal stability of the PBI heteroaromatic backbone. In particular, the degradation of the SPBI polymers with reasonable high molecular weights commenced above 450°C, notably higher than other

  8. Ionic conducting poly-benzimidazoles; Polybenzimidazoles conducteurs ioniques

    Energy Technology Data Exchange (ETDEWEB)

    Jouanneau, J

    2006-11-15

    Over the last years, many research works have been focused on new clean energy systems. Hydrogen fuel cell seems to be the most promising one. However, the large scale development of this technology is still limited by some key elements. One of them is the polymer electrolyte membrane 'Nafion' currently used, for which the ratio performance/cost is too low. The investigations we carried out during this thesis work are related to a new class of ionic conducting polymer, the sulfonated poly-benzimidazoles (sPBI). Poly-benzimidazoles (PBI) are aromatic heterocyclic polymers well-known for their excellent thermal and chemical stability. Ionic conduction properties are obtained by having strong acid groups (sulfonic acid SO{sub 3}H) on the macromolecular structure. For that purpose, we first synthesized sulfonated monomers. Their poly-condensation with an appropriate non-sulfonated co-monomer yields to sPBI with sulfonation range from 0 to 100 per cent. Three different sPBI structures were obtained, and verified by appropriate analytical techniques. We also showed that the protocol used for the synthesis resulted in high molecular weights polymers. We prepared ionic conducting membrane by casting sPBI solutions on glass plates. Their properties of stability, water swelling and ionic conductivity were investigated. Surprisingly, the behaviour of sPBI was quite different from the other sulfonated aromatic polymers with same amount of SO{sub 3}H, their stability was much higher, but their water swelling and ionic conductivity were quite low. We attributed these differences to strong ionic interactions between the sulfonic acid groups and the basic benzimidazole groups of our polymers. However, we managed to solve this problem synthesizing very highly sulfonated PBI, obtaining membranes with a good balance between all the properties necessary. (author)

  9. Enhancing the Durability and Carrier Selectivity of Perovskite Solar Cells Using a Blend Interlayer.

    Science.gov (United States)

    Sin, Dong Hun; Jo, Sae Byeok; Lee, Seung Goo; Ko, Hyomin; Kim, Min; Lee, Hansol; Cho, Kilwon

    2017-05-31

    A mechanically and thermally stable and electron-selective ZnO/CH 3 NH 3 PbI 3 interface is created via hybridization of a polar insulating polymer, poly(ethylene glycol) (PEG), into ZnO nanoparticles (NPs). PEG successfully passivates the oxygen defects on ZnO and prevents direct contact between CH 3 NH 3 PbI 3 and defects on ZnO. A uniform CH 3 NH 3 PbI 3 film is formed on a soft ZnO:PEG layer after dispersion of the residual stress from the volume expansion during CH 3 NH 3 PbI 3 conversion. PEG also increases the work of adhesion of the CH 3 NH 3 PbI 3 film on the ZnO:PEG layer and holds the CH 3 NH 3 PbI 3 film with hydrogen bonding. Furthermore, PEG tailors the interfacial electronic structure of ZnO, reducing the electron affinity of ZnO. As a result, a selective electron-collection cathode is formed with a reduced electron affinity and a deep-lying valence band of ZnO, which significantly enhances the carrier lifetime (473 μs) and photovoltaic performance (15.5%). The mechanically and electrically durable ZnO:PEG/CH 3 NH 3 PbI 3 interface maintains the sustainable performance of the solar cells over 1 year. A soft and durable cathodic interface via PEG hybridization in a ZnO layer is an effective strategy toward flexible electronics and commercialization of the perovskite solar cells.

  10. Ionic conducting poly-benzimidazoles

    International Nuclear Information System (INIS)

    Jouanneau, J.

    2006-11-01

    Over the last years, many research works have been focused on new clean energy systems. Hydrogen fuel cell seems to be the most promising one. However, the large scale development of this technology is still limited by some key elements. One of them is the polymer electrolyte membrane 'Nafion' currently used, for which the ratio performance/cost is too low. The investigations we carried out during this thesis work are related to a new class of ionic conducting polymer, the sulfonated poly-benzimidazoles (sPBI). Poly-benzimidazoles (PBI) are aromatic heterocyclic polymers well-known for their excellent thermal and chemical stability. Ionic conduction properties are obtained by having strong acid groups (sulfonic acid SO 3 H) on the macromolecular structure. For that purpose, we first synthesized sulfonated monomers. Their poly-condensation with an appropriate non-sulfonated co-monomer yields to sPBI with sulfonation range from 0 to 100 per cent. Three different sPBI structures were obtained, and verified by appropriate analytical techniques. We also showed that the protocol used for the synthesis resulted in high molecular weights polymers. We prepared ionic conducting membrane by casting sPBI solutions on glass plates. Their properties of stability, water swelling and ionic conductivity were investigated. Surprisingly, the behaviour of sPBI was quite different from the other sulfonated aromatic polymers with same amount of SO 3 H, their stability was much higher, but their water swelling and ionic conductivity were quite low. We attributed these differences to strong ionic interactions between the sulfonic acid groups and the basic benzimidazole groups of our polymers. However, we managed to solve this problem synthesizing very highly sulfonated PBI, obtaining membranes with a good balance between all the properties necessary. (author)

  11. Formation of core (polystyrene)-shell (polybenzimidazole) nanoparticles using sulfonated polystyrene as template.

    Science.gov (United States)

    Hazarika, Mousumi; Arunbabu, Dhamodaran; Jana, Tushar

    2010-11-15

    We report formation of core (polystyrene)-shell (polybenzimidazole) nanoparticles from a new blend system consisting of an amorphous polymer polybenzimidazole (PBI) and an ionomer sodium salt of sulfonated polystyrene (SPS-Na). The ionomer used for the blending is spherical in shape with sulfonate groups on the surface of the particles. An in depth investigation of the blends at various sulfonation degrees and compositions using Fourier transform infrared (FT-IR) spectroscopy provides direct evidence of specific hydrogen bonding interactions between the N-H groups of PBI and the sulfonate groups of SPS-Na. The disruption of PBI chains self association owing to the interaction between the functional groups of these polymer pairs is the driving force for the blending. Thermodynamical studies carried out by using differential scanning calorimeter (DSC) establish partially miscible phase separated blending of these polymers in a wider composition range. The two distinguishable glass transition temperatures (T(g)) which are different from the neat components and unaltered with the blends composition attribute that the domain size of heterogeneity (d(d)) of the blends is >20 nm since one of the blend component (SPS-Na particle) diameter is ∼70 nm. The diminish of PBI chains self association upon blending with SPS-Na particles and the presence of invariant T(g)'s of the blends suggest the wrapping of PBI chains over the SPS-Na spherical particle surface and hence resulting a core-shell morphology. Transmission electron microscopy (TEM) study provides direct evidence of core-shell nanoparticle formation; where core is the polystyrene and shell is the PBI. The sulfonation degree affects the blends phase separations. The higher degree of sulfonation favors the disruption of PBI self association and thus forms partially miscible two phases blends with core-shell morphology. Copyright © 2010 Elsevier Inc. All rights reserved.

  12. Electric Response and Conductivity Mechanism in H3PO4‑Doped Polybenzimidazole-4N−HfO2 Nanocomposite Membranes for High Temperature Fuel Cells

    International Nuclear Information System (INIS)

    Nawn, Graeme; Vezzù, Keti; Bertasi, Federico; Pagot, Gioele; Pace, Giuseppe; Conti, Fosca; Negro, Enrico

    2017-01-01

    Relaxation and polarization phenomena of phosphoric acid-doped [PBI4N(HfO 2 ) x ](H 3 PO 4 ) y nanocomposite membranes for high-temperature proton-exchange membrane fuel cells are studied using Dynamic Mechanical Analysis (DMA) and Broadband Electrical Spectroscopy (BES). The membranes are obtained by casting combinations of a polybenzimidazole polymer (PBI4N) with increasing amounts of hafnium oxide nanofiller, resulting in [PBI4N(HfO 2 ) x ] hybrid systems with 0 ≤ x ≤ 0.32. Phosphoric acid at varying content levels (0 ÷ 18 wt%) is used as a doping agent, giving rise to [PBI4N(HfO 2 ) x ](H 3 PO 4 ) y membranes. DMA and BES studies lead us to determine that the electric response of the membranes is modulated by polarization phenomena and by α and β dielectric relaxation events of the polymer matrix. Additionally, the experimental results suggest that in [PBI4N(HfO 2 ) x ](H 3 PO 4 ) y membranes the conductivity occurs owing to three conductivity pathways: two mechanisms involving inter-domain proton migration phenomena by “hopping” events; and one mechanism in which proton exchange occurs between delocalization bodies. These results highlight the significant effect of the hafnium oxide nanofiller content on the conductivity of [PBI4N(HfO 2 ) x ](H 3 PO 4 ) y where, at x ≥ 0.04, demonstrates conductivity higher (9.0 × 10 −2 S/cm) than that of pristine H 3 PO 4 -doped PBI4N (4.8 × 10 −2 S/cm) at T ≥ 155 °C.

  13. Rapid sonochemical preparation of shape-selective lead iodide

    International Nuclear Information System (INIS)

    Huang, Baojun; He, Qin; Fa, Wenjun; Li, Pinjiang; Zhang, Yange; Zheng, Zhi

    2012-01-01

    Graphical abstract: SEM morphologies of various PbI2 products obtained with the iodine concentration of 6.7 g/L and irradiation time of 1 minute at the reaction temperatures of 35 °C (a), 25 °C (b), and 15 °C (c). Highlights: ► PbI 2 with various morphologies were rapidly formed at room temperature. ► We could well control the morphologies of PbI 2 by changing reaction conditions. ► The PbI 2 films could better resist rolling in a liquid media. -- Abstract: Lead iodide (PbI 2 ) films/crystals with various nano/micro morphologies (e.g., Nanoflake, block and microrod) were rapidly synthesized by taking advantage of a simple sonochemical method. The PbI 2 crystals with uniform nanoflake structures could be fabricated directly on lead foils with the irradiation time as short as 36 s via interfacial reaction between lead foils and elemental iodine in ethanol at ambient temperature. It was found experimentally that the morphologies of the resulting thin films/crystals could be well controlled by the adjustment of several parameters including irradiation time, reaction solvents, iodine concentration, ultrasonic power, and reaction temperature. Most importantly, the resultant PbI 2 films are stable enough to resist rolling under the drastic ultrasound irradiation in a liquid media. This method is believed to be the fastest way for in situ fabrication of morphology-controlled semiconductor films on various metal substrates for subsequent applications related to the other metal iodide or metal sulfide semiconductor films.

  14. Spectral characteristics of europium-doped lead iodide

    International Nuclear Information System (INIS)

    Novosad, I.S.; Novosad, S.S.

    2013-01-01

    Optical absorption and x-ray luminescence spectra and thermally stimulated luminescence curves of a PbI 2 :EuCl 3 crystal grown by the Stockbarger method were investigated in the temperature range 85-295 K. It was presumed based on results of EPR spectral studies that the europium ions in this material existed in the divalent state and replaced matrix cations. An intense broad non-elementary band at 780 nm in addition to a weak band with a maximum in the range 512-520 nm were observed in the PbI 2 :Eu 2+ x-ray luminescence spectrum at 85 K. The intensity of the long-wavelength emission increased slightly upon increasing the crystal temperature from 85 to 130 K and was quenched in several stages upon increasing the temperature further to 220 K. The maximum shifted to 740 nm. It was proposed based on an analysis of the obtained data and results of a study of the luminescence properties of PbI 2 and PbI 2 :Mn 2+ crystals that the non-elementary emission band of the PbI 2 :Eu 2+ crystal at 780 nm could be represented as a superposition of three individual Gaussian bands with maxima near 715, 740, and 800 nm that were due to centers characteristic of the matrix and additional centers that were formed by Eu ions through association with intrinsic and dopant oxygen-containing defects, respectively. Doping PbI 2 with Eu 2+ ions did not affect the spectrum of matrix trapping levels. The nature of emission and trapping centers and luminescence excitation mechanisms of PbI 2 :Eu 2+ were discussed. (authors)

  15. Efficacy of single-stage breast-conserving treatment using multicatheter partial breast brachytherapy evaluated by GEC-ESTRO phase 3 trial.

    Science.gov (United States)

    Sato, Kazuhiko; Fuchikami, Hiromi; Kato, Masahiro; Shimo, Takahiro; Kubota, Jun; Takeda, Naoko; Inoue, Yuko; Seto, Hiroshi; Okawa, Tomohiko

    2017-10-01

    The GEC-ESTRO has reported the equivalent outcomes of partial breast irradiation (PBI) using multicatheter interstitial brachytherapy (MCB) to whole breast irradiation (WBI) in breast-conserving therapy (BCT). We performed single-stage BCT with partial breast brachytherapy by intraoperative catheter placement. After the categorization of patients into inclusion and exclusion criteria on this trial, our databases were evaluated in order to translate it to Japanese patients. Patients undergoing BCT were retrospectively examined between November 2007 and December 2015. The technique is an open-cavity implant with a dose of 32 Gy in 8 fractions. The 4-year clinical outcomes of MCB-PBI were evaluated in the 2 distinct categories, and the comparison of the outcomes of MCB-PBI with WBI was performed in patients with unfavorable features. Of a total of 501 lesions undergoing BCT, 301 lesions were treated with MCB-PBI and 200 lesions with WBI. At the median follow-up time of 52 months, the 4-year rate of ipsilateral breast tumor recurrence (IBTR)-free, disease-free (DFS), and overall survival (OS) in patients with MCB-PBI and WBI were 98.9% vs. 98.0% ( p = 0.56), 97.0% vs. 95.3% ( p = 0.78), and 99.6% vs. 98.2% ( p = 0.38), respectively. Although in exclusion cohort treated with MCB-PBI, IBTR-free, and disease-free survival were significantly worse than in inclusion cohort, non-significantly worse outcomes was demonstrated than in exclusion cohort with WBI; IBTR-free survival (95.0% vs. 97.2%, p = 0.24), and disease-free survival (95.0% vs. 95.8%, p = 0.31). Single-stage BCT using MCB-PBI offered similar tumor control rates compering to WBI. However, further research is needed to define the benefit for patients with an exclusion criteria.

  16. Patients' perspectives on urethral bulk injection therapy and mid-urethral sling surgery for stress urinary incontinence.

    Science.gov (United States)

    Casteleijn, Fenne M; Zwolsman, Sandra E; Kowalik, Claudia R; Roovers, Jan-Paul P W R

    2018-04-19

    The aim of this study was to identify all treatment decision factors that determined the preference for peri-urethral bulk injection therapy (PBI) or mid-urethral sling (MUS) surgery in patients with primary stress urinary incontinence (SUI). Second, we explored what patients expect from treatment for SUI and whether patients would consider PBI as a primary treatment option. In a qualitative design, 20 semi-structured, face-to-face interviews were conducted in women with primary SUI. Exclusion criteria were: previous PBI or MUS surgery; predominating urgency. Interviews were guided by three open-ended questions and a topic list. PBI treatment and MUS surgery were described in detail, and the efficacy was stated as 70% and 90%, respectively. Data saturation was reached when no new treatment decision factors were identified in three consecutive interviews. Interviews were audiotaped and fully transcribed. Thematic analysis by a coding process was done independently by two researchers. Sixteen procedural, personal, professional, social and external treatment decision factors were identified. Regarding expectations about treatment for SUI, women believed 'becoming dry' was wishful thinking. The majority of patients accepted a small degree of persistent urinary incontinence after treatment. Regardless of their treatment preference, patients indicated that women should be informed about PBI as a primary treatment option. Patients with primary SUI are open to PBI as an alternative treatment option even with lower cure rates compared with MUS surgery performed under general or spinal anesthesia. Patients indicated that women with primary SUI seeking treatment should be informed about PBI as a treatment option.

  17. Parental bonding and vulnerability to adolescent suicide.

    Science.gov (United States)

    Martin, G; Waite, S

    1994-04-01

    Part of a series of studies into early detection in adolescent suicide, this study investigated relationships between parenting style and suicidal thoughts, acts and depression. Students (mean age 15 years) from 4 randomly chosen high schools completed self-report questionnaires containing the Parental Bonding Instrument (PBI) and the Youth Self Report, which provided information about suicide ideation, deliberate self-harm and depression. Significant differences for mean scores on the PBI subscales were noted between cases and noncases of depression, suicidal thoughts and deliberate self-harm. Assignment by adolescents of their parents to the "affectionless control" quadrant of the PBI doubles the relative risk for suicidal thoughts, increases the relative risk for deliberate self-harm 3-fold and increases the relative risk for depression 5-fold. It seems that the PBI may play a role in identification of vulnerable adolescents; further, it both elucidates aspects of adolescent-parent interaction and points toward areas for intervention with at-risk adolescents. We recommend the use of the PBI in early detection studies of adolescent suicide.

  18. Abnormal eating attitudes and behaviours and perceived parental control: a study of white British and British-Asian school girls.

    Science.gov (United States)

    Furnham, A; Adam-Saib, S

    2001-09-01

    Previous studies have found significantly higher scores on the Eating Attitudes Test (EAT-26) which measures eating disorders among second-generation British-Asian schoolgirls in comparison to their White counterparts. Further, high EAT-26 scores (an indication of unhealthy eating attitudes and behaviours) are positively associated with parental overprotection scores on the Parental Bonding Instrument (PBI). This study aimed to replicate and extend previous findings, comparing British-Asian schoolgirls to White schoolgirls and consider 'intra-Asian' differences on the same measures, including factor scores. Participants completed three questionnaires: EAT-26, PBI and BSS (Body Satisfaction Scale). There were 168 participants: 46 White, 40 Indian, 44 Pakistani and 38 Bengali. Previous findings were supported; the Asian scores were significantly higher than the White scores on the EAT-26 and PBI, but not the BSS. The Bengali sample had significantly higher EAT-26 total and 'oral control' scores than the other groups. There were no intra-Asian differences for the overprotection scores. PBI scores were not associated with EAT-26 scores. The BSS score was the only significant predictor of EAT scores, when entered into a regression along with PBI scores and the body mass index. Results demonstrated sociocultural factors in the development of eating disorders. The results suggest that there are important psychological differences between second-generation migrants from different countries on the Indian subcontinent. In line with previous studies, significant differences were found between the four ethnic groups, parenting styles, but these did not relate to actual eating disorders.

  19. Enhanced photovoltaic performance of CH3NH3PbBrXI3-X-based perovskite solar cells via anti-solvent extraction

    Science.gov (United States)

    Jiang, Zhaoyi; Zhang, Weijia; Lu, Chaoqun; Ma, Denghao; Liu, Haixu; Yu, Wei; Zhang, Yu; Ma, Qiang; Zhang, Yulong

    2018-06-01

    In this paper, the two-step sequential deposition method was used to prepare the CH3NH3PbBrXI3-X films by introducing CH3NH3Br in the precursors. The surface morphology of the PbI2 films was controlled by anti-solvent extraction (ASE) to improve the microstructure and photo-physical properties of the perovskite films. It was noteworthy that, compared to the compact PbI2 films, the porous PbI2 films facilitated the growth of crystals and bromine incorporation in films, and the prepared perovskite films exhibited enlarged grain size, increased light absorption, enhanced Br incorporation and prolonged carrier lifetime, which resulted in excellent photo-electrical properties of the CH3NH3PbBrXI3-X films. With porous PbI2 templates, the inverted planar perovskite solar cells based on films with appropriate Br incorporation (CH3NH3Br/CH3NH3I mole ratio = 3/7) showed a photovoltaic conversion efficiency (PCE) of 14.9%, and the stability of the devices in air was elevated. Consequently, the high-quality CH3NH3PbBrXI3-X films can be obtained with porous PbI2 templates for improving the performance of the perovskite solar cells.

  20. Psychometric Validation of the Parental Bonding Instrument in a U.K. Population-Based Sample: Role of Gender and Association With Mental Health in Mid-Late Life.

    Science.gov (United States)

    Xu, Man K; Morin, Alexandre J S; Marsh, Herbert W; Richards, Marcus; Jones, Peter B

    2016-08-01

    The factorial structure of the Parental Bonding Instrument (PBI) has been frequently studied in diverse samples but no study has examined its psychometric properties from large, population-based samples. In particular, important questions have not been addressed such as the measurement invariance properties across parental and offspring gender. We evaluated the PBI based on responses from a large, representative population-based sample, using an exploratory structural equation modeling method appropriate for categorical data. Analysis revealed a three-factor structure representing "care," "overprotection," and "autonomy" parenting styles. In terms of psychometric measurement validity, our results supported the complete invariance of the PBI ratings across sons and daughters for their mothers and fathers. The PBI ratings were also robust in relation to personality and mental health status. In terms of predictive value, paternal care showed a protective effect on mental health at age 43 in sons. The PBI is a sound instrument for capturing perceived parenting styles, and is predictive of mental health in middle adulthood. © The Author(s) 2016.

  1. Effects of Different Solvents on the Planar Hetero-junction Perovskite Solar Cells

    Directory of Open Access Journals (Sweden)

    Lin Shunquan

    2015-01-01

    Full Text Available The perovskite (CH3NH3PbI3 films on the planar hetero-junction perovskite solar cells (PHJ-PSCs are fabricated by “two-steps” process with the wet spin-coating method. The precursor (PbI2 solutions are compounded with 4 types of solvents: N-Methyl Pyrrolidone (NMP, γ-butyrolactone (GBL, Dimethyl Sulfoxide (DMSO and N, N-dimethylformamide (DMF. All the solutions have the same concentration. The influences of different precursor solvents to the micro-structures of CH3NH3PbI3 films and device performance are studied. Atomic force microscopy (AFM and scanning electron microscope (SEM are used to characterize the CH3NH3PbI3 films. The results indicate that the CH3NH3PbI3 film using DMF solvent possesses more rough morphology and thickest thickness. The monolithic PHJ-PSCs devices based on DMF solvent are tested under a standard one sun of simulated solar irradiation (AM1.5. The results show that the open-circuit voltage (Voc reaches 872mV, the short-circuit current (Jsc reaches 9.35mA/cm2, the filling factor(FF is 0.62 and the photo-current conversion efficiency (PCE is 5.05%. DMF is the best one among these 4 types of solvents for PHJ-PSCs.

  2. Light-trapping in perovskite solar cells

    Directory of Open Access Journals (Sweden)

    Qing Guo Du

    2016-06-01

    Full Text Available We numerically demonstrate enhanced light harvesting efficiency in both CH3NH3PbI3 and CH(NH22PbI3-based perovskite solar cells using inverted vertical-cone photonic-crystal nanostructures. For CH3NH3PbI3 perovskite solar cells, the maximum achievable photocurrent density (MAPD reaches 25.1 mA/cm2, corresponding to 92% of the total available photocurrent in the absorption range of 300 nm to 800 nm. Our cell shows 6% absorption enhancement compared to the Lambertian limit (23.7 mA/cm2 and has a projected power conversion efficiency of 12.9%. Excellent solar absorption is numerically demonstrated over a broad angular range from 0 to 60 degree for both S- and P- polarizations. For the corresponding CH(NH22PbI3 based perovskite solar cell, with absorption range of 300 nm to 850 nm, we find a MAPD of 29.1 mA/cm2, corresponding to 95.4% of the total available photocurrent. The projected power conversion efficiency of the CH(NH22PbI3 based photonic crystal solar cell is 23.4%, well above the current world record efficiency of 20.1%.

  3. Neuroimaging in adult penetrating brain injury: a guide for radiographers

    Energy Technology Data Exchange (ETDEWEB)

    Temple, Nikki; Donald, Cortny; Skora, Amanda [Discipline of Medical Radiation Sciences, The University of Sydney, Lidcombe, New South Wales (Australia); Reed, Warren, E-mail: warren.reed@sydney.edu.au [Medical Image Optimisation and Perception Group, Discipline of Medical Radiation Sciences, The University of Sydney, Lidcombe, New South Wales (Australia)

    2015-06-15

    Penetrating brain injuries (PBI) are a medical emergency, often resulting in complex damage and high mortality rates. Neuroimaging is essential to evaluate the location and extent of injuries, and to manage them accordingly. Currently, a myriad of imaging modalities are included in the diagnostic workup for adult PBI, including skull radiography, computed tomography (CT), magnetic resonance imaging (MRI) and angiography, with each modality providing their own particular benefits. This literature review explores the current modalities available for investigating PBI and aims to assist in decision making for the appropriate use of diagnostic imaging when presented with an adult PBI. Based on the current literature, the authors have developed an imaging pathway for adult penetrating brain injury that functions as both a learning tool and reference guide for radiographers and other health professionals. Currently, CT is recommended as the imaging modality of choice for the initial assessment of PBI patients, while MRI is important in the sub-acute setting where it aids prognosis prediction and rehabilitation planning, Additional follow-up imaging, such as angiography, should be dependent upon clinical findings.

  4. A novel amperometric sensor for peracetic acid based on a polybenzimidazole-modified gold electrode

    Energy Technology Data Exchange (ETDEWEB)

    Hua, Mu-Yi, E-mail: huamy@mail.cgu.edu.t [Green Research Center, Department of Chemical and Materials Engineering, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China); Biosensor Group, Biomedical Engineering Research Center, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China); Chen, Hsiao-Chien [Green Research Center, Department of Chemical and Materials Engineering, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China); Biosensor Group, Biomedical Engineering Research Center, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China); Tsai, Rung-Ywan [Electronics and Optoelectronics Research Laboratories, Industrial Technology Research Institute, 195, Sec. 4, Chung Hsing Rd., Hsinchu 31040, Taiwan (China); Lin, Yu-Chen [Green Research Center, Department of Chemical and Materials Engineering, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China); Biosensor Group, Biomedical Engineering Research Center, Chang Gung University, 259 Wen-Hwa 1st Rd., Kuei-Shan, Tao-Yuan 33302, Taiwan (China)

    2011-04-30

    We have developed a peracetic acid (PAA) sensor based on a polybenzimidazole-modified gold (PBI/Au) electrode. Fourier transform infrared and X-ray photoelectron spectroscopy indicated that PAA oxidized 69.4% of the imine in PBI to form PBI N-oxide, increasing the electrochemical reduction current during cyclic voltammetry. The chemical oxidation of the PBI/Au electrode by PAA, followed by its electrochemical reduction, allowed PAA to be detected directly and consecutively by assessing its reduction current. The PAA sensor had a broad linear detection range (3.1 {mu}M-1.5 mM) and a rapid response time (3.9 s) at an applied potential of -0.3 V. Potentially interfering substances, such as hydrogen peroxide, acetic acid, and oxygen, had no effect on the ability of the probe to detect PAA, indicating high selectivity of the probe. Furthermore, the detection range, response time, and sensitivity of the sensor could all be improved by modification of the smooth planar electrode surface to a porous three-dimensional configuration. When compared to the analytical characteristics of other PAA sensors operating under optimal conditions, the three-dimensional PBI/Au electrode offers a rapid detection time, a usable linear range, and a relatively low detection limit.

  5. A novel amperometric sensor for peracetic acid based on a polybenzimidazole-modified gold electrode

    International Nuclear Information System (INIS)

    Hua, Mu-Yi; Chen, Hsiao-Chien; Tsai, Rung-Ywan; Lin, Yu-Chen

    2011-01-01

    We have developed a peracetic acid (PAA) sensor based on a polybenzimidazole-modified gold (PBI/Au) electrode. Fourier transform infrared and X-ray photoelectron spectroscopy indicated that PAA oxidized 69.4% of the imine in PBI to form PBI N-oxide, increasing the electrochemical reduction current during cyclic voltammetry. The chemical oxidation of the PBI/Au electrode by PAA, followed by its electrochemical reduction, allowed PAA to be detected directly and consecutively by assessing its reduction current. The PAA sensor had a broad linear detection range (3.1 μM-1.5 mM) and a rapid response time (3.9 s) at an applied potential of -0.3 V. Potentially interfering substances, such as hydrogen peroxide, acetic acid, and oxygen, had no effect on the ability of the probe to detect PAA, indicating high selectivity of the probe. Furthermore, the detection range, response time, and sensitivity of the sensor could all be improved by modification of the smooth planar electrode surface to a porous three-dimensional configuration. When compared to the analytical characteristics of other PAA sensors operating under optimal conditions, the three-dimensional PBI/Au electrode offers a rapid detection time, a usable linear range, and a relatively low detection limit.

  6. Validity of the Parental Burnout Inventory Among Dutch Employees.

    Science.gov (United States)

    Van Bakel, Hedwig J A; Van Engen, Marloes L; Peters, Pascale

    2018-01-01

    The purpose of this study was to validate the Parental Burnout Inventory (PBI) in a Dutch sample of working parents. The Dutch version of the PBI and questionnaires about work were administered to 627 working parents, with at least one child living at home. We investigated whether the tri-dimensional structure of the PBI held in a sample of male and female employed parents. Furthermore, we examined the relationships between PBI and the constructs work-related burnout, depressive mood, parenting stress and work-family conflict, which we assessed with widely used and validated instruments, i.e., emotional exhaustion [a subscale of the Dutch version of Maslach's Burnout Inventory], a Dutch Parental Stress Questionnaire and Work-Family Conflict. The results support the validity of a tri-dimensional parental burnout syndrome, including exhaustion, distancing and inefficacy. Low to moderate correlations between parents' burnout symptoms and professional exhaustion, parenting stress, depressive complaints and work-family conflict experiences were found, suggesting that the concept of PBI differs significantly from the concepts of job burnout, depression and stress, respectively. The current study confirms that some parents are extremely exhausted by their parental role. However, the number of Dutch employees reporting extreme parental burnout is rather low.

  7. Neuroimaging in adult penetrating brain injury: a guide for radiographers

    International Nuclear Information System (INIS)

    Temple, Nikki; Donald, Cortny; Skora, Amanda; Reed, Warren

    2015-01-01

    Penetrating brain injuries (PBI) are a medical emergency, often resulting in complex damage and high mortality rates. Neuroimaging is essential to evaluate the location and extent of injuries, and to manage them accordingly. Currently, a myriad of imaging modalities are included in the diagnostic workup for adult PBI, including skull radiography, computed tomography (CT), magnetic resonance imaging (MRI) and angiography, with each modality providing their own particular benefits. This literature review explores the current modalities available for investigating PBI and aims to assist in decision making for the appropriate use of diagnostic imaging when presented with an adult PBI. Based on the current literature, the authors have developed an imaging pathway for adult penetrating brain injury that functions as both a learning tool and reference guide for radiographers and other health professionals. Currently, CT is recommended as the imaging modality of choice for the initial assessment of PBI patients, while MRI is important in the sub-acute setting where it aids prognosis prediction and rehabilitation planning, Additional follow-up imaging, such as angiography, should be dependent upon clinical findings

  8. Optical diagnostics of lead and PbGa2S4 layered crystal laser plasmas

    International Nuclear Information System (INIS)

    Shuaibov, A.K.; Dashchenko, A.I.; Shevera, I.V.

    2001-01-01

    Laser plasmas produced at the surfaces of lead and a PbGa 2 S 4 layered crystal irradiated by a neodymium laser with λ = 1.06 μm, pulse duration τ = 20 ns, and intensity W = (1-2) x 10 9 W/cm 2 are studied using optical diagnostics. It is shown that, in a lead plasma, the most intense (characteristic) lines are the PbI 405.7-nm, PbI 368.3-nm, PbI 364-nm, and PbII 220.4-nm lines. In a layered crystal plasma, the emission spectrum is an aggregation of the most intense PbI and GaI lines, whereas sulfur lines are absent. The bottlenecks of the recombination of the ionic and atomic components of the lead and PbGa 2 S 4 crystal plasmas are determined. The average propagation velocity of the lead laser plume is 18-20 km/s. A comparative analysis of the emission dynamics of PbI and GaI lines in the laser plasmas of these metals and in the plasma of a PbGa 2 S 4 crystal is carried out. The results obtained are important for the optical diagnostics of the plasmas of lead- and gallium-containing crystals and for the optimization of laser deposition of the thin films of these substances

  9. Thermal stability and molecular ordering of organic semiconductor monolayers: effect of an anchor group.

    Science.gov (United States)

    Jones, Andrew O F; Knauer, Philipp; Resel, Roland; Ringk, Andreas; Strohriegl, Peter; Werzer, Oliver; Sferrazza, Michele

    2015-06-08

    The thermal stability and molecular order in monolayers of two organic semiconductors, PBI-PA and PBI-alkyl, based on perylene derivatives with an identical molecular structure except for an anchor group for attachment to the substrate in PBI-PA, are reported. In situ X-ray reflectivity measurements are used to follow the stability of these monolayers in terms of order and thickness as temperature is increased. Films have thicknesses corresponding approximately to the length of one molecule; molecules stand upright on the substrate with a defined structure. PBI-PA monolayers have a high degree of order at room temperature and a stable film exists up to 250 °C, but decomposes rapidly above 300 °C. In contrast, stable physisorbed PBI-alkyl monolayers only exist up to 100 °C. Above the bulk melting point at 200 °C no more order exists. The results encourage using anchor groups in monolayers for various applications as it allows enhanced stability at the interface with the substrate. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Development and application of a general plasmid reference material for GMO screening.

    Science.gov (United States)

    Wu, Yuhua; Li, Jun; Wang, Yulei; Li, Xiaofei; Li, Yunjing; Zhu, Li; Li, Jun; Wu, Gang

    The use of analytical controls is essential when performing GMO detection through screening tests. Additionally, the presence of taxon-specific sequences is analyzed mostly for quality control during GMO detection. In this study, 11 commonly used genetic elements involving three promoters (P-35S, P-FMV35S and P-NOS), four marker genes (Bar, NPTII, HPT and Pmi), and four terminators (T-NOS, T-35S, T-g7 and T-e9), together with the reference gene fragments from six major crops of maize, soybean, rapeseed, rice, cotton and wheat, were co-integrated into the same single plasmid to construct a general reference plasmid pBI121-Screening. The suitability test of pBI121-Screening plasmid as reference material indicated that the non-target sequence on the pBI121-Screening plasmid did not affect the PCR amplification efficiencies of screening methods and taxon-specific methods. The sensitivity of screening and taxon-specific assays ranged from 5 to 10 copies of pBI121-Screening plasmid, meeting the sensitivity requirement of GMO detection. The construction of pBI121-Screening solves the lack of a general positive control for screening tests, thereby reducing the workload and cost of preparing a plurality of the positive control. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Validity of the Parental Burnout Inventory Among Dutch Employees

    Directory of Open Access Journals (Sweden)

    Hedwig J. A. Van Bakel

    2018-05-01

    Full Text Available The purpose of this study was to validate the Parental Burnout Inventory (PBI in a Dutch sample of working parents. The Dutch version of the PBI and questionnaires about work were administered to 627 working parents, with at least one child living at home. We investigated whether the tri-dimensional structure of the PBI held in a sample of male and female employed parents. Furthermore, we examined the relationships between PBI and the constructs work-related burnout, depressive mood, parenting stress and work-family conflict, which we assessed with widely used and validated instruments, i.e., emotional exhaustion [a subscale of the Dutch version of Maslach’s Burnout Inventory], a Dutch Parental Stress Questionnaire and Work-Family Conflict. The results support the validity of a tri-dimensional parental burnout syndrome, including exhaustion, distancing and inefficacy. Low to moderate correlations between parents’ burnout symptoms and professional exhaustion, parenting stress, depressive complaints and work-family conflict experiences were found, suggesting that the concept of PBI differs significantly from the concepts of job burnout, depression and stress, respectively. The current study confirms that some parents are extremely exhausted by their parental role. However, the number of Dutch employees reporting extreme parental burnout is rather low.

  12. Possible route to d0 magnetism in α-PbO compound

    Science.gov (United States)

    Berashevich, J.; Reznik, A.

    2014-10-01

    Using first principles methods, we investigated the possibility of inducing d0 magnetism in α-PbO. The Pbi interstitial defect was found to acquire magnetic properties after its incorporation into the α-PbO crystal structure. The Pbi interstitial defect generates a p localized state with two electrons on-site, the spin alignment of which is governed by Hund's rule, thereby leading to the formation of the local magnetic moment 2μB. The magnetic coupling between defects is a function of the occupancy of the defect states. For two defects in their zero charge state Pbi(0), the antiferromagnetic coupling is more stable. The Pb interstitial defects in the charge state Pbi(1 +) already have the ferromagnetic ground state. The magnetic coupling was found to be driven by long-range order interactions. The critical limit on the defect concentration required to establish magnetic percolation above room temperature is about 1020 cm-3, which may be possible when Pbi defects are formed on the surface of a single crystal. The substitution of the Pb interstitial defect with the non-magnetic elements of the s2px outer shell (the local magnetic moment is defined by 1 ≤ x ≤ 3) was found to be a potential means for tuning the magnetic behavior.

  13. Numerical simulation and experimental validation of inverted planar perovskite solar cells based on NiOx hole transport layer

    Science.gov (United States)

    Wei, Xiaoqing; Wang, Xian; Jiang, Hailong; Huang, Yongliang; Han, Anjun; Gao, Qi; Bian, Jiantao; Liu, Zhengxin

    2017-12-01

    Numerical simulation of inverted planar perovskite solar cells based on NiOx hole transport layer was performed with AMPS-1D program. The simulated device parameters were shown to agree well with our experimental work. The simulated results revealed that the device contained typical p-i-n junction configuration. The optimum thickness of the absorber, the effects of the absorber quality, the defect density of interfaces, the effects of VBO and CBO, the interface contact at front and back electrodes were analyzed. Open-circuit voltage mainly depended on the defect density in CH3NH3PbI3 layer, the recombination at HTL/CH3NH3PbI3 and ETL/CH3NH3PbI3 interface, the values of VBO and CBO, while short-circuit current mainly depended on the thickness of CH3NH3PbI3 layer. Fill factor was significantly influenced by the interface contact at front and back electrodes. Remarkably, a power conversion efficiency of 21.8% is obtained under optimised conditions. Real devices with PCE of up to 15% were obtained by initially optimizing the preparation of CH3NH3PbI3 absorber layer. Our work can provide some important guidance for device design and optimization from the considerations of both theory and experiment.

  14. A polymer electrolyte membrane for high temperature fuel cells to fit vehicle applications

    International Nuclear Information System (INIS)

    Li Mingqiang; Scott, Keith

    2010-01-01

    Poly(tetrafluoroethylene) PTFE/PBI composite membranes doped with H 3 PO 4 were fabricated to improve the performance of high temperature polymer electrolyte membrane fuel cells (HT-PEMFC). The composite membranes were fabricated by immobilising polybenzimidazole (PBI) solution into a hydrophobic porous PTFE membrane. The mechanical strength of the membrane was good exhibiting a maximum load of 35.19 MPa. After doping with the phosphoric acid, the composite membrane had a larger proton conductivity than that of PBI doped with phosphoric acid. The PTFE/PBI membrane conductivity was greater than 0.3 S cm -1 at a relative humidity 8.4% and temperature of 180 deg. C with a 300% H 3 PO 4 doping level. Use of the membrane in a fuel cell with oxygen, at 1 bar overpressure gave a peak power density of 1.2 W cm -2 at cell voltages >0.4 V and current densities of 3.0 A cm -2 . The PTFE/PBI/H 3 PO 4 composite membrane did not exhibit significant degradation after 50 h of intermittent operation at 150 deg. C. These results indicate that the composite membrane is a promising material for vehicles driven by high temperature PEMFCs.

  15. Dosimetric investigation depending on tumor location in patient breast in partial breast irradiation

    International Nuclear Information System (INIS)

    Kim, Min Joo; Park, So Hyun; Jung, Joo Young; Woong, Cho; Suh, Tae Suk

    2012-01-01

    The Partial Breast Irradiation (PBI) technique, which involves radiation beam delivery techniques that use a limited range of treatment volumes, has been a challenging approach that is worthy of consideration compared to whole-breast radiation therapy (WBRT). Because of a small target volumes used in the PBI technique, the radiation dose can be safely delivered to the targeted tissue without the unwanted delivery of radiation to normal breast tissues and organ at risk (OAR), such as contralateral breast, lung and heart.Through PBI technique, better cosmetic outcomes and minimizing damages to OARs could be expected and also the daily dose can be increased with smaller number of fractionation in radiation therapy. The purpose of this study was to evaluate the dosimetric effects according to tumor locations in patient's breast for Partial Breast Irradiation (PBI) technique using three Dimensional Conformal Radiation Therapy (3DCRT), Electron Beam Radiation therapy (EBRT) and Helical-tomotherapy (H-TOMO). Dosimetric comparisons of PBI technique for 3DCRT, EBRT, and H-TOMO depending on the classified tumor locations were performed. H-TOMO delivered the low dose to lager volume to surrounding normal tissue, such as the heart and lungs compared to 3DCRT and EBRT although it had the same degree of target coverage as the other methods (3DCRT, EBRT). EBRT had a curative effect for early-stage breast cancers located in the lower and inner sections (LIQ-S, LIQ-D)

  16. Perioperative Care for Pediatric Patients With Penetrating Brain Injury: A Review.

    Science.gov (United States)

    Mikhael, Marco; Frost, Elizabeth; Cristancho, Maria

    2017-05-19

    Traumatic brain injury (TBI) continues to be the leading cause of death and acquired disability in young children and adolescents, due to blunt or penetrating trauma, the latter being less common but more lethal. Penetrating brain injury (PBI) has not been studied extensively, mainly reported as case reports or case series, due to the assumption that both types of brain injury have common pathophysiology and consequently common management. However, recommendations and guidelines for the management of PBI differ from those of blunt TBI in regards to neuroimaging, intracranial pressure (ICP) monitoring, and surgical management including those pertaining to vascular injury. PBI was one of the exclusion criteria in the second edition of guidelines for the acute medical management of severe TBI in infants, children, and adolescents that was published in 2012 (it is referred to as "pediatric guidelines" in this review). Many reviews of TBI do not differentiate between the mechanisms of injury. We present an overview of PBI, its presenting features, epidemiology, and causes as well as an analysis of case series and the conclusions that may be drawn from those and other studies. More clinical trials specific to penetrating head injuries in children, focusing mainly on pathophysiology and management, are needed. The term PBI is specific to penetrating injury only, whereas TBI, a more inclusive term, describes mainly, but not only, blunt injury.

  17. Thermodynamic origin of instability in hybrid halide perovskites

    Science.gov (United States)

    Tenuta, E.; Zheng, C.; Rubel, O.

    2016-11-01

    Degradation of hybrid halide perovskites under the influence of environmental factors impairs future prospects of using these materials as absorbers in solar cells. First principle calculations can be used as a guideline in search of new materials, provided we can rely on their predictive capabilities. We show that the instability of perovskites can be captured using ab initio total energy calculations for reactants and products augmented with additional thermodynamic data to account for finite temperature effects. Calculations suggest that the instability of CH3NH3PbI3 in moist environment is linked to the aqueous solubility of the CH3NH3I salt, thus making other perovskite materials with soluble decomposition products prone to degradation. Properties of NH3OHPbI3, NH3NH2PbI3, PH4PbI3, SbH4PbI3, CsPbBr3, and a new hypothetical SF3PbI3 perovskite are studied in the search for alternative solar cell absorber materials with enhanced chemical stability.

  18. Energy level alignment at the methylammonium lead iodide/copper phthalocyanine interface

    Directory of Open Access Journals (Sweden)

    Shi Chen

    2014-08-01

    Full Text Available The energy level alignment at the CH3NH3PbI3/copper phthalocyanine (CuPc interface is investigated by X-ray photoelectron spectroscopy (XPS and ultraviolet photoelectron spectroscopy (UPS. XPS reveal a 0.3 eV downward band bending in the CuPc film. UPS validate this finding and further reveal negligible interfacial dipole formation – verifying the viability of vacuum level alignment. The highest occupied molecular orbital of CuPc is found to be closer to the Fermi level than the valance band maximum of CH3NH3PbI3, facilitating hole transfer from CH3NH3PbI3 to CuPc. However, subsequent hole extraction from CuPc may be impeded by the downward band bending in the CuPc layer.

  19. The stability of poly(2,2′-(m-phenylene)-5,5′-bibenzimidazole) membranes in aqueous potassium hydroxide

    DEFF Research Database (Denmark)

    Aili, David; Jankova Atanasova, Katja; Li, Qingfeng

    2015-01-01

    25wt%. This work is devoted to a comprehensive stability study of mPBI in aqueous KOH of different concentrations for up to 200 days under conditions relevant for electrochemical energy conversion technologies. The polymer membranes were kept at 88°C in aqueous KOH with concentrations ranging from 0...... to 50wt%, and the chemical and physicochemical changes were monitored. The degradation was connected to the hydrolysis of the polymer backbone and the degradation rate increased with increasing KOH concentration. In the lower concentration range mPBI proved to be stable but exhibited low ionic...... conductivity (10−4Scm−1). The preparation of a porous mPBI matrix was demonstrated as an effective approach to increase the ionic conductivity in the lower KOH concentration range, with great potential for further improvement through optimization of the porous structure....

  20. Optical diagnostics of lead and PbGa2S4 layered crystal laser plasmas

    International Nuclear Information System (INIS)

    Shuaibov, A.K.; Dashchenko, A.I.; Shevera, I.V.

    2001-01-01

    Paper presents the results of the optic diagnostics of plasma of laser flames formed from lead surface and PbGa 2 S 4 laminar crystal using a neodymium laser. It is shown that the most intensive lines in the lead laser plasma are as follows: 405.7, 368.3, 364.0 nm PbI and 220.4 nm PbII while for the laminar crystal base plasma - the combination of the most intensive lines of PbI and GaI emission. One determined the narrow point of recombination fluxes for the ion and the atomic components of laser plasma of lead and of PbGa 2 S 4 crystal. One conducted comparison study of emission dynamics of PbI and GaI lines in laser plasma of the respective metals and of PbGa 2 S 4 crystal [ru

  1. Infraorbital nerve block within the Pterygopalatine fossa of the horse: anatomical landmarks defined by computed tomography

    International Nuclear Information System (INIS)

    Carsten, S.; Hagen, G.

    2008-01-01

    In order to provide anaesthesia of the equine maxillary cheek teeth, a local nerve block of the infraorbital nerve in the pterygopalatine fossa had been proposed, which is referred to as the 'Palatine Bone Insertion' (PBI). As several complications with this method were reported, our study was designed to recommend a modified injection technique which avoids the risk of puncturing of relevant anatomical structures. Five cadaver heads and two living horses were examined by contrast medium injections and subsequent computed tomography (CT). Spinal needles were inserted using two different insertion techniques: The above mentioned (PBI), and a modification called 'Extraperiorbital Fat Body Insertion' (EFBI). Both techniques (PBI and EFBI) provide a consistent distribution of contrast medium around the infraorbital nerve. However, only the EFBI technique is appropriate to minimize the risk of complications. This study is an example for the permanent challenge of anatomists to supply a basis for clinical and surgical procedures

  2. Physical punishment and signs of mental distress in normal adolescents.

    Science.gov (United States)

    Bachar, E; Canetti, L; Bonne, O; DeNour, A K; Shalev, A Y

    1997-01-01

    Adolescents (375 males and 496 females) were administered the Brief Symptom Inventory (BSI), the General Well-Being Scale (GWB), the Parental Bonding Instrument (PBI), and two questions about each parent, supplementing the PBI, tapping violent punitive behavior. Signs of mental distress in adolescents and reported physical punishment from parents were analyzed. Results indicated that greater physical punishment was associated with higher levels of psychiatric symptoms and lower general well-being. These results persisted after controlling for parental attitudes, as quantified by the PBI, and socioeconomic status. The findings of this study can contribute to efforts to raise public awareness of the negative consequences of physical punishment on the mental health of children.

  3. Method for solidification of radioactive iodine-containing solid wastes

    International Nuclear Information System (INIS)

    Ozawa, Yoshihiro; Funabashi, Kiyomi; Uetake, Naoto.

    1987-01-01

    Purpose: To process radioactive iodine containing solid wastes as non-leaching solidified wastes with no risk of iodine release. Method: It has been known for the thermal stability of CuI, PbI 2 or adsorbents containing the same that they do not release iodine in an inert gas atmosphere or in a reducing atmosphere at a temperature lower than 480 deg C. In view of the above, adsorbents containing iodine in the chemical form of CuI or PbI 2 , or CuI or powdery PbI 2 per se are sealed and solidified into low melting glass at a temperature of lower than 480 deg C at which no iodine release occurs in a non-oxidative atmosphere. Since the products are vitrified wastes, they scarcely show leaching property and are excellent in durability and stability. (Takahashi, M.)

  4. Low density lipoprotein levels linkage with the periodontal status patients of coronary heart disease

    Science.gov (United States)

    Ahmad, Nafisah Ibrahim; Masulili, Sri Lelyati C.; Lessang, Robert; Radi, Basuni

    2017-02-01

    Studies found an association between periodontitis and coronary heart disease (CHD), but relationship between periodontal status CHD patients with LDL (Low Density Lipoprotein) levels, as risk factors for atherosclerosis, has not been studied. Objective: To analyze relationship between LDL and periodontal status CHD. Methods: Periodontal status of 60 CHD, 40 controls were examined (PBI, PPD, CAL) and their blood was taken to assess levels of LDL. Result: Found significant differences LDL (p=0.005), correlation between LDL with PPD (p=0.003) and CAL CHD (p=0.013), and PPD (p=0.001), CAL (p=0.008) non-CHD, but no significant correlation between LDL with PBI CAD (p=0.689) and PBI non-CHD (p=0.320). Conclusion: There is a correlation between the LDL levels with periodontal status.

  5. Nanostructured poly(benzimidazole membranes by N-alkylation

    Directory of Open Access Journals (Sweden)

    J. Weber

    2014-01-01

    Full Text Available Modification of poly(benzimidazole (PBI by N-alkylation leads to polymers capable of undergoing microphase separation. Polymers with different amounts of C18 alkyl chains have been prepared. The polymers were analyzed by spectroscopy, thermal analysis, electron microscopy and X-ray scattering. The impact of the amount of alkyl chains on the observed microphase separation was analyzed. Membranes prepared from the polymers do show microphase separation, as evidenced by scattering experiments. While no clear morphology could be derived for the domains in the native state, evidence for the formation of lamellar morphologies upon doping with phosphoric acid is provided. Finally, the proton conductivity of alkyl-modified PBI is compared with that of pure PBI, showing that the introduction of alkyl side chains does not result in significant conductivity changes.

  6. CH3NH3I treatment temperature of 70 °C in low-pressure vapor-assisted deposition for mesoscopic perovskite solar cells

    Science.gov (United States)

    Jin, Wenbin; Zou, Xiaoping; Bai, Xiao; Yang, Ying; Chen, Dan

    2018-01-01

    Herein, we report a modified vapor-assisted deposition method to fabricate CH3NH3PbI3 film at 70 °C in a vacuum drying oven. The modified method has excellent operability and expandability in preparing perovskite solar cells. The CH3NH3I treatment temperature is 130 °C or 150 °C in conventional method, but we reduced the temperature to 70 °C in the modified vapor-assisted method. Meanwhile, the quality of CH3NH3PbI3 films prepared via the modified method is superior to that of CH3NH3PbI3 films of solution-processed method.

  7. Synergistic extraction behaviour of americium from simulated acidic waste solutions

    International Nuclear Information System (INIS)

    Pathak, P.N.; Veeraraghavan, R.; Mohapatra, P.K.; Manchanda, V.K.

    1998-01-01

    The extraction behaviour of americium has been investigated with mixtures of 3-phenyl-4-benzoyl-5-isoxazolone (PBI) and oxodonors viz. tri-n-butyl phosphate (TBP), tri-n-octyl phosphine oxide (TOPO) and di-n-butyl octanamide (DBOA) using dodecane as the diluent from 1-6 M HNO 3 media. It is observed that D Am remains unaltered with PBI concentration (in the range 0.06-0.1 M) at 1.47 M TBP in the entire range of HNO 3 concentration. PBI and TBP in combination appears more promising compared to other synergistic systems. The possibility of using this mixture for americium removal from high level liquid waste solution has been explored. Extraction studies indicated that prior removal of uranium by 20% TBP in dodecane is helpful in the quantitative recovery of americium in three contacts. Effect of lanthanides on D Am is found to be marginal. (orig.)

  8. Cu(II) and Co(II) complexes of benzimidazole derivative: Structures, catecholase like activities and interaction studies with hydrogen peroxide

    Science.gov (United States)

    Kumari, Babli; Adhikari, Sangita; Matalobos, Jesús Sanmartín; Das, Debasis

    2018-01-01

    Present study describes the synthesis and single crystal X-ray structures of two metal complexes of benzimidazole derivative (PBI), viz. the Cu(II) complex, [Cu(PBI)2(NCS)]ClO4 (1) and a Co(II) complex, [Co(PBI)2(NCS)1.75Cl0.25] (2). The Cu(II) complex (1) shows catecholase like activity having Kcat = 1.84 × 104 h-1. Moreover, interactions of the complexes with hydrogen peroxide have been investigated using fluorescence spectroscopy. The interaction constant of 1 and 2 for H2O2 are 6.67 × 102 M-1 and 1.049 × 103 M-1 while their detection limits for H2O2 are 3.37 × 10-7 M and 2.46 × 10-7 M respectively.

  9. PENGEMBANGAN PERANGKAT PEMBELAJARAN MATEMATIKA MODEL PROBLEM BASED INSTRUCTION PADA MATA KULIAH KAPITA SELEKTA MATEMATIKA SEKOLAH DASAR

    Directory of Open Access Journals (Sweden)

    Ririn Widiyasari

    2016-12-01

    Full Text Available Tujuan penelitian ini adalah: (1 menghasilkan perangkat pembelajaran matematika model PBI yang valid, (2 mendapatkan efektivitas pembelajaran matematika dengan model PBI dan (3 mengetahui apakah perangkat pembelajaranan matematika model PBI praktis. Jenis penelitian ini adalah penelitian pengembangan yang mengacu pada model Plomp yang dimodifikasi. Perangkat pembelajaran yang dikembangkan terdiri dari silabus, Satuan Acara Perkuliahan (SAP, modul pembelajaran, dan worksheet. Kevalidan perangkat pembelajaran ditentukan berdasarkan validasi tim ahli dan teman sejawat, hasil penilaian oleh lima validator diperoleh kriteria valid dengan klasifikasi baik dan sangat baik. Keefektivan pembelajaran didapatkan dengan lembar pengamatan keaktifan mahasiswa, diperoleh hasil keaktifan mahasiswa termasuk kategori aktif. Sedangkan uji kepraktisan perangkat pembelajaran, dari uji lapangan diperoleh hasil pengamatan terhadap proses pembelajaran, angket respon pengajar dan mahasiswa terhadap pemakaian perangkat pembelajaran semuanya menunjukkan hasil yang baik.

  10. Parental rearing style: examining for links with personality vulnerability factors for depression.

    Science.gov (United States)

    Parker, G

    1993-07-01

    Recent research provides evidence of links between anomalous parenting experiences in childhood and subsequent depression. A study was designed to pursue the possibility that anomalous parenting effects a diathesis to depression by inducing a vulnerable cognitive style rather than by disposing directly to depression. Possible mediating personality style variables were explored in a study of 123 depressed subjects who scored their parents on the Parental Bonding Instrument (PBI), as well as completing a state depression and several relevant personality measures. Low self-esteem and a related dysfunction cognitive style were the personality variables most clearly linked with PBI scores, with links persisting after partialling out state levels of depression. Failure to find links between PBI scores and depression levels limited explication of the diathesis stress model.

  11. Shape-controlled synthesis of organolead halide perovskite nanocrystals and their tunable optical absorption

    International Nuclear Information System (INIS)

    Chen, Zhenhua; Tang, Yongbing; Huang, Xing; Lee, Chun-Sing; Li, Hui; Ho, Derek

    2014-01-01

    Hybrid organolead halide perovskites (CH 3 NH 3 PbI 3 ) with polymorphic structures have been successfully synthesized by controlling their solubility in solvents with different polarities. Crystal formation stages of the perovskites have been demonstrated for the first time. Shape changes of such perovskites are accompanied by transition in their crystal structures and variation of optical properties. Herein, a new trigonal phase for CH 3 NH 3 PbI 3 has been observed with a rod-like morphology. Photoemission study indicates a significant red shift in the perovskite nanoparticles, compared to that of the rod-like nanocrystals. This solvent-controlled formation of polymorphic phases provide an additional approach for controlling the optical properties of CH 3 NH 3 PbI 3 for various optoelectronic applications. (papers)

  12. Dealing with the Surgical and Medical Challenges of Penetrating Brain Injuries

    Directory of Open Access Journals (Sweden)

    Nikolaos Syrmos

    2013-01-01

    Full Text Available Peacetime has reduced the overall incidence of penetrating brain injuries (PBI, and those related to missile penetration are not common anymore at least in western countries. Nevertheless, PBI still occur, and car crashes or work accidents are their main causes. The management of such cases is characterized by many challenges, not only from a surgical and medical point of view, but also for the different and sometimes bizarre dynamics by which they present. Herein we report an unusual deep penetrating brain injury, due to a high-energy crash against a metallic rod in a construction site, with a good surgical outcome despite dramatic clinical conditions on admission. A discussion of the surgical results and functional outcome related to PBI, as found in the English medical literature, is provided. Moreover the most common postoperative complications along with the diagnostic flow charts and therapeutic options useful to prevent inappropriate treatment are highlighted.

  13. Role of prophylactic brain irradiation in limited stage small cell lung cancer: clinical, neuropsychologic, and CT sequelae

    International Nuclear Information System (INIS)

    Laukkanen, E.; Klonoff, H.; Allan, B.; Graeb, D.; Murray, N.

    1988-01-01

    Ninety-four patients with limited stage small cell lung cancer treated between 1981 and 1985 with a regimen including prophylactic brain irradiation (PBI) after combination chemotherapy were assessed for compliance with PBI, brain relapse, and neurologic morbidity. Seventy-seven percent of patients had PBI and of these, 22% developed brain metastases after a median time of 11 months post treatment. The brain was the apparent unique initial site of relapse in 10% of PBI cases but more commonly brain relapse was preceded or accompanied by failure at other sites, especially the chest. Brain metastases were the greatest cause of morbidity in 50% of PBI failures. Twelve of 14 PBI patients alive 2 years after treatment had oncologic, neurologic, and neuropsychological evaluation, and brain CT. All long-term survivors were capable of self care and none fulfilled diagnostic criteria for dementia, with three borderline cases. One third had pretreatment neurologic dysfunction and two thirds post treatment neurologic symptoms, most commonly recent memory loss. Fifty percent had subtle motor findings. Intellectual functioning was at the 38th percentile with most patients having an unskilled occupational history. Neuropsychologic impairment ratings were borderline in three cases and definitely impaired in seven cases. CT scans showed brain atrophy in all cases with mild progression in those having a pre-treatment baseline. Periventricular and subcortical low density lesions identical to the CT appearance of subcortical arteriosclerotic encephalopathy were seen in 82% of posttreatment CT studies, and lacunar infarcts in 54%. Neuropsychologic impairment scores and the extent of CT periventricular low density lesions were strongly associated

  14. The influence of the utilization time of brush heads from different types of power toothbrushes on oral hygiene assessed over a 6-month observation period: A randomized clinical trial.

    Science.gov (United States)

    Schmickler, Jan; Wurbs, Sabine; Wurbs, Susanne; Kramer, Katharina; Rinke, Sven; Hornecker, Else; Mausberg, Rainer F; Ziebolz, Dirk

    2016-12-01

    This randomized clinical trial investigated the influence of the utilization time of brush heads from different types of power toothbrushes [oscillating rotating (OR) and sonic action (SA)93; on oral hygiene (plaque accumulation and gingival inflammation) over a 6-month observation period. 49 participants were randomly allocated into two groups: use of the same brush head over 6 months (NR: non-replacement) or replacement of brush head every 4 weeks over 6 months (R: replacement). Each group was subdivided into two subgroups according to kind of toothbrush (TB) used (OR and SA). Modified Quigley-Hein plaque index (QHI), papilla bleeding index (PBI), and gingival index (GI) were recorded at baseline and 2, 8, 12, 16, and 24 weeks after baseline. After 24 weeks, participants of both groups (R and NR) received a new brush head. At week 26, final QHI, PBI, and GI were recorded. QHI decreased between baseline and follow-up visits in R groups (P 0.05). There was no significant effect of time on PBI or GI in any of R subgroups (P> 0.05). In NR oscillating/rotating TB: significant increase in PBI and GI was detected 24 weeks after baseline (PBI: P= 0.02, GI: P= 0.03); sonic action TBs showed significant decrease in PBI at every follow-up visit (P< 0.05), except at 24 weeks after baseline (P= 0.73). GI was significantly decreased at 2 weeks after baseline only (P< 0.01). Six-month use of the same brush head reduced effectiveness in removing plaque, and gingival inflammation appeared to increase after a utilization time of over 4 months. Replacing brush heads is advised after 4 months.

  15. Preoperative single fraction partial breast radiotherapy for early-stage breast cancer.

    Science.gov (United States)

    Palta, Manisha; Yoo, Sua; Adamson, Justus D; Prosnitz, Leonard R; Horton, Janet K

    2012-01-01

    Several recent series evaluating external beam accelerated partial breast irradiation (PBI) have reported adverse cosmetic outcomes, possibly related to large volumes of normal tissue receiving near-prescription doses. We hypothesized that delivery of external beam PBI in a single fraction to the preoperative tumor volume would be feasible and result in a decreased dose to the uninvolved breast compared with institutional postoperative PBI historical controls. A total of 17 patients with unifocal Stage T1 breast cancer were identified. Contrast-enhanced subtraction magnetic resonance images were loaded into an Eclipse treatment planning system and used to define the target volumes. A "virtual plan" was created using four photon beams in a noncoplanar beam arrangement and optimized to deliver 15 Gy to the planning target volume. The median breast volume was 1,713 cm(3) (range: 1,014-2,140), and the median clinical target volume was 44 cm(3) (range: 26-73). In all cases, 100% of the prescription dose covered 95% of the clinical target volume. The median conformity index was 0.86 (range: 0.70-1.12). The median percentage of the ipsilateral breast volume receiving 100% and 50% of the prescribed dose was 3.8% (range: 2.2-6.9) and 13.3% (range: 7.5-20.8) compared with 18% (range: 3-42) and 53% (range: 24-65) in the institutional historical controls treated with postoperative external beam PBI (p = .002). The median maximum skin dose was 9 Gy. The median dose to 1 and 10 cm(3) of skin was 6.7 and 4.9 Gy. The doses to the heart and ipsilateral lung were negligible. Preoperative PBI resulted in a substantial reduction in ipsilateral breast tissue dose compared with postoperative PBI. The skin dose appeared reasonable, given the small volumes. A prospective Phase I trial evaluating this technique is ongoing. Copyright © 2012 Elsevier Inc. All rights reserved.

  16. Ultralow Self-Doping in 2D Hybrid Perovskite Single Crystals

    KAUST Repository

    Peng, Wei

    2017-06-28

    Unintentional self-doping in semiconductors through shallow defects is detrimental to optoelectronic device performance. It adversely affects junction properties and it introduces electronic noise. This is especially acute for solution-processed semiconductors, including hybrid perovskites, which are usually high in defects due to rapid crystallization. Here, we uncover extremely low self-doping concentrations in single crystals of (C6H5C2H4NH3)2PbI4・(CH3NH3PbI3)n-1 (n=1, 2, and 3)—over three orders of magnitude lower than those of typical three-dimensional hybrid perovskites—by analyzing their conductivity behavior. We propose that crystallization of hybrid perovskites containing large organic cations suppresses defect formation and thus favors a low self-doping level. To exemplify the benefits of this effect, we demonstrate extraordinarily high light-detectivity (1013 Jones) in (C6H5C2H4NH3)2PbI4・(CH3NH3PbI3)n-1 photoconductors due to the reduced electronic noise, which makes them particularly attractive for the detection of weak light signals. Furthermore, the low self-doping concentration reduces the equilibrium charge carrier concentration in (C6H5C2H4NH3)2PbI4・(CH3NH3PbI3)n-1, advantageous in the design of p-i-n heterojunction solar cells by optimizing band alignment and promoting carrier depletion in the intrinsic perovskite layer, thereby enhancing charge extraction.

  17. Columnar Self-Assembly of Electron-Deficient Dendronized Bay-Annulated Perylene Bisimides.

    Science.gov (United States)

    Gupta, Ravindra Kumar; Shankar Rao, Doddamane S; Prasad, S Krishna; Achalkumar, Ammathnadu S

    2018-03-07

    Three new heteroatom bay-annulated perylene bisimides (PBIs) have been synthesized by microwave-assisted synthesis in excellent yield. N-annulated and S-annulated perylene bisimides exhibited columnar hexagonal phase, whereas Se-annulated perylene bisimide exhibited low temperature columnar oblique phase in addition to the high temperature columnar hexagonal phase. The cup shaped bay-annulated PBIs pack into columns with enhanced intermolecular interactions. In comparison to PBI, these molecules exhibited lower melting and clearing temperature, with good solubility. A small red shift in the absorption was seen in the case of N-annulated PBI, whereas S- and Se-annulated PBIs exhibited blue-shifted absorption spectra. Bay-annulation increased the HOMO and LUMO levels of the N-annulated perylene bisimide, whereas a slight increase in the LUMO level and a decrease in the HOMO levels were observed in the case of S- and Se-annulated perylene bisimides, in comparison to the simple perylene bisimide. The band gaps of PBI and PBI-N were almost same, whereas an increase in the band gaps were observed in the case of S- and Se-annulated PBIs. The tendency to freeze in the ordered glassy columnar phase for PBI-N and PBI-S will help to overcome the charge traps due to crystallization, which are detrimental to one-dimensional charge carrier mobility. These solution processable electron deficient columnar semiconductors possessing good thermal stability may form an easily accessible promising class of n-type materials. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Ultrasonic irradiation to modify the functionalized bionanocomposite in sulfonated polybenzimidazole membrane for fuel cells applications and antibacterial activity.

    Science.gov (United States)

    Esmaeilzade, Banafshe; Esmaielzadeh, Sheida; Ahmadizadegan, Hashem

    2018-04-01

    In this article the new proton exchange membranes were prepared from sulfonated polybenzimidazole (s-PBI) and various amounts of sulfonated titania/cellulose nanohybrids (titania/cellulose-SO 3 H) via ultrasonic waves. The ultrasonic irradiation effectively changes the rheology and the glass transition temperature and the crystallinity of the composite polymer. Ultrasonic irradiation has a very strong mixing and dispersion effect, much stronger than conventional stirring, which can improve the dispersion of titania/cellulose-SO 3 H nanoparticles in the polymer matrix. The strong -SO 3 H/-SO 3 H interaction between s-PBI chains and titania/cellulose-SO 3 H hybrids leads to ionic cross-linking in the membrane structure, which increases both the thermal stability and methanol resistance of the membranes. After acid doping with phosphoric acid, s-PBI/titania/cellulose-SO 3 H nanocomposite membranes exhibit depressions on methanol permeability and enhancements on proton conductivity comparing to the pristine s-PBI membrane. The chemical structure of the functionlized titania was characterized with FTIR, and energy-dispersive X-ray. Imidazole and sulfonated groups on the surface of modified nanoparticles forming linkages with s-PBI chains, improved the compatibility between s-PBI and nanoparticles, and enhanced the mechanical strength of the prepared nanocomposite membranes. From SEM and TEM analysis could explain the homogeneous dispersion of titania/cellulose-SO 3 H in nanocomposite membranes. Moreover, the membranes exhibited excellent antibacterial activities against S. aureus and E. coli. A. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Molecular cloning and characterization of satellite DNA sequences from constitutive heterochromatin of the habu snake (Protobothrops flavoviridis, Viperidae) and the Burmese python (Python bivittatus, Pythonidae).

    Science.gov (United States)

    Matsubara, Kazumi; Uno, Yoshinobu; Srikulnath, Kornsorn; Seki, Risako; Nishida, Chizuko; Matsuda, Yoichi

    2015-12-01

    Highly repetitive DNA sequences of the centromeric heterochromatin provide valuable molecular cytogenetic markers for the investigation of genomic compartmentalization in the macrochromosomes and microchromosomes of sauropsids. Here, the relationship between centromeric heterochromatin and karyotype evolution was examined using cloned repetitive DNA sequences from two snake species, the habu snake (Protobothrops flavoviridis, Crotalinae, Viperidae) and Burmese python (Python bivittatus, Pythonidae). Three satellite DNA (stDNA) families were isolated from the heterochromatin of these snakes: 168-bp PFL-MspI from P. flavoviridis and 196-bp PBI-DdeI and 174-bp PBI-MspI from P. bivittatus. The PFL-MspI and PBI-DdeI sequences were localized to the centromeric regions of most chromosomes in the respective species, suggesting that the two sequences were the major components of the centromeric heterochromatin in these organisms. The PBI-MspI sequence was localized to the pericentromeric region of four chromosome pairs. The PFL-MspI and the PBI-DdeI sequences were conserved only in the genome of closely related species, Gloydius blomhoffii (Crotalinae) and Python molurus, respectively, although their locations on the chromosomes were slightly different. In contrast, the PBI-MspI sequence was also in the genomes of P. molurus and Boa constrictor (Boidae), and additionally localized to the centromeric regions of eight chromosome pairs in B. constrictor, suggesting that this sequence originated in the genome of a common ancestor of Pythonidae and Boidae, approximately 86 million years ago. The three stDNA sequences showed no genomic compartmentalization between the macrochromosomes and microchromosomes, suggesting that homogenization of the centromeric and/or pericentromeric stDNA sequences occurred in the macrochromosomes and microchromosomes of these snakes.

  20. Relationship of order and number of siblings to perceived parental attitudes in childhood.

    Science.gov (United States)

    Kitamura, T; Sugawara, M; Shima, S; Toda, M A

    1998-06-01

    Despite the increasingly recognized link between perceived parenting behavior and the onset of psychopathology in adults, studies of the possible determinants of perceptions of parenting behavior are rare. In a sample of 1,145 pregnant Japanese women, correlations were examined between the numbers and sexes of siblings and perceived rearing practices, as rated by the Parental Bonding Instrument (PBI; Parker, Tupling, & Brown, 1979). The participants with more elder sisters viewed their parents' attitudes as less caring, whereas those with more brothers, particularly younger brothers, viewed their parents' attitudes as less overprotective. However, the proportion of the variance of all the PBI scores explained by different types of siblings was very small.

  1. Development and characterization of acid-doped polybenzimidazole/sulfonated polysulfone blend polymer electrolytes for fuel cells

    DEFF Research Database (Denmark)

    Hasiotis, C.; Li, Qingfeng; Deimede, V.

    2001-01-01

    Polymeric membranes from blends of sulfonated polysulfones (SPSF) and polybenzimidazole (PBI) doped with phosphoric acid were developed as potential high-temperature polymer electrolytes for fuel cells and other electrochemical applications. The water uptake and acid doping of these polymeric...... membranes were investigated. Ionic conductivity of the membranes was measured in relation to temperature, acid doping level, sulfonation degree of SPSF, relative humidity, and blend composition. The conductivity of SPSF was of the order of 10/sup -3/ S cm/sup -1/. In the case of blends of PBI and SPSF...

  2. Chemically Stable Covalent Organic Framework (COF)-Polybenzimidazole Hybrid Membranes: Enhanced Gas Separation through Pore Modulation.

    Science.gov (United States)

    Biswal, Bishnu P; Chaudhari, Harshal D; Banerjee, Rahul; Kharul, Ulhas K

    2016-03-24

    Highly flexible, TpPa-1@PBI-BuI and TpBD@PBI-BuI hybrid membranes based on chemically stable covalent organic frameworks (COFs) could be obtained with the polymer. The loading obtained was substantially higher (50 %) than generally observed with MOFs. These hybrid membranes show an exciting enhancement in permeability (about sevenfold) with appreciable separation factors for CO2/N2 and CO2/CH4. Further, we found that with COF pore modulation, the gas permeability can be systematically enhanced. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. The influence of additives in the stoichiometry of hybrid lead halide perovskites

    Directory of Open Access Journals (Sweden)

    Ignasi Burgués-Ceballos

    2017-11-01

    Full Text Available We investigate the employment of carefully selected solvent additives in the processing of a commercial perovskite precursor ink and analyze their impact on the performance of organometal trihalide perovskite (CH3NH3PbI3−xClx photovoltaic devices. We provide evidence that the use of benzaldehyde can be used as an effective method to preserve the stoichiometry of the perovskite precursors in solution. Benzaldehyde based additive engineering shows to improve perovskite solid state film morphology and device performance of CH3NH3PbI3−xClx based solar cells.

  4. Positive attitudinal shifts with the Physics by Inquiry curriculum across multiple implementations

    Directory of Open Access Journals (Sweden)

    Beth A. Lindsey

    2012-01-01

    Full Text Available Recent publications have documented positive attitudinal shifts on the Colorado Learning Attitudes about Science Survey (CLASS among students enrolled in courses with an explicit epistemological focus. We now report positive attitudinal shifts in classes using the Physics by Inquiry (PbI curriculum, which has only an implicit focus on student epistemologies and nature of science issues. These positive shifts have occurred in several different implementations of the curriculum, across multiple institutions and multiple semesters. In many classes, students experienced significant attitudinal shifts in the problem-solving categories of the CLASS, despite the conceptual focus of most PbI courses.

  5. Fabrication of Polybenzimidazole/Palladium Nanoparticles Hollow Fiber Membranes for Hydrogen Purification

    KAUST Repository

    Villalobos, Luis Francisco

    2017-09-13

    A novel scheme to fabricate polybenzimidazole (PBI) hollow fiber membranes with a thin skin loaded with fully dispersed palladium nanoparticles is proposed for the first time. Palladium is added to the membrane during the spinning process in the form of ions that coordinate to the imidazole groups of the polymer. This is attractive for membrane production because agglomeration of nanoparticles is minimized and the high-cost metal is incorporated in only the selective layer—where it is required. Pd-containing membranes achieve three orders of magnitude higher H2 permeances and a twofold improvement in H2/CO2 selectivity compared to pure PBI hollow fiber membranes.

  6. Effect of chloride impurities on the performance and durability of polybenzimidazole-based high temperature proton exchange membrane fuel cells

    DEFF Research Database (Denmark)

    Ali, Syed Talat; Li, Qingfeng; Pan, Chao

    2011-01-01

    The effect of chloride as an air impurity and as a catalyst contaminant on the performance and durability of polybenzimidazole (PBI)-based high temperature proton exchange membrane fuel cell (HT-PEMFC) was studied. The ion chromatographic analysis reveals the existence of chloride contaminations....... The performance loss was recovered when switching from the HCl solution back to pure water in the air humidifier. Under an accelerated aging performance test conducted through potential cycling between 0.9 V and 1.2 V, the PBI-based fuel cell initially containing 0.5 NaCl mg cm−2 on the cathode catalyst layer...

  7. Nail Assessment in Psoriasis and Psoriatic Arthritis (NAPPA)

    DEFF Research Database (Denmark)

    Augustin, M; Blome, C; Costanzo, A

    2013-01-01

    assessing quality of life (NAPPA-QoL), a two-part questionnaire assessing patient-relevant treatment benefits (the Patient Benefit Index, NAPPA-PBI) and a psoriasis Clinical Assessment of Severity (NAPPA-CLIN). METHODS: Development of the questionnaires involved multiple steps: (i) collection of items about......%) and comprehensible (95%). NAPPA-QoL and NAPPA-PBI scores correlated moderately with clinical outcomes [e.g. Nail Psoriasis Severity Index (NAPSI)] and markedly with other quality-of-life questionnaires (e.g. EQ-5D™). Both questionnaires were sensitive to change. Internal consistency was good (Cronbach α ≥ 0...

  8. Prone versus supine positioning for whole and partial-breast radiotherapy: A comparison of non-target tissue dosimetry

    International Nuclear Information System (INIS)

    Kirby, Anna M.; Evans, Philip M.; Donovan, Ellen M.; Convery, Helen M.; Haviland, Joanna S.; Yarnold, John R.

    2010-01-01

    Purpose: To compare non-target tissue (including left-anterior-descending coronary-artery (LAD)) dosimetry of prone versus supine whole (WBI) and partial-breast irradiation (PBI). Methods and materials: Sixty-five post-lumpectomy breast cancer patients underwent CT-imaging supine and prone. On each dataset, the whole-breast clinical-target-volume (WB-CTV), partial-breast CTV (tumour-bed + 15 mm), ipsilateral-lung and chest-wall were outlined. Heart and LAD were outlined in left-sided cases (n = 30). Tangential-field WBI and PBI plans were generated for each position. Mean LAD, heart, and ipsilateral-lung doses (x mean ), maximum LAD (LAD max ) doses, and the volume of chest-wall receiving 50 Gy (V 50Gy ) were compared. Results: Two-hundred and sixty plans were generated. Prone positioning reduced heart and LAD doses in 19/30 WBI cases (median reduction in LAD mean = 6.2 Gy) and 7/30 PBI cases (median reduction in LAD max = 29.3 Gy) (no difference in 4/30 cases). However, prone positioning increased cardiac doses in 8/30 WBI (median increase in LAD mean = 9.5 Gy) and 19/30 PBI cases (median increase in LAD max = 22.9 Gy) (no difference in 3/30 cases). WB-CTV > 1000cm 3 was associated with improved cardiac dosimetry in the prone position for WBI (p = 0.04) and PBI (p = 0.04). Prone positioning reduced ipsilateral-lung mean in 65/65 WBI and 61/65 PBI cases, and chest-wall V 50Gy in all WBI cases. PBI reduced normal-tissue doses compared to WBI in all cases, regardless of the treatment position. Conclusions: In the context of tangential-field WBI and PBI, prone positioning is likely to benefit left-breast-affected women of larger breast volume, but to be detrimental in left-breast-affected women of smaller breast volume. Right-breast-affected women are likely to benefit from prone positioning regardless of breast volume.

  9. Ternary system of cesium, rubidium and lead iodides

    International Nuclear Information System (INIS)

    Volchanskaya, V.V.; Dunaeva, T.I.; Il'yasov, I.I.

    1990-01-01

    Meltability diagram of ternary system (CsI) 2 -(RbI) 2 -PbI 2 has been studied. The liquidus of the given system consists of crystallization fields of solid solutions (CsI-RbI) and (CsI·PbI 2 -RbI-PbI 2 ), fields of incongruently melting compounds 9RbI·PbI 2 , 4CsI·PbI 2 and field of PbI 2 component. In the system two nonvariant points at 410 and 380 deg C are detected

  10. Akibat Hukum Bagi Bank Bila Kewajiban Modal Inti Minimum Tidak Terpenuhi

    Directory of Open Access Journals (Sweden)

    Indira Retno Aryatie

    2012-02-01

    Full Text Available As an implementation of the Indonesian Banking Architecture policy, the government issues Bank Indonesia Regulation No. 9/16/ PBI/2007 on Minimum Tier One Capital that increases the minimum capital to 100 billion rupiah. This writing discusses the legal complication that a bank will face should it fail to fulfil the minimum ratio. Sebagai tindak lanjut dari kebijakan Arsitektur Perbankan Indonesia, pemerintah mengeluarkan Peraturan Bank Indonesia 9/16/PBI/2007 tentang Kewajiban Modal Inti Minimum Bank yang menaikkan modal inti minimum bank umum menjadi 100 miliar rupiah. Tulisan ini membahas akibat hukum yang akan dialami bank bila kewajiban modal minimum tersebut gagal dipenuhi.

  11. The influence of additives in the stoichiometry of hybrid lead halide perovskites

    Science.gov (United States)

    Burgués-Ceballos, Ignasi; Savva, Achilleas; Georgiou, Efthymios; Kapnisis, Konstantinos; Papagiorgis, Paris; Mousikou, Androniki; Itskos, Grigorios; Othonos, Andreas; Choulis, Stelios A.

    2017-11-01

    We investigate the employment of carefully selected solvent additives in the processing of a commercial perovskite precursor ink and analyze their impact on the performance of organometal trihalide perovskite (CH3NH3PbI3-xClx) photovoltaic devices. We provide evidence that the use of benzaldehyde can be used as an effective method to preserve the stoichiometry of the perovskite precursors in solution. Benzaldehyde based additive engineering shows to improve perovskite solid state film morphology and device performance of CH3NH3PbI3-xClx based solar cells.

  12. Structural and optical studies of local disorder sensitivity in natural organic-inorganic self-assembled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Vijaya Prakash, G; Pradeesh, K [Nanophotonics Lab, Department of Physics, Indian Institute of Technology Delhi, New Delhi (India); Ratnani, R; Saraswat, K [Department of Pure and Applied Chemistry, MDS University, Ajmer (India); Light, M E [School of Chemistry, University of Southampton, Southampton (United Kingdom); Baumberg, J J, E-mail: prakash@physics.iitd.ac.i [Nanophotonic Centre, Cavendish Laboratory, University Cambridge, Cambridge CB3 OHE (United Kingdom)

    2009-09-21

    The structural and optical spectra of two related lead iodide (PbI) based self-assembled hybrid organic-inorganic semiconductors are compared. During the synthesis, depending on the bridging of organic moiety intercalated between the PbI two-dimensional planes, different crystal structures are produced. These entirely different networks show different structural and optical features, including excitonic bandgaps. In particular, the modified organic environment of the excitons is sensitive to the local disorder both in single crystal and thin film forms. Such information is vital for incorporating these semiconductors into photonic device architectures.

  13. Understanding ternary poly(potassium benzimidazolide)-based polymer electrolytes

    DEFF Research Database (Denmark)

    Aili, David; Jankova Atanasova, Katja; Han, Junyoung

    2016-01-01

    Poly(2,20-(m-phenylene)-5,50-bisbenzimidazole) (m-PBI) can dissolve large amounts of aqueous electrolytes to give materials with extraordinary high ion conductivity and the practical applicability has been demonstrated repeatedly in fuel cells, water electrolysers and as anion conducting component...

  14. On the Synthesis and Optical Characterization of Zero-Dimensional-Networked Perovskites

    KAUST Repository

    Almutlaq, Jawaher

    2017-01-01

    The results of the optical characterization showed that the absorption and the corresponding PL spectra were successfully tuned to cover the visible spectrum from 410 nm for Cs4PbCl6, to 520 nm and 700 m for Cs4PbBr6 and Cs4PbI6, respectively

  15. Atmospheric effects on the photovoltaic performance of hybrid perovskite solar cells

    KAUST Repository

    Sheikh, Arif D.; Bera, Ashok; Haque, Mohammed; Baby, Rakhi Raghavan; Del Gobbo, Silvano; Alshareef, Husam N.; Wu, Tao

    2015-01-01

    nitrogen, and dry air, on the photovoltaic performance of TiO2-CH3NH3PbI3-xClx-spiro-MeOTAD solar cells. We found that spin coating of spiro-MeOTAD in an oxygen atmosphere alone was not adequate to functionalize its hole-transport property completely

  16. Natural extensions for Nakada's α-expansions : Descending from 1 to g

    NARCIS (Netherlands)

    de Jonge, C.J.; Kraaikamp, C.

    <p>By means of singularisations and insertions in Nakada's α-expansions, which involves the removal of partial quotients 1 while introducing partial quotients with a minus sign, the natural extension of Nakada's continued fraction map Tα is given for (10-2)/3≤α<1. From our construction it follows

  17. Lead iodide perovskite sensitized all-solid-state submicron thin film mesoscopic solar cell with efficiency exceeding 9%.

    KAUST Repository

    Kim, Hui-Seon; Lee, Chang-Ryul; Im, Jeong-Hyeok; Lee, Ki-Beom; Moehl, Thomas; Marchioro, Arianna; Moon, Soo-Jin; Humphry-Baker, Robin; Yum, Jun-Ho; Moser, Jacques E; Grä tzel, Michael; Park, Nam-Gyu

    2012-01-01

    We report on solid-state mesoscopic heterojunction solar cells employing nanoparticles (NPs) of methyl ammonium lead iodide (CH(3)NH(3))PbI(3) as light harvesters. The perovskite NPs were produced by reaction of methylammonium iodide with PbI(2) and deposited onto a submicron-thick mesoscopic TiO(2) film, whose pores were infiltrated with the hole-conductor spiro-MeOTAD. Illumination with standard AM-1.5 sunlight generated large photocurrents (J(SC)) exceeding 17 mA/cm(2), an open circuit photovoltage (V(OC)) of 0.888 V and a fill factor (FF) of 0.62 yielding a power conversion efficiency (PCE) of 9.7%, the highest reported to date for such cells. Femto second laser studies combined with photo-induced absorption measurements showed charge separation to proceed via hole injection from the excited (CH(3)NH(3))PbI(3) NPs into the spiro-MeOTAD followed by electron transfer to the mesoscopic TiO(2) film. The use of a solid hole conductor dramatically improved the device stability compared to (CH(3)NH(3))PbI(3) -sensitized liquid junction cells.

  18. The effect of irradiation by 173Cs and 60Co on the optical and spectral response properties of lead iodide thin films

    International Nuclear Information System (INIS)

    Jamil, S. S. B.; Ltaif, A. K.; Fadhel, H. M.

    2012-12-01

    This films of solution grown PbI 2 and of pure material of PbI 2 have been deposited onto glass substrate at 100o C by vacuum thermal evaporation technique. Some physical properties of samples without and with gamma radiation are studied. The irradiation process to the samples were made by applied sample to 1 73 'Cs source with activity 0.635 μci and 6 0C o source with activity 0.62 μci without and with different times of irradiation (3,4,5,6, weeks) to obtain the suitable dose. The x-ray diffraction analysis confirmed that PbI 2 films are polycrystalline, having bollixing structure. Transmission spectra, absorption coefficient and band gap energy are studies were also carried out in the wavelength region of 420-900 nm. The band gap of Pb1 2 at room temperature was found to be 2.37-2.78 eV with direct transition nature using the plots were calculated which were machinating with earlier reported value. The spectral photocurrent of PbI 2 layers deposited in different time were also studied, it is found the maximum photocurrent response always is between the wavelength 490-500 nm. (Author)

  19. Intergenerational Transmission of Parenting Style and Personality: Direct Influence or Mediation?

    Science.gov (United States)

    Kitamura, Toshinori; Shikai, Noriko; Uji, Masayo; Hiramura, Hidetoshi; Tanaka, Nao; Shono, Masahiro

    2009-01-01

    In order to examine the relationships between parenting styles and personality traits over generations, a cross-sectional questionnaire study was conducted for fathers and mothers of school-age children of grades 5-9. The parenting styles measured by the Parental Bonding Instrument (PBI) and the personality traits measured by the Temperament and…

  20. Planar-Structure Perovskite Solar Cells with Efficiency beyond 21.

    Science.gov (United States)

    Jiang, Qi; Chu, Zema; Wang, Pengyang; Yang, Xiaolei; Liu, Heng; Wang, Ye; Yin, Zhigang; Wu, Jinliang; Zhang, Xingwang; You, Jingbi

    2017-12-01

    Low temperature solution processed planar-structure perovskite solar cells gain great attention recently, while their power conversions are still lower than that of high temperature mesoporous counterpart. Previous reports are mainly focused on perovskite morphology control and interface engineering to improve performance. Here, this study systematically investigates the effect of precise stoichiometry, especially the PbI 2 contents on device performance including efficiency, hysteresis and stability. This study finds that a moderate residual of PbI 2 can deliver stable and high efficiency of solar cells without hysteresis, while too much residual PbI 2 will lead to serious hysteresis and poor transit stability. Solar cells with the efficiencies of 21.6% in small size (0.0737 cm 2 ) and 20.1% in large size (1 cm 2 ) with moderate residual PbI 2 in perovskite layer are obtained. The certificated efficiency for small size shows the efficiency of 20.9%, which is the highest efficiency ever recorded in planar-structure perovskite solar cells, showing the planar-structure perovskite solar cells are very promising. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Reproductive Failure

    African Journals Online (AJOL)

    ve toxoplasmosis. Low PBI. +ve mycoplasma. +ve GTI. KPI >15j! Trichomonas candida. Shirodkar sutures ... MATERIAL. Each patient has a glucose tolerance test as a routine. and, in a few cases, abnormal results have been obtained in patients not otherwise known to be diabetic. LEUCOCYTE ALKALINE PHOSPHATASE.

  2. Polybenzimidazole-based mixed membranes with exceptional high water vapor permeability and selectivity

    KAUST Repository

    Akhtar, Faheem Hassan

    2017-09-13

    Polybenzimidazole (PBI), a thermal and chemically stable polymer, is commonly used to fabricate membranes for applications like hydrogen recovery at temperatures of more than 300 °C, fuel cells working in a highly acidic environment, and nanofiltration in aggressive solvents. This report shows for the first time use of PBI dense membranes for water vapor/gas separation applications. They showed an excellent selectivity and high water vapor permeability. Incorporation of inorganic hydrophilic titanium-based nano-fillers into the PBI matrix further increased the water vapor permeability and water vapor/N2 selectivity. The most selective mixed matrix membrane with 0.5 wt% loading of TiO2 nanotubes yielded a water vapor permeability of 6.8×104 Barrer and a H2O/N2 selectivity of 3.9×106. The most permeable membrane with 1 wt% loading of carboxylated TiO2 nanoparticles had a 7.1×104 Barrer water vapor permeability and a H2O/N2 selectivity of 3.1×106. The performance of these membranes in terms of water vapor transport and selectivity is among the highest reported ones. The remarkable ability of PBI to efficiently permeate water versus other gases opens the possibility to fabricate membranes for dehumidification of streams in harsh environments. This includes the removal of water from high temperature reaction mixtures to shift the equilibrium towards products.

  3. Proton triggered circularly polarized luminescence in orthogonal- and co-assemblies of chiral gelators with achiral perylene bisimide.

    Science.gov (United States)

    Han, Dongxue; Han, Jianlei; Huo, Shengwei; Qu, Zuoming; Jiao, Tifeng; Liu, Minghua; Duan, Pengfei

    2018-05-29

    The orthogonal- or co-assembly of achiral perylene bisimide (PBI) with chiral gelators can be regulated by solvents. While the coassembly leads to the formation of chiroptical nanofibers through chirality transfer, the orthogonal assemblies could not. Moreover, protonation on the coassembled nanofibers could light up the circularly polarized luminescence (CPL).

  4. Development and Characterization of Temperature-resistant Polymer Electrolytes

    DEFF Research Database (Denmark)

    Qingfeng, Li; Hjuler, Hans Aage; Bjerrum, Niels

    1999-01-01

    Acid-doped PBI polymer electrolyte membranes have been developed and characterized for fuel cell applications at temperatures up to 200°C. Electric conductivity as high as 0.13 S/cm is obtained at 160°C at high doping levels. The water osmotic drag coefficient of the polymer electrolyte is found...

  5. Polybenzimidazole and sulfonated polyhedral oligosilsesquioxane composite membranes for high temperature polymer electrolyte membrane fuel cells

    DEFF Research Database (Denmark)

    Aili, David; Allward, Todd; Alfaro, Silvia Martinez

    2014-01-01

    Composite membranes based on poly(2,2′(m-phenylene)-5,5́bibenzimidazole) (PBI) and sulfonated polyhedral oligosilsesquioxane (S-POSS) with S-POSS contents of 5 and 10wt.% were prepared by solution casting as base materials for high temperature polymer electrolyte membrane fuel cells. With membranes...

  6. Electrically Anisotropic Layered Perovskite Single Crystal

    KAUST Repository

    Li, Ting-You

    2016-01-01

    -23). However, the difficulty in growing large-sized LOIHPs single crystal with superior electrical properties limits their practical applications. Here, we report a method to grow the centimeter-scaled LOIHP single crystal of [(HOC2H4NH3)2PbI4], demonstrating

  7. Growth and properties of lead iodide thin films by spin coating

    Indian Academy of Sciences (India)

    X-ray diffraction patterns revealed that the thin films possessed hexagonal structures. The thin films .... of inorganic PbI2 in an organic solvent depends on the co- ordination .... Figure 7b and c shows the absorption coefficient of both samples ...

  8. Gas Separation Membranes Derived from High-Performance Immiscible Polymer Blends Compatibilized with Small Molecules.

    Science.gov (United States)

    Panapitiya, Nimanka P; Wijenayake, Sumudu N; Nguyen, Do D; Huang, Yu; Musselman, Inga H; Balkus, Kenneth J; Ferraris, John P

    2015-08-26

    An immiscible polymer blend comprised of high-performance copolyimide 6FDA-DAM:DABA(3:2) (6FDD) and polybenzimidazole (PBI) was compatibilized using 2-methylimidazole (2-MI), a commercially available small molecule. Membranes were fabricated from blends of 6FDD:PBI (50:50) with and without 2-MI for H2/CO2 separations. The membranes demonstrated a matrix-droplet type microstructure as evident with scanning electron microscopy (SEM) imaging where 6FDD is the dispersed phase and PBI is the continuous phase. In addition, membranes with 2-MI demonstrated a uniform microstructure as observed by smaller and more uniformly dispersed 6FDD domains in contrast to 6FDD:PBI (50:50) blend membranes without 2-MI. This compatibilization effect of 2-MI was attributed to interfacial localization of 2-MI that lowers the interfacial energy similar to a surfactant. Upon the incorporation of 2-MI, the H2/CO2 selectivity improved remarkably, compared to the pure blend, and surpassed the Robeson's upper bound. To our knowledge, this is the first report of the use of a small molecule to compatibilize a high-performance immiscible polymer blend. This approach could afford a novel class of membranes in which immiscible polymer blends can be compatibilized in an economical and convenient fashion.

  9. Psychometric Validation of the Parental Bonding Instrument in a UK Population–Based Sample Role of Gender and Association With Mental Health in Mid-Late Life

    NARCIS (Netherlands)

    M.K. Xu (Kate); A. J. S. Morin (Alexandre); H. W. Marsh (Herbert); M. Richards (Martin); P. B. Jones (Peter)

    2016-01-01

    markdownabstractThe factorial structure of the Parental Bonding Instrument (PBI) has been frequently studied in diverse samples but no study has examined its psychometric properties from large, population-based samples. In particular, important questions have not been addressed such as the

  10. Does low-energy sweetener consumption affect energy intake and body weight? A systematic review, including meta-analyses, of the evidence from human and animal studies

    NARCIS (Netherlands)

    Rogers, P.J.; Hogenkamp, P.S.; Graaf, de Kees; Higgs, S.; Lluch, A.; Ness, A.R.; Penfold, C.; Perry, R.; Putz, P.; Yeomans, M.R.; Mela, D.J.

    2016-01-01

    <p>By reducing energy density, low-energy sweeteners (LES) might be expected to reduce energy intake (EI) and body weight (BW). To assess the totality of the evidence testing the null hypothesis that LES exposure (versus sugars or unsweetened alternatives) has no effect on EI or BW, we conducted a

  11. Identification and functional characterisation of Complement Regulator Acquiring Surface Protein-1 of serum resistant Borrelia garinii OspA serotype 4

    Directory of Open Access Journals (Sweden)

    Zipfel Peter F

    2010-02-01

    Full Text Available Abstract Background B. burgdorferi sensu lato (sl is the etiological agent of Lyme borreliosis in humans. Spirochetes have adapted themselves to the human immune system in many distinct ways. One important immune escape mechanism for evading complement activation is the binding of complement regulators Factor H (CFH or Factor H-like protein1 (FHL-1 to Complement Regulator-Acquiring Surface Proteins (CRASPs. Results We demonstrate that B. garinii OspA serotype 4 (ST4 PBi resist complement-mediated killing by binding of FHL-1. To identify the primary ligands of FHL-1 four CspA orthologs from B. garinii ST4 PBi were cloned and tested for binding to human CFH and FHL-1. Orthologs BGA66 and BGA71 were found to be able to bind both complement regulators but with different intensities. In addition, all CspA orthologs were tested for binding to mammalian and avian CFH. Distinct orthologs were able to bind to CFH of different animal origins. Conclusions B. garinii ST4 PBi is able to evade complement killing and it can bind FHL-1 to membrane expressed proteins. Recombinant proteins BGA66 can bind FHL-1 and human CFH, while BGA71 can bind only FHL-1. All recombinant CspA orthologs from B. garinii ST4 PBi can bind CFH from different animal origins. This partly explains the wide variety of animals that can be infected by B. garinii.

  12. Sequence Classification: 891407 [

    Lifescience Database Archive (English)

    Full Text Available ive stress, forms LMA1 complex with Pbi2p, acts as a cofactor for Tsa1p, required for ER-Golgi transport and vacuole inheritance; Trx2p || http://www.ncbi.nlm.nih.gov/protein/6321648 ...

  13. METODE ANUITAS DAN PROPORSIONAL MURABAHAH SEBAGAI BENTUK TRANSPARANSI DAN PUBLIKASI LAPORAN BANK

    Directory of Open Access Journals (Sweden)

    Mr Faisal

    2015-02-01

    Full Text Available Proportional and annuity methods are based on PBI 14/14/PBI/2012 on Transparency and Publication Reports of Islamic Banking and SEBI No. 15/26/DPbs/2013 on Implementation of Accounting Guidelines of Islamic Banking in Indonesia. These methods are forms of commitment to bring transparency in the Islamic banks and recognition on financial statement of profit on murabaha. The Annuity method is referred to PSAK 50, PSAK 55 and PSAK 60 because the substance is classified as a form of financing. Proportional method is referred to PSAK 102 because the substance is classified as trading activities. Metode anuitas dan proporsional didasarkan pada PBI No. 14/14/PBI/2012 tentang Transparansi dan Publikasi Laporan Bank Syariah dan SEBI No. 15/26/DPbs/2013 tentang Pelaksanaan Pedoman Akuntansi Perbankan Syariah Indonesia. Metode tersebut merupakan bentuk komitmen bank syariah dalam mewujudkan transparansi dan laporan keuangan pada pengakuan keuntungan murabahah. Metode anuitas mengacu pada PSAK 50, PSAK 55, dan PSAK 60 karena secara substansi dikategorikan sebagai bentuk pembiayaan. Metode proporsional mengacu pada PSAK 102 karena secara substansi dikategorikan sebagai bentuk kegiatan jual beli.

  14. In situ X-ray scattering of perovskite solar cell active layers roll-to-roll coated on flexible substrates

    DEFF Research Database (Denmark)

    Rossander, Lea Hildebrandt; Larsen-Olsen, Thue T.; Dam, Henrik Friis

    2016-01-01

    crystallographic developments between the substrates, especially seen through the behaviour of a crystalline precursor which survived longer on the flexible substrates than on glass. Additionally, the common degradation product PbI2 was absent on the thickest flexible substrate. This leads us to conjecture...

  15. Improved Efficiency in Inverted Perovskite Solar Cells Employing a Novel Diarylamino-Substituted Molecule as PEDOT:PSS Replacement

    KAUST Repository

    El Labban, Abdulrahman

    2016-03-15

    An approach to fabricate high-efficiency inverted planar perovskites solar cells using solution-processed organic small molecules hole transporting layer is reported. Devices using CH3NH3PbI3 as photoactive layer and PC60BM as electron transport layer show power conversion efficiencies exceeding 12% and open-circuit voltages (VOC) higher than 1 V.

  16. A Self-Powered and Flexible Organometallic Halide Perovskite Photodetector with Very High Detectivity

    KAUST Repository

    Leung, Siu; Ho, Kang-Ting; Kung, Po-Kai; Hsiao, Vincent K. S.; Alshareef, Husam N.; Wang, Zhong Lin; He, Jr-Hau

    2018-01-01

    Flexible and self-powered photodetectors (PDs) are highly desirable for applications in image sensing, smart building, and optical communications. In this paper, a self-powered and flexible PD based on the methylammonium lead iodide (CH3 NH3 PBI3

  17. The new green revolution

    NARCIS (Netherlands)

    Fresco, Louise O.

    2015-01-01

    <p>By combining scientific excellence with social involvement, M. S. Swaminathan has put himself in the tradition of the great agricultural researchers such as Von Liebich, Vavilov, De Vries, Haber and his friend and colleague Norman Borlaug that have defeated the Spectre of Malthus. His ability to

  18. The influence of dietary calcium and phosphorus on bone metabolism

    NARCIS (Netherlands)

    Schaafsma, G.

    1981-01-01

    <p/>By means of this study it was attempted to obtain a better insight into the possible influence of the diet on the development of human osteoporosis. This disease, which is a consequence of decalcification of the bones, occurs frequently in elderly people, particularly in postmenopausal

  19. Effect of halide-mixing on the switching behaviors of organic-inorganic hybrid perovskite memory

    Science.gov (United States)

    Hwang, Bohee; Gu, Chungwan; Lee, Donghwa; Lee, Jang-Sik

    2017-03-01

    Mixed halide perovskite materials are actively researched for solar cells with high efficiency. Their hysteresis which originates from the movement of defects make perovskite a candidate for resistive switching memory devices. We demonstrate the resistive switching device based on mixed-halide organic-inorganic hybrid perovskite CH3NH3PbI3-xBrx (x = 0, 1, 2, 3). Solvent engineering is used to deposit the homogeneous CH3NH3PbI3-xBrx layer on the indium-tin oxide-coated glass substrates. The memory device based on CH3NH3PbI3-xBrx exhibits write endurance and long retention, which indicate reproducible and reliable memory properties. According to the increase in Br contents in CH3NH3PbI3-xBrx the set electric field required to make the device from low resistance state to high resistance state decreases. This result is in accord with the theoretical calculation of migration barriers, that is the barrier to ionic migration in perovskites is found to be lower for Br- (0.23 eV) than for I- (0.29-0.30 eV). The resistive switching may be the result of halide vacancy defects and formation of conductive filaments under electric field in the mixed perovskite layer. It is observed that enhancement in operating voltage can be achieved by controlling the halide contents in the film.

  20. Global Ionospheric and Thermospheric Effects of the June 2015 Geomagnetic Disturbances : Multi-Instrumental Observations and Modeling

    NARCIS (Netherlands)

    Astafyeva, E; Zakharenkova, I; Huba, J. D.; Doornbos, E.N.; van den IJssel, J.A.A.

    2017-01-01

    <p>By using data from multiple instruments, we investigate ionospheric/thermospheric behavior during the period from 21 to 23 June 2015, when three interplanetary shocks (IS) of different intensities arrived at Earth. The first IS was registered at 16:45 UT on 21 June and caused ~50 nT increase in

  1. Lead iodide perovskite sensitized all-solid-state submicron thin film mesoscopic solar cell with efficiency exceeding 9%.

    KAUST Repository

    Kim, Hui-Seon

    2012-08-21

    We report on solid-state mesoscopic heterojunction solar cells employing nanoparticles (NPs) of methyl ammonium lead iodide (CH(3)NH(3))PbI(3) as light harvesters. The perovskite NPs were produced by reaction of methylammonium iodide with PbI(2) and deposited onto a submicron-thick mesoscopic TiO(2) film, whose pores were infiltrated with the hole-conductor spiro-MeOTAD. Illumination with standard AM-1.5 sunlight generated large photocurrents (J(SC)) exceeding 17 mA/cm(2), an open circuit photovoltage (V(OC)) of 0.888 V and a fill factor (FF) of 0.62 yielding a power conversion efficiency (PCE) of 9.7%, the highest reported to date for such cells. Femto second laser studies combined with photo-induced absorption measurements showed charge separation to proceed via hole injection from the excited (CH(3)NH(3))PbI(3) NPs into the spiro-MeOTAD followed by electron transfer to the mesoscopic TiO(2) film. The use of a solid hole conductor dramatically improved the device stability compared to (CH(3)NH(3))PbI(3) -sensitized liquid junction cells.

  2. Comparison of radiogrammetrical metacarpal indices in children and reference data from the First Zurich Longitudinal Study

    Energy Technology Data Exchange (ETDEWEB)

    Martin, David D.; Heckmann, Conrad; Neuhof, Julia; Ranke, Michael B.; Binder, Gerhard [University Children' s Hospital Tuebingen, Pediatric Endocrinology and Diabetology, Tuebingen (Germany); Jenni, Oskar G. [University Children' s Hospital, Child Development Centre, Zurich (Switzerland)

    2012-08-15

    A number of radiogrammetrical metacarpal indices are in use, some of which have been adapted for children. The purpose of this study was to compare four known indices - bone mineral density (BMD), relative cortical area, Exton-Smith index, bending breaking resistance index - and the more recently defined pediatric bone index (PBI) according to the two criteria of minimum height dependence and minimum variability in children of equal bone age. A total of 3,121 left-hand radiographs from 231 healthy Caucasian children ranging in age from 3 to 19 years old were analysed using BoneXpert {sup registered}, a programme for automatic analysis of hand radiographs and assessment of bone age. Dependence on height for chronological age or bone age and the mean relative standard deviation were lowest in the PBI for both genders pooled. The differences in height dependence were statistically significant and are shown to be clinically relevant. Reference data for PBI are presented. PBI may be a better indicator than BMD for bone health in children; however, verification in a clinical group is needed. (orig.)

  3. Functional Behavioral Assessment for a Boy with Duchenne Muscular Dystrophy and Problem Behavior: A Case Study from Greece

    Science.gov (United States)

    Theodoridou, Zoe; Koutsoklenis, Athanasios

    2013-01-01

    This article focuses on the application of functional behavioral assessment (FBA) to design a positive behavior intervention (PBI) for a boy with Duchenne muscular dystrophy (DMD) who encounters serious difficulties at the mainstream school because of behavioral problems and physical limitations. After the definition of problem behavior and its…

  4. High Molecular Weight Polybenzimidazole Membranes for High Temperature PEMFC

    DEFF Research Database (Denmark)

    Yang, Jingshuai; Cleemann, Lars Nilausen; Steenberg, T.

    2014-01-01

    High temperature operation of proton exchange membrane fuel cells under ambient pressure has been achieved by using phosphoric acid doped polybenzimidazole (PBI) membranes. To optimize the membrane and fuel cells, high performance polymers were synthesized of molecular weights from 30 to 94 kDa w...

  5. High temperature proton exchange membranes based on polybenzimidazole and clay composites for fuel cells

    DEFF Research Database (Denmark)

    Plackett, David; Siu, Ana; Li, Qingfeng

    2011-01-01

    dispersion of modified laponite clay was achieved in polybenzimidazole (PBI) solutions which, when cast and allowed to dry, resulted in homogeneous and transparent composite membranes containing up to 20 wt% clay in the polymer. The clay was organically modified using a series of ammonium and pyr...

  6. Binderless electrodes for high-temperature polymer electrolyte membrane fuel cells

    DEFF Research Database (Denmark)

    Fernandez, Santiago Martin; Li, Qingfeng; Steenberg, Thomas

    2014-01-01

    A new electrode concept was proved with no polymeric binder in the catalyst layer for acid-doped polybenzimidazole (PBI) membrane fuel cells. It shows that a stable interface between the membrane and the catalyst layer can be retained when a proton conducting acid phase is established. The absenc...

  7. Performance Degradation Tests of Phosphoric Acid Doped Polybenzimidazole Membrane Based High Temperature Polymer Electrolyte Membrane Fuel Cells

    DEFF Research Database (Denmark)

    Zhou, Fan; Araya, Samuel Simon; Grigoras, Ionela

    2015-01-01

    Degradation tests of two phosphoric acid (PA) doped PBI membrane based HT-PEM fuel cells were reported in this paper to investigate the effects of start/stop and the presence of methanol in the fuel to the performance degradation of the HT-PEM fuel cell. Continuous tests with pure dry H2 and meth...

  8. Soft Body Armor: An Overview of Materials, Manufacturing, Testing, and Ballistic Impact Dynamics

    Science.gov (United States)

    2011-08-01

    Atlantic Treaty Organization NIJ National Institute of Justice OTV Outer tactical vest PBI Polybenzimidazole PBO Polybenzobisoxazole PET ...grenades and mortar rounds, is performed in accordance with the North Atlantic Treaty Organization (NATO) Standardization Agreement (STANAG) 2920.6...LEVELS IN SOFT BODY ARMOR The design of woven fabrics for armor applications is complex because it requires an understanding of the related

  9. Determination of lead at nanogram level in water samples by ...

    African Journals Online (AJOL)

    A novel method of chemistry applicable to the determination of trace lead in water samples based on the resonance light scattering (RLS) technique has been developed. In dilute phosphoric acid medium, in the presence of a large excess of I-, Pb(II) can form [PbI4]2-, which further reacts with tetrabutyl ammonium bromide ...

  10. Model Compound Studies of Rigid Rod Aromatic Heterocyclic Polymer Systems, the X-Ray Crystal Structure of 2,6-Diphenylbenzo (1,2-d; 5,4-d’) Diimidazole Tetrahydrate, C2OH14N4. 4H2O, a Model System for the Study of Polymer-Water Interaction in Polybenzimidazoles.

    Science.gov (United States)

    1983-07-01

    begin to degrade . The strong affinity for water is manifested by the ability of PBI’s to dry desiccant! Further- more, the observation that crystals of...25. G. M. Brown (1969), "The Crystal Structure of 6- Mercaptopurine Monohydrate," Acta Crystallogr., 3, 210-214. 26. J. Sletten and L. H. Jensen

  11. Fast Crystallization and improved Stability of Perovskite Solar Cells with Zn 2 SnO 4 Electron Transporting Layer: Interface Matters

    KAUST Repository

    Bera, Ashok; Sheikh, Arif D.; Haque, Mohammed; Bose, Riya; Alarousu, Erkki; Mohammed, Omar F.; Wu, Tao

    2015-01-01

    conversion efficiency of 13.34%, which is even higher than that achieved with the commonly used TiO2 in the similar experimental conditions (9.1%). Simple one-step spin coating of CH3NH3PbI3−xClx on Zn2SnO4 is found to lead to rapidly crystalized bilayer

  12. Patterning and photoluminescent properties of perovskite-type organic/inorganic hybrid luminescent films by soft lithography

    Science.gov (United States)

    Cheng, Z. Y.; Wang, Z.; Xing, R. B.; Han, Y. C.; Lin, J.

    2003-07-01

    Perovskite-type organic/inorganic hybrid layered compound (C 6H 5C 2H 4NH 3) 2PbI 4 was synthesized. The patterning of (C 6H 5C 2H 4NH 3) 2PbI 4 thin films on silicon substrate was realized by the micromolding in capillaries (MIMIC) process, a kind of soft lithography. Bright green luminescent stripes with different widths (50, 15, 0.8 μm) have been obtained. The structure and optical properties of (C 6H 5C 2H 4NH 3) 2PbI 4 films were characterized by X-ray diffraction (XRD), UV/Vis absorption and photoluminescence excitation and emission spectra, respectively. It is shown that the organic-inorganic layered (C 6H 5C 2H 4NH 3) 2PbI 4 film was c-axis oriented, paralleling to the substrate plane. Green exciton emission at 525 nm was observed in the film, and the explanations for it were given.

  13. Method of operating a direct dme fuel cell system

    DEFF Research Database (Denmark)

    2011-01-01

    The present invention relates to a method of operating a fuel cell system comprising one or more fuel cells with a proton exchange membrane, wherein the membrane is composed of a polymeric material comprising acid-doped polybenzimidazole (PBI). The method comprises adjusting the operating...

  14. Nitrogen and energy metabolism of sows during several reproductive cycles in relation to nitrogen intake

    NARCIS (Netherlands)

    Everts, H.

    1994-01-01

    <p>By feeding the same diet during pregnancy and lactation sows are fed above the nitrogen requirement during pregnancy due to the relatively high nitrogen requirement during lactation. For feeding closer to the requirements at least two diets are needed: one diet with a low nitrogen content

  15. Propolis-Sahara honeys preparation exhibits antibacterial and anti-biofilm activity against bacterial biofims formed on urinary catheters

    Directory of Open Access Journals (Sweden)

    Saad Aissat

    2016-11-01

    Full Text Available Objective: To evaluate the antibacterial effect of Sahara honeys (SHs against bacterial biofilms formed on urinary catheters in combination with propolis-Sahara honeys (P-SHs. Methods: Three clinical isolates were subjected to biofilm detection methods. The antibacterial and anti-biofilm activity for SHs and P-SHs were determined using agar well diffusion and the percentage of biofilm inhibition (PBI methods. Results: The PBI for Gram-positive bacteria [Staphylococcus aureus (S. aureus] was in the range of 0%–20%, while PBI for Gram-negative bacteria [Pseudomonas aeruginosa and Escherichia coli (E. coli] were in range of 17%–57% and 16%–65%, respectively. The highest PBI (65% was produced by SH2 only on E. coli. In agar well diffusion assay, zones of inhibition ranged from 11–20 mm (S. aureus, 9–19 mm (Pseudomonas aeruginosa and 11–19 mm (E. coli. The highest inhibition (20 mm was produced by SH1 only on S. aureus. In addition, the treatment of SHs and P-SHs catheters with a polymicrobial biofilms reduced biofilm formation after 48 h exposure period. Conclussions: SHs and P-SHs applied as a natural agent can be used as a prophylactic agent to prevent the formation of in vitro biofilm.

  16. Persistent Teaching Practices after Geospatial Technology Professional Development

    Science.gov (United States)

    Rubino-Hare, Lori A.; Whitworth, Brooke A.; Bloom, Nena E.; Claesgens, Jennifer M.; Fredrickson, Kristi M.; Sample, James C.

    2016-01-01

    This case study described teachers with varying technology skills who were implementing the use of geospatial technology (GST) within project-based instruction (PBI) at varying grade levels and contexts 1 to 2 years following professional development. The sample consisted of 10 fifth- to ninth-grade teachers. Data sources included artifacts,…

  17. Effects of High Temperature and Thermal Cycling on the Performance of Perovskite Solar Cells: Acceleration of Charge Recombination and Deterioration of Charge Extraction

    KAUST Repository

    Sheikh, Arif D.; Munir, Rahim; Haque, Mohammed; Bera, Ashok; Hu, Weijin; Shaikh, Parvez Abdul Ajij; Amassian, Aram; Wu, Tao

    2017-01-01

    In this work, we investigated the effects of high operating temperature and thermal cycling on the photovoltaic performance of perovskite solar cells (PSCs) with a typical mesostructured (m)-TiO2-CH3NH3PbI3-xClx-spiro-OMeTAD architecture. After

  18. The Role of Connectivity on Electronic Properties of Lead Iodide Perovskite-Derived Compounds

    NARCIS (Netherlands)

    Kamminga, Machteld E; De Wijs, Gilles; Havenith, Remco W A; Blake, Graeme R; Palstra, Thomas T M

    2017-01-01

    We use a layered solution crystal growth method to synthesize high-quality single crystals of two different benzylammonium lead iodide perovskite-like organic/inorganic hybrids. The well-known (C6H5CH2NH3)(2)PbI4 phase is obtained in the form of bright orange platelets, with a structure comprised of

  19. Micropatterned 2D Hybrid Perovskite Thin Films with Enhanced Photoluminescence Lifetimes

    NARCIS (Netherlands)

    Kamminga, Machteld E.; Fang, Hong Hua; Loi, Maria Antonietta; Ten Brink, Gert H.; Blake, Graeme R.; Palstra, Thomas T.M.; Ten Elshof, Johan E.

    2018-01-01

    The application of luminescent materials in display screens and devices requires micropatterned structures. In this work, we have successfully printed microstructures of a two-dimensional (2D), orange-colored organic/inorganic hybrid perovskite ((C6H5CH2NH3)2PbI4) using two different soft

  20. Polybenzimidazole-based mixed membranes with exceptional high water vapor permeability and selectivity

    KAUST Repository

    Akhtar, Faheem Hassan; Kumar, Mahendra; Villalobos, Luis Francisco; Shevate, Rahul; Vovusha, Hakkim; Schwingenschlö gl, Udo; Peinemann, Klaus-Viktor

    2017-01-01

    Polybenzimidazole (PBI), a thermal and chemically stable polymer, is commonly used to fabricate membranes for applications like hydrogen recovery at temperatures of more than 300 °C, fuel cells working in a highly acidic environment, and nanofiltration in aggressive solvents. This report shows for the first time use of PBI dense membranes for water vapor/gas separation applications. They showed an excellent selectivity and high water vapor permeability. Incorporation of inorganic hydrophilic titanium-based nano-fillers into the PBI matrix further increased the water vapor permeability and water vapor/N2 selectivity. The most selective mixed matrix membrane with 0.5 wt% loading of TiO2 nanotubes yielded a water vapor permeability of 6.8×104 Barrer and a H2O/N2 selectivity of 3.9×106. The most permeable membrane with 1 wt% loading of carboxylated TiO2 nanoparticles had a 7.1×104 Barrer water vapor permeability and a H2O/N2 selectivity of 3.1×106. The performance of these membranes in terms of water vapor transport and selectivity is among the highest reported ones. The remarkable ability of PBI to efficiently permeate water versus other gases opens the possibility to fabricate membranes for dehumidification of streams in harsh environments. This includes the removal of water from high temperature reaction mixtures to shift the equilibrium towards products.