Isolation, characterization, antibiogram and pathology of Pasteurella multocida isolated from pigs

Directory of Open Access Journals (Sweden)

Mamta Tigga

2014-05-01

Full Text Available Aim: Isolation, characterization and antibiogram of Pasteurella multocida from diseased pigs of district Durg of Chhattisgarh, and to study pathological changes caused by swine pasteurellosis. Materials and Methods: An outbreak of swine pasteurellosis was suspected in pigs of Ruwabandha (Bhilai, Anjora, Somni, Tedesara, Tirgajhola villages of Durg district in Chhattisgarh, India during August and September of 2011. Nasal Swabs and blood samples from ailing pigs and heart blood and impression smears from morbid pigs were processed for detection and isolation of P. multocida by bacteriological methods. Detailed necropsy was conducted and gross and histopathological lesions were recorded. The test Isolates were subjected to antimicrobial sensitivity profile by disc-diffusion method. Results: The blood smears from heart blood and tissue impression smears revealed teaming of bipolar organisms indicating the presence of Pasteurella spp. The isolates obtained were subjected to Gram's staining for checking the purity and bipolar morphology and characterized biochemically. Gross lesions included severe acute pneumonia and haemorrhages in lungs, petechial haemorrhages on serous membranes and other visceral organs. On histopathological examination, lungs showed typical fibrinous bronchopneumonia, multifocal suppuration. All the isolates of P. multocida were 100% sensitive to Amoxicillin, Gentamicin, Enrofloxacin and showed100% resistance to Ceftizoxim and Cloxacillin. Conclusion: Gross and microscopic lesions in dead animals are of great diagnostic value and are of characteristic of P. multocida infection. Cultural, morphological and biochemical characters are useful to rule out the causative agent as P. multocida. Antibiotic sensitivity pattern of the isolates should routinely be carried out for knowing the antibiotic resistance trends in an endemic area.

Restriction endonuclease analysis of Pasteurella multocida isolates from three California turkey premises.

Science.gov (United States)

Christiansen, K H; Carpenter, T E; Snipes, K P; Hird, D W; Ghazikhanian, G Y

1992-01-01

Three California turkey premises that had repeated outbreaks of fowl cholera were studied for periods of 2 to 4 years. Using biochemical, serologic, plasmid DNA, and restriction endonuclease analyses of isolates of Pasteurella multocida from turkeys and wildlife on the premises, strains of the organism were found to be enzootic on two of the premises. On the third, a variety of strains of P. multocida were isolated from fowl cholera outbreak flocks.

Revised description and classification of atypical isolates of Pasteurella multocida from bovine lungs based on genotypic characterization to include variants previously classified as biovar 2 of Pasteurella canis and Pasteurella avium

DEFF Research Database (Denmark)

Christensen, Henrik; Angen, Øystein; Olsen, John E.

2004-01-01

Strains deviating in key phenotypic characters, mainly isolated from cases of bovine pneumonia in five European countries, were genotyped in order to examine their genotypic relationship with Pasteurella multocida. Twenty-two strains of Pasteurella avium biovar 2, including variants in indole, xy...

Transmission of Pasteurella multocida on California turkey premises in 1988-89.

Science.gov (United States)

Christiansen, K H; Carpenter, T E; Snipes, K P; Hird, D W

1992-01-01

Restriction endonuclease analysis (REA) of whole-cell DNA was used to determine possible sources of Pasteurella multocida for each outbreak of fowl cholera occurring in turkey flocks in eight commercial poultry companies in California from October 1988 to September 1989. Over this period, 179 isolates of P. multocida were obtained from dead turkeys in 80 meat and breeder flocks on 43 premises. P. multocida was isolated from wildlife on five premises. Isolates were characterized by subspecies, serotype, presence of plasmid DNA, and REA type. In 52 (65%) flocks, all isolates of P. multocida had the same REA pattern as the M9 live vaccine strain following digestion of DNA with the restriction enzyme SmaI. Field strains of P. multocida were obtained from 27 (34%) flocks, and one flock (1%) yielded both M9 and a field strain of the organism. REA of field strains of P. multocida revealed 17 different SmaI REA types. Based on matching SmaI REA types, potential sources of P. multocida were identified for 15 of the 28 flocks infected with field strains of the organism, and transmission between turkey premises was a possibility in only seven flocks.

Host Response in Rabbits to Infection with Pasteurella multocida Serogroup F Strains Originating from Fowl Cholera

Science.gov (United States)

The ability of two avian Pasteurella multocida serogroup F strains to induce disease in rabbits was investigated in this study. Two groups of 18 Pasteurella-free rabbits each were intranasally challenged with strains isolated from chicken and turkey, respectively. Half the animals in each challenge ...

Utilization of L-aspartate, L-malate and fumarate by Pasteurella multocida

Energy Technology Data Exchange (ETDEWEB)

Hoefer, M.; Flossmann, K.D. (Akademie der Landwirtschaftswissenschaften der DDR, Jena. Inst. fuer Bakterielle Tierseuchenforschung)

1981-01-01

Strains of Pasteurella multocida use L-aspartate, L-malate and furmarate, respectively, as substrates for production of succinic acid which accumulates in the medium. As was established by studies with /sup 14/C- and /sup 3/H-labelled substrates, the degradation of these substances proceeds analogously via the citric acid cycle.

Utilization of L-aspartate, L-malate and fumarate by Pasteurella multocida

International Nuclear Information System (INIS)

Hoefer, M.; Flossmann, K.D.

1981-01-01

Strains of Pasteurella multocida use L-aspartate, L-malate and furmarate, respectively, as substrates for production of succinic acid which accumulates in the medium. As was established by studies with 14 C- and 3 H-labelled substrates, the degradation of these substances proceeds analogously via the citric acid cycle. (author)

The pathogenesis of Pasteurella multocida local isolates in mice and chicken

Directory of Open Access Journals (Sweden)

Supar

2000-03-01

Full Text Available Avian cholera or fowl cholera is a bacterial disease caused by Pasteurella multocida strain of serogroup A, has been recognized as important disease in domestic poultry such as ducks and chicken. P. multocida strains derived from overseas and local isolates are stored as freeze dried and kept at the Research hlstitute for Veterinary Science (BALITVET culture collection (BCC. Some of those bacteria are still alive and can be used as vaccine candidates. Each strain or isolate was activated in brain heart infusion broth containing foetal calf serum and incubated at 37°C then it was identitied by biochemical reactions. Field surveys Were conducted in Central Java and South Kalimantan to observe fowl cholera problems and sample collections for isolation of pathogens. Of the 14 of Pasteurella multocida strains or isolates from BCC, II strains (9 imported 2 local isolates were still alive. In addition to this 2 isolates trom chicken and duck were viable. Seven out of 9 imported strains killed mice within 3 x 24 hours, similarly for the local isolates (BCC 299, 2331, DYI, DY2, 12TG, 15TG. However, the only BCC 2331 and DY2 isolates were able to kill two week old chicken witIlin 6 x 24 hours post inoculation. From this experiment indicated that the P. multocida local isolates (BCC 2,331 and DY2 are more pathogenic than that of imported strains. Two strains of imported P. multocida BCC 2331, 1362 and 6 local isolates (BCC 299, 2331, DYI, DY2, 12TG and 15TG would be selected for mono- and polyvalent vaccine candidates in the following experiments and the highly patogenic BCC 2331 and DY2 isolates would be used to challenge the vaccinated animals.

Plasmid DNA Analysis of Pasteurella multocida Serotype B isolated from Haemorrhagic Septicaemia outbreaks in Malaysia

Directory of Open Access Journals (Sweden)

Jamal, H.

2005-01-01

Full Text Available A total of 150 purified isolates of Pasteurella multocida serotype B were used (Salmah, 2004 for plasmid DNA curing experiment to determine hyaluronidase activity, antibiotic resistance pattern (ARP and mice lethality test (LD50 for their role of pathogenicity. A plasmid curing experiment was carried out by using the intercalating agent; ethidium bromide and rifampicin, where it was found all the plasmids had been cured (plasmidless from Pasteurella multocida. All of these plasmidless isolates maintained their phenotypic characteristics. They showed the same antibiotic resistancepattern as before curing, produced hyaluronidase and possessed lethality activity in mice when injected intraperitoneally(i.p. Based on this observation, the antibiotic resistance, hyaluronidase activity and mice virulence could probably be chromosomal-mediated. Plasmids were detected 100% in all P. multocida isolates with identical profile of 2 plasmids size 3.0 and 5.5 kb. No large plasmids could be detected in all isolates. Since all the isolates appeared to have identicalplasmid profiles, they were subjected to restriction enzyme(RE analysis. From RE analysis results obtained, it can be concluded that the plasmid DNA in serotype B isolates are identical. Only 4 of 32 REs were found to cleave these plasmids with identical restriction fingerprints; BglII, HaeIII, RsaI and SspI. From RE analysis results, it can be concluded that the plasmid DNA isolates are identical. This plasmid might not played any role in pathogenicity of Pasteurella multocida serotype B, however this information is important for the construction of shuttle vectors in genetic studies of the pathogenicity of haemorrhagic septicaemia(HS.

Pneumonia in calves produced with aerosols of Pasteurella multocida alone and in combination with bovine herpesvirus 1.

OpenAIRE

Jericho, K W; Carter, G R

1985-01-01

Pathological changes in respiratory tracts were studied in 30 calves following exposure to aerosols of Pasteurella multocida or to bovine herpesvirus 1 and P. multocida. Two groups of five calves were exposed to aerosols of one of two types of P. multocida only, which produced lobar pneumonia in one calf of each group. Another five groups of four calves were exposed to aerosols of bovine herpesvirus 1 and four to seven days later to one of the two types or one sub-type of P. multocida. Extens...

Pasteurella multocida Involved in Respiratory Disease of Wild Chimpanzees

Science.gov (United States)

Köndgen, Sophie; Leider, Michaela; Lankester, Felix; Bethe, Astrid; Lübke-Becker, Antina; Leendertz, Fabian H.; Ewers, Christa

2011-01-01

Pasteurella multocida can cause a variety of diseases in various species of mammals and birds throughout the world but nothing is known about its importance for wild great apes. In this study we isolated P. multocida from wild living, habituated chimpanzees from Taï National Park, Côte d'Ivoire. Isolates originated from two chimpanzees that died during a respiratory disease outbreak in 2004 as well as from one individual that developed chronic air-sacculitis following this outbreak. Four isolates were subjected to a full phenotypic and molecular characterisation. Two different clones were identified using pulsed field gel electrophoresis. Multi Locus Sequence Typing (MLST) enabled the identification of previous unknown alleles and two new sequence types, ST68 and ST69, were assigned. Phylogenetic analysis of the superoxide dismutase (sodA) gene and concatenated sequences from seven MLST-housekeeping genes showed close clustering within known P. multocida isolated from various hosts and geographic locations. Due to the clinical relevance of the strains described here, these results make an important contribution to our knowledge of pathogens involved in lethal disease outbreaks among endangered great apes. PMID:21931664

Comparative genome analysis of an avirulent and two virulent strains of avian Pasteurella multocida reveals candidate genes involved in fitness and pathogenicity

Science.gov (United States)

Fowl cholera is a highly contagious systemic disease affecting wild and domestic birds, frequently resulting in high morbidity and mortality. The causative agent is Pasteurella multocida (P. multocida). The completed genome of P. multocida strain Pm70 has been available for over eleven years and has...

Antimicrobial susceptibility of Pasteurella multocida and Haemophilus parasuis isolates associated with porcine pneumonia

Directory of Open Access Journals (Sweden)

Kateřina Nedbalcová

2013-01-01

Full Text Available Pasteurella multocida and Haemophilus parasuis pig isolates obtained in the Czech Republic were tested for their susceptibility against selected antimicrobial agents by broth microdilution method between 2008 and 2011. A low degree of resistance was observed for ampicillin, amoxicillin/clavulanic acid, ceftiofur, tulathromycin, tilmicosin, florfenicol and enrofloxacin in 20 (6.0%, 15 (4.5 %, 2 (0.6%, 8 (2.4%, 13 (3.9%, 5 (1.5% and 5 (1.5% P. multocida isolates as well as for tiamulin, gentamicin, tulathromycin, tilmicosin and ampicillin in 2 (2.4%, 2 (2.4%, 3 (3.6%, 3 (3.6% and 6 (7.2% H. parasuis isolates. In addition, moderate level of resistance to tiamulin was found in 60 (18.1% P. multocida isolates and high level of resistance for tetracycline was detected in 107 (32.2 % P. multocida isolates and in 23 (27.7 % H. parasuis isolates. Differences between resistance rates of P. multocida and H. parasuis were significant (P ≤ 0.5 only for tiamulin. These data confirmed that antimicrobial resistance is not very widespread among current porcine P. multocida and H. parasuis isolates in the Czech Republic.

Characterization of sucrose-negative Pasteurella multocida variants, including isolates from large-cat bite wounds

DEFF Research Database (Denmark)

Christensen, Henrik Grimmig; Bisgaard, Magne; Angen, Øystein

2005-01-01

To validate the identification of Pasteurella multocida-like bacteria negative for acid formation from sucrose, including isolates from bite wounds caused by large cats, 17 strains were phenotypically and genotypically characterized. Phylogenetic analysis of partially sequenced rpoB and infB genes...... showed the monophyly of the strains characterized and the reference strains of P. multocida. The sucrose-negative strains formed two groups, one related to reference strains of P. multocida and the other related to a separate species-like group (taxon 45 of Bisgaard). DNA-DNA hybridization further...... and the reference strains of P. multocida. Two strains isolated from leopard bite wounds were related to the type strain of P. dagmatis; however, they represented a new taxon (taxon 46 of Bisgaard), in accordance with their distinct phenotypic and genotypic identifications. The present study documents that sucrose-negative...

Effect of aerial ammonia on porcine infection of the respiratory tract with toxigenic Pasteurella multocida

DEFF Research Database (Denmark)

Andreasen, Morten; Bækbo, P.; Nielsen, J.P.

1999-01-01

The objective of the experimental study was to examine whether aerial ammonia alone could predispose the respiratory system of pigs to infection with toxigenic Pasteurella multocida type A. Two groups of 5 pigs each were continuously exposed to 50 ppm ammonia and less than 5 ppm ammonia...

Associations between water quality, Pasteurella multocida, and avian cholera at Sacramento National Wildlife Refuge

Science.gov (United States)

Lehr, M.A.; Botzler, R.G.; Samuel, M.D.; Shadduck, D.J.

2005-01-01

We studied patterns in avian cholera mortality, the presence of Pasteurella multocida in the water or sediment, and water chemistry characteristics in 10 wetlands at the Sacramento National Wildlife Refuge Complex (California, USA), an area of recurrent avian cholera epizootics, during the winters of 1997 and 1998. Avian cholera outbreaks (a?Y50 dead birds) occurred on two wetlands during the winter of 1997, but no P. multocida were recovered from 390 water and 390 sediment samples from any of the 10 wetlands. No mortality events were observed on study wetlands during the winter of 1998; however, P. multocida was recovered from water and sediment samples in six of the 10 study wetlands. The pH levels were higher for wetlands experiencing outbreaks during the winter of 1997 than for nonoutbreak wetlands, and aluminum concentrations were higher in wetlands from which P. multocida were recovered during the winter of 1998. Water chemistry parameters (calcium, magnesium, sodium, and dissolved protein) previously linked with P. multocida and avian cholera mortality were not associated with the occurrence of avian cholera outbreaks or the presence of P. multocida in our study wetlands. Overall, we found no evidence to support the hypothesis that wetland characteristics facilitate the presence of P. multocida and, thereby, allow some wetlands to serve as long-term sources (reservoirs) for P. multocida.

The Capsule Is a Virulence Determinant in the Pathogenesis of Pasteurella multocida M1404 (B:2)

OpenAIRE

Boyce, John D.; Adler, Ben

2000-01-01

Capsules from a range of pathogenic bacteria are key virulence determinants, and the capsule has been implicated in virulence in Pasteurella multocida. We have previously identified and determined the nucleotide sequence of the P. multocida M1404 (B:2) capsule biosynthetic locus (J. D. Boyce, J. Y. Chung, and B. Adler, Vet. Microbiol. 72:121–134, 2000). The cap locus consists of 15 genes, which can be grouped into three functional regions. Regions 1 and 3 contain genes proposed to encode prot...

Virulence Genes and Antimicrobial Resistance Profiles of Pasteurella multocida Strains Isolated from Rabbits in Brazil

Directory of Open Access Journals (Sweden)

Thais Sebastiana Porfida Ferreira

2012-01-01

Full Text Available Pasteurella multocida is responsible for a wide range of diseases in domestic animals. In rabbits, the agent is related to nasal discharge, pneumonia, otitis media, pyometra, orchitis, abscess, and septicemia. One hundred and forty rabbits with respiratory diseases from four rabbitries in São Paulo State, Brazil were evaluated for the detection of P. multocida in their nasal cavities. A total of twenty-nine animals were positive to P. multocida isolation, and 46 strains were selected and characterized by means of biochemical tests and PCR. P. multocida strains were tested for capsular type, virulence genes, and resistance profile. A total of 45.6% (21/46 of isolates belonged to capsular type A, and 54.34% (25/46 of the isolates were untypeable. None of the strains harboured toxA or pfhA genes. The frequency of the other twenty genes tested was variable, and the data generated was used to build a dendrogram, showing the relatedness of strains, which were clustered according to origin. Resistance revealed to be more common against sulfonamides and cotrimoxazole, followed by erythromycin, penicillin, and amoxicillin.

Lack of effect of aerial ammonia on atrophic rhinitis and pneumonia induced by Mycoplasma hyopneumoniae and toxigenic Pasteurella multocida

DEFF Research Database (Denmark)

Andreasen, Morten; Bækbo, P.; Nielsen, Jens

2000-01-01

The objective of this experimental study was to determine the effects of aerial ammonia on disease development and bacterial colonization in weaned pigs inoculated with toxigenic Pasteurella multocida and Mycoplasma hyopneumoniae. Two groups of 10 pigs each were continuously exposed to 50 and 100 p.......p.m ammonia, respectively, and compared to a non-exposed control, group of 20 pigs. Following aerosol inoculation with M. hyopneumoniae at day 9, ail pigs were aerosol-inoculated with toxigenic P. multocida type A at days 28, 42 and 56. Ac day 63 they were euthanized. Clinical signs including coughing...... with inoculations with M. hyopneumoniae and toxigenic P. multocida had no significant effect on disease development, but may have enhanced colonization by toxigenic P. multocida on the nasal turbinates....

Anatomopathological pneumonic aspects associated with highly pathogenic Pasteurella multocida in finishing pigs

Directory of Open Access Journals (Sweden)

Eliana S. Paladino

Full Text Available ABSTRACT: The bacterium Pasteurella multocida is a frequent cause of porcine respiratory disease complex in finishing pigs. Historically, the bacterium is recognized as an opportunistic agent, causing secondary bacterial pneumonia in pigs. Several Brazilian reports have suggested the ability of P. multocida to cause primary pulmonary infection that leads to the death of finishing pigs prior to slaughter. The aim of this study was to evaluate anatomopathological pulmonary findings associated with P. multocida infection that were obtained from animals with clinical respiratory disease and from animals at slaughter. Twenty-five lung samples from 14 herds of finishing pigs with acute clinical respiratory disease and 19 lungs collected at slaughter from a different set of 14 herds were studied. In all lung samples, bacterial isolation was performed, and only samples with pure P. multocida growth were included in the study. Gross and histopathological lesions were evaluated, as well as Influenza A, porcine circovirus type 2 (PCV2 and Mycoplasma hyopneumoniae co-infections. Pleuritis and pericarditis were more often observed in clinical samples (P<0.05. Moreover, there was a numerical trend indicating that pericarditis, lymphadenomegaly and cavity exudates were more often present in clinical samples. Thirteen lung samples were negative to M. hyopneumoniae, Influenza A and PCV2 by immunohistochemistry (IHC, with only P. multocida identified. In these cases, gross lesions such as pleuritis, pericarditis and lymphadenomegaly were always present, and no histologic lesions indicative of other agents such as Actinobacillus pleuropneumoniae, Actinobacillus suis or Haemophilus parasuis were observed. These findings suggest the ability of some P. multocida isolates to cause primary respiratory and systemic infection. However, in this study, it was not possible to determine specific virulence markers to explain these findings.

Capsular Polysaccharide Interferes with Biofilm Formation by Pasteurella multocida Serogroup A

Directory of Open Access Journals (Sweden)

Briana Petruzzi

2017-11-01

Full Text Available Pasteurella multocida is an important multihost animal and zoonotic pathogen that is capable of causing respiratory and multisystemic diseases, bacteremia, and bite wound infections. The glycosaminoglycan capsule of P. multocida is an essential virulence factor that protects the bacterium from host defenses. However, chronic infections (such as swine atrophic rhinitis and the carrier state in birds and other animals may be associated with biofilm formation, which has not been characterized in P. multocida. Biofilm formation by clinical isolates was inversely related to capsule production and was confirmed with capsule-deficient mutants of highly encapsulated strains. Capsule-deficient mutants formed biofilms with a larger biomass that was thicker and smoother than the biofilm of encapsulated strains. Passage of a highly encapsulated, poor-biofilm-forming strain under conditions that favored biofilm formation resulted in the production of less capsular polysaccharide and a more robust biofilm, as did addition of hyaluronidase to the growth medium of all of the strains tested. The matrix material of the biofilm was composed predominately of a glycogen exopolysaccharide (EPS, as determined by gas chromatography-mass spectrometry, nuclear magnetic resonance, and enzymatic digestion. However, a putative glycogen synthesis locus was not differentially regulated when the bacteria were grown as a biofilm or planktonically, as determined by quantitative reverse transcriptase PCR. Therefore, the negatively charged capsule may interfere with biofilm formation by blocking adherence to a surface or by preventing the EPS matrix from encasing large numbers of bacterial cells. This is the first detailed description of biofilm formation and a glycogen EPS by P. multocida.

Serotypes and DNA fingerprint profiles of Pasteurella multocida isolated from raptors

Science.gov (United States)

Wilson, M.A.; Duncan, R.M.; Nordholm, G.E.; Berlowski, B.M.

1995-01-01

Pasteurella multocida isolates from 21 raptors were examined by DNA fingerprint profile and serotyping methods. Isolates were obtained from noncaptive birds of prey found in 11 states from November 28, 1979, through February 10, 1993. Nine isolates were from bald eagles, and the remaining isolates were from hawks, falcons, and owls. Seven isolates were members of capsule group A, and 14 were nonencapsulated. One isolate was identified as somatic type 3, and another was type 3,4,7; both had unique HhaI DNA fingerprint profiles. Nineteen isolates expressed somatic type 1 antigen; HhaI profiles of all type 1 isolates were identical to each other and to the HhaI profile of the reference somatic type 1, strain X-73. The 19 type 1 isolates were differentiated by sequential digestion of DNA with HpaII; four HpaII fingerprint profiles were obtained. The HpaII profile of one isolate was identical to the HpaII profile of strain X-73. Incidence of P. multocida somatic type 1 in raptors suggests that this type may be prevalent in other wildlife or wildlife environments.

Phenotypic and genotypic characters of isolates of Pasteurella multocida obtained from back-yard poultry and from two outbreaks of avian cholera in avifauna in Denmark

DEFF Research Database (Denmark)

Christensen, J.P.; Dietz, Hans-Henrik; Bisgaard, M.

1998-01-01

Two outbreaks of fowl cholera in the avifauna in Denmark, affecting primarily elders but also cormorants, gulls and oyster-catchers were shown to be caused by the same clone of Pasteurella multocida ssp, multocida by restriction enzyme analysis (REA) and ribotyping, using the enzymes HpaII and Hha...

Meningencefalite por Pasteurella multocida: estudo clínico-laboratorial de um caso em lactente

Directory of Open Access Journals (Sweden)

C. E. Levy

1989-12-01

Full Text Available Os autores apresentam descrição clínico-laboratorial e evolutiva do caso de lactente com o diagnóstico de meningencefalite por Pasteurella multocida que apresentou na evolução atraso neuromotor, manifestações epilépticas, surdez neurossensorial e paresia crural à esquerda. Fazem também breve revisão do papel deste agente etiológico na patologia humana. Ressaltam a importância da P. multocida em casos de meningites bacterianas, fazendo-se o diagnóstico laboratorial diferencial com o Haemophilus influenzae e Neisseria meningitidis em processos infecciosos conseqüentes a arranhadura ou mordida de animais e nas bacteremias ou septicemias em pacientes com hepatopatias crônicas ou em estados de imunodepressão.

Multiplex PCR To Identify Macrolide Resistance Determinants in Mannheimia haemolytica and Pasteurella multocida

DEFF Research Database (Denmark)

Rose, Simon; Desmolaize, Benoit; Jaju, Puneet

2012-01-01

The bacterial pathogens Mannheimia haemolytica and Pasteurella multocida are major etiological agents in respiratory tract infections of cattle. Although these infections can generally be successfully treated with veterinary macrolide antibiotics, a few recent isolates have shown resistance...... to these drugs. Macrolide resistance in members of the family Pasteurellaceae is conferred by combinations of at least three genes: erm(42), which encodes a monomethyltransferase and confers a type I MLS(B) (macrolide, lincosamide, and streptogramin B) phenotype; msr(E), which encodes a macrolide efflux pump...

Variability of Pasteurella multocida isolated from Icelandic sheep and detection of the toxA gene.

Science.gov (United States)

Einarsdottir, Thorbjorg; Gunnarsson, Eggert; Sigurdardottir, Olof G; Jorundsson, Einar; Fridriksdottir, Vala; Thorarinsdottir, Gudridur E; Hjartardottir, Sigridur

2016-09-01

Pasteurella multocida can be part of the upper respiratory flora of animals, but under conditions of stress or immunocompromisation, the bacteria can cause severe respiratory symptoms. In this study, we compared 10 P. multocida isolates from Icelandic sheep with respiratory symptoms and 19 isolates from apparently healthy abattoir sheep. We examined capsule type, genetic variability and the presence of the toxA gene in the two groups. Surprisingly, we found that all ovine P. multocida isolates examined in this study carried the toxA gene, which markedly differs from what has been published from other studies. Interestingly, all isolates from abattoir animals were capsule type D, whilst bacteria isolated from animals with clinical respiratory symptoms had capsule type A, D or F. Examination of seven housekeeping genes indicated that the clinical respiratory isolates were significantly more heterogeneous than the abattoir isolates (P<0.05, two-tailed Mann-Whitney U test). The results suggest that there may be at least two groups of P. multocida in sheep - a genetically homogeneous group that resides in the respiratory tract and a genetically heterogeneous group that is the predominant cause of disease.

Comparison of standardised versus non-standardised methods for testing the in vitro potency of oxytetracycline against mannheimia haemolytica and pasteurella multocida

OpenAIRE

Lees, P; Illambas, J; Pelligand, L; Toutain, P L

2016-01-01

The in vitro pharmacodynamics of oxytetracycline was established for six isolates of each of the calf pneumonia pathogens Mannheimia haemolytica and Pasteurella multocida. Minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and bacterial time-kill curves were determined in two matrices, Mueller Hinton broth (MHB) and calf serum. Geometric mean MIC ratios, serum:MHB, were 25.2:1 (M. haemolytica) and 27.4:1 (P. multocida). The degree of binding of oxytetracycline to...

A novel Erm monomethyltransferase in antibiotic-resistant isolates of Mannheimia haemolytica and Pasteurella multocida

DEFF Research Database (Denmark)

Desmolaize, Benoit; Rose, Simon; Warrass, Ralf

2011-01-01

Mannheimia haemolytica and Pasteurella multocida are aetiological agents commonly associated with respiratory tract infections in cattle. Recent isolates of these pathogens have been shown to be resistant to macrolides and other ribosome-targeting antibiotics. Direct analysis of the 23S r...... without any dimethyltransferase activity. Erm(42) is a novel addition to the Erm family: it is phylogenetically distant from the other Erm family members and it is unique in being a bona fide monomethyltransferase that is disseminated between bacterial pathogens....

Isolation, characterization, virulence and immunogenicity testing of field isolates of Pasteurella multocida, Staphylococcus aureus, and Streptococcus agalactiae in laboratory settings.

Science.gov (United States)

Qudratullah; Muhammad, G; Saqib, M; Bilal, M Qamar

2017-08-01

The present study was designed to investigate isolation, characterization, virulence and immunogenicity testing of field isolates of Pasteurella multocida, Staphylococcus aureus, and Streptococcus agalactiae in rabbits and mice. Isolates of P. multocida, S. aureus and Str. agalactiae recovered from field cases of Hemorragic septicemia and mastitis were scrutinized for virulence/pathogenicity and immunogenicity. Mouse LD 50 of P. multocida showed that P. multocida isolate No.1 was more virulent than isolates No. 2 and 3. Virulence of isolate No.1S. aureus and Str. agalactiae revealed that 100, 80% rabbits died within 18h of inoculation. Seven-digit numerical profiles of these 4 isolates with API ® Staph test strips isolates, No.1 (6736153) showed good identification (S. aureus id=90.3%). Indirect ELISA-based serum antibody titers to P. multocida isolate No.1, S. aureus No.1, Str. agalactiae, isolate No.1 elicited high antibody titers 1.9, 1.23, 1.12 respectively. All the pathogens of Isolate No. 1 (P. multocida, S. aureus Str. agalactiae), were high antibody than others isolates. Copyright © 2017 Elsevier B.V. All rights reserved.

Isolation and Identification of Pasteurella multocida from Sheep & Goat in Iran

Directory of Open Access Journals (Sweden)

Valadan, M.,

2014-05-01

Full Text Available This study has been carried out with the objective of isolation and identification of agent(s of pasteurella pneumonia in sheep and goat in Iran using bacteriological and biochemical assays to be identified in the pursuant researches to be used in pasteurellosis vaccine production. To accomplish this objective, samples were gathered from areas suspicious to pasteurellosis infection and industrial abbatoirs according to clinical and autopsy symptoms from eight provinces of Bushehr, Esfahan, Kerman, Kohgilooyeh & Boyr Ahmad, Fars, Qom, Tehran and Qazvin in a period from spring 2008 to spring 2011. Samples were different in sort due to the existent condition but generally were comprised of palatine tonsil swabs or blood samples taken from jugular vein in live animals and lungs or upper respiratory tract lymph glands in dead or slaughtered animals. Totally, 1454 samples (1120 samples of sheep, 334 samples of goat composed if 1084 samples of live animals and 370 samples of dead or slaughterd animals were tested. Considering results obtained from assays, only 54 samples (3.71% were assessed as being pasteurella, genus of which was totally identified as multocida.

Why your housecat's trite little bite could cause you quite a fright: a study of domestic felines on the occurrence and antibiotic susceptibility of Pasteurella multocida.

Science.gov (United States)

Freshwater, A

2008-10-01

Approximately four to five million animal bite wounds are reported in the USA each year. Domestic companion animals inflict the majority of these wounds. Although canine bites far outnumber feline bites, unlike the dog, the cat's bite is worse than its bark; 20-80% of all cat bites will become infected, compared with only 3-18% of dog bite wounds. Pasteurella multocida is the most commonly cultured bacterium from infected cat bite wounds. Anyone seeking medical attention for a cat-inflicted bite wound is given prophylactic/empiric penicillin or a derivative to prevent Pasteurella infection (provided they are not allergic to penicillins). In an effort to establish a carriage rate of P. multocida in the domestic feline, bacterial samples from the gingival margins of domestic northern Ohio cats (n=409) were cultured. Isolates were tested for antibiotic sensitivity as prophylactic/empiric use of penicillin and its derivatives could potentially give rise to antibiotic resistance in P. multocida. The high carriage rate (approximately 90%) of P. multocida observed was found to be independent of physiological and behavioural variables including age, breed, food type, gingival scale, lifestyle and sex. High antibiotic susceptibility percentages were observed for benzylpenicillin, amoxicillin-clavulanate, cefazolin, and azithromycin (100%, 100%, 98.37% and 94.02%, respectively) in P. multocida isolates. The high prevalence of P. multocida in the feline oral cavity indicates that prophylactic/empiric antibiotic therapy is still an appropriate response to cat bite wounds. Additionally, the susceptibility of P. multocida to penicillin and its derivatives indicates that they remain reliable choices for preventing and treating P. multocida infections.

Multiorgan Failure and Refractory Lactic Acidosis due to Pasteurella multocida Septicemia in a Patient with No Animal Exposure

Directory of Open Access Journals (Sweden)

Damaris Pena

2018-01-01

Full Text Available Introduction. Pasteurella multocida is a gram-negative coccobacillus pathogenic to animals. It can cause infection in humans by a bite, scratch, or lick from a cat or dog. P. multocida can cause a variety of infections in humans, including cellulitis, osteomyelitis, endocarditis, peritonitis, and septic shock. Case Presentation. A 56-year-old male presented to our hospital with a 2-day history of fever, abdominal pain, nausea, and vomiting. He denied exposure to cats, dogs or other pets. He had severe respiratory distress requiring ventilator support, profound septic shock requiring multiple vasopressors, severe lactic acidosis, and renal failure requiring emergent hemodialysis. Blood cultures confirmed the presence of P. multocida. The patient subsequently died of cardiopulmonary arrest due to multiorgan failure with refractory shock. Conclusion. P. multocida septicemia can lead to septic shock. Early identification of this organism may decrease mortality. Although our patient had no known cat or dog exposure, physicians should enquire about a history of animal exposure when a patient presents with an infection with no obvious cause.

Genotyping of Pasteurella multocida ovine and bovine isolates from Iran based on PCR-RFLP of ompH gene

Directory of Open Access Journals (Sweden)

A. Ghanizadeh

2015-10-01

Full Text Available Pasteurella multocida (P. multocida, A Gram-negative facultative anaerobic bacterium, is a causative animal pathogen in porcine atrophic rhinitis and avian fowl cholera. The outer membrane of Gram-negative bacteria contains of many different protein in very high copy numbers. One of the major outer membrane, the H proteins have functional as high immunogenicity and antigenicity. In this study to increase information about epidemiology of ovine and bovine P. multocida, the 24 isolates from sheep and nine isolates from cattle were investigated by PCR-RFLP analysis of the ompH gene. In all 33 isolates, digestion of the amplified fragment of ompH gene by using EcoRI, cfoI and HindIII produced 3, 5 and 3 different restriction patterns respectively. Sixteen RFLP patterns were found among 33 investigated P.multocida isolates. This study showed that, the PCR RFLP based on ompH gene is potentially a useful method for typing of P. multocida isolates from sheep and cattle. The RFLP patterns of this gene exhibited extensive restriction site heterogeneity, which may be particularly suitable for fingerprinting of P. multocida isolates.Considering ompH protein as a protective immunogenic moiety of P.ultocida, the results of this study showed a heterogenic bacteria and this means the possibility to produce a multivalent vaccine to be protective against diseases caused by this organism in sheep and cattle in Iran.

Time-course investigation of infection with a low virulent Pasteurella multocida strain in normal and immune-suppressed 12-week-old free-range chickens

DEFF Research Database (Denmark)

Mbuthia, P.G.; Njagi, L.W.; Nyaga, P.N.

2011-01-01

Twelve-week-old indigenous chickens, either immune-suppressed using dexamethasone (IS) or non-immune-suppressed (NIS), were challenged with a low virulent strain, Pasteurella multocida strain NCTC 10322(T), and developed clinical signs and pathological lesions typical of chronic fowl cholera. NIS...

Ducks as a potential reservoir for Pasteurella multocida infection detected using a new rOmpH-based ELISA.

Science.gov (United States)

Liu, Rongchang; Chen, Cuiteng; Cheng, Longfei; Lu, Ronghui; Fu, Guanghua; Shi, Shaohua; Chen, Hongmei; Wan, Chunhe; Lin, Jiansheng; Fu, Qiuling; Huang, Yu

2017-07-28

Pasteurella multocida is an important pathogen of numerous domestic poultry and wild animals and is associated with a variety of diseases including fowl cholera. The aim of this study was to develop an indirect enzyme-linked immunosorbent assay (ELISA) based on recombinant outer-membrane protein H (rOmpH) for detection of anti-P. multocida antibodies in serum to determine their prevalence in Chinese ducks. The P. multocida ompH gene was cloned into pET32a, and rOmpH was expressed in Escherichia coli BL21 (DE3). Western blotting revealed that purified rOmpH was recognized by duck antisera against P. multocida, and an indirect ELISA was established. During analysis of serum samples (n=115) from ducks, the rOmpH ELISA showed 95.0% specificity, 100% sensitivity and a 92.0% κ coefficient (95% confidence interval 0.844-0.997) as compared with a microtiter agglutination test. Among 165 randomly selected serum samples, which were collected in 2015 and originated from six duck farms across Fujian Province, China, anti-P. multocida antibodies were detected in 22.42% of apparently healthy ducks, including 25 of 90 sheldrakes (27.8%), eight of 50 Peking ducks (16.0%) and four of 25 Muscovy ducks (16%). Overall, the data suggest that rOmpH is a suitable candidate antigen for the development of an indirect ELISA for detection of P. multocida in ducks; moreover, our results showed that ducks could serve as a potential reservoir for P. multocida infection.

Structure and function of C-terminal catalytic region of pasteurella multocida toxin

International Nuclear Information System (INIS)

Kitadokoro, Kengo; Kamitami, Shigeki; Horiguchi, Yasuhiko

2008-01-01

Pasteurella multocida toxin (PMT) is one of virulence factors responsible for the pathogenesis in some Pasteurellosis. We determined the crystal structure of the C-terminal region of PMT (C-PMT), which carries an intracellularly active moiety. The overall structure of C-PMT displays three different domains designated C1, C2 and C3. We found in the C3 domain the Cys-His-Asp catalytic triad that is organized only when the Cys is released from a disulfide bond. The steric alignment of the triad corresponded well to that of papain or other enzymes carrying the Cys-His-Asp triad. Our results demonstrate that PMT is an enzymatic toxin carrying the cysteine-protease like catalytic triad, which is organized only under reducing conditions. (author)

Prosthetic joint infection caused by Pasteurella multocida: a case series and review of literature.

Science.gov (United States)

Honnorat, Estelle; Seng, Piseth; Savini, Hélène; Pinelli, Pierre-Olivier; Simon, Fabrice; Stein, Andreas

2016-08-20

Pasteurella multocida is a well-recognized zoonotic agent following dog or cat bites or scratches. Nevertheless, prosthetic joint infection caused by P. multocida are rarely reported. We report here a series of six cases of prosthetic joint infection caused by P. multocida managed at a referral centre for the treatment of bone and joint infection in southern France. We also reviewed the 26 cases reported in literature. The mean age of our cases was 74 years [±8.2, range 63-85]. In majority of our cases (5 cases) were associated with knee prostheses and one case with a hip prosthesis. Most of cases occurred after cat or dog scratches or licks or contact. Diagnoses of prosthetic joint infection caused by P. multocida were made by positive cultures of surgical biopsies or needle aspiration. Mean time delay between prosthetic joint implantation and infection onset was 7.6 years (±5.12 years, range 2-17). Local inflammation, which occurred in all six cases, was the most frequent clinical symptom, followed by pain in five cases, fever and swollen joints in four cases, and a fistula with purulent discharge inside the wound in two cases. The mean time of antibiotic therapy was 8 months. Surgical treatment with prosthesis removal was performed in three cases. Six of our cases were in remission without apparent relapse at 3 years after end of treatment. Prosthetic joint infections caused by P. multocida usually occur after animal scratches or bites, but can occasionally occur after a short animal lick. These infections are usually resulting from a contiguous infection and localized in the knee. An early antibiotic therapy after surgical debridement could avoid prosthetic withdrawal, notably in elderly patients. Patients with prosthetic joints should be warned that animals are potential sources of serious infection and urgent medical advice should be sought if they are bitten or scratched.

Analysis of the polymerization initiation and activity of Pasteurella multocida heparosan synthase PmHS2, an enzyme with glycosyltransferase and UDP-sugar hydrolase activity

NARCIS (Netherlands)

Chavaroche, A.A.E.; Broek, van den L.A.M.; Springer, J.; Boeriu, C.; Eggink, G.

2011-01-01

Heparosan synthase catalyzes the polymerization of heparosan [-4GlcUAß1-4GlcNAca1-]n by transferring alternatively the monosaccharide units from UDP-GlcUA and UDP-GlcNAc to an acceptor molecule. Details on the heparosan chain initiation by Pasteurella multocida heparosan synthase PmHS2 and its

Establishment of a Pathogenicity Index for One-day-old Broilers to Pasteurella multocida Strains Isolated from Clinical Cases in Poultry and Swine

Directory of Open Access Journals (Sweden)

RM Pilatti

Full Text Available ABSTRACT Although Pasteurella multocida is a member of the respiratory microbiota, under some circumstances, it is a primary agent of diseases , such as fowl cholera (FC, that cause significant economic losses. Experimental inoculations can be employed to evaluate the pathogenicity of strains, but the results are usually subjective and knowledge on the pathogenesis of this agent is still limited. The objective of this study was to establish a new methodology for classifying the pathogenicity of P. multocida by formulating a standard index. Strains isolated from FC cases and from swine with respiratory problems were selected. One hundred mL of a bacterial culture of each strain, containing 106 CFU, was inoculated in 10 one-day-old broilers. Mortality after inoculation, time of death (TD, and the presence of six macroscopic lesions were evaluated over a period of seven days post-inoculation (dpi. A Pathogenicity Index Per Bird (IPI, ranging 0 to 10, was calculated. Liver and heart fragments were collected to reisolate the bacteria. Blood was collected from the surviving birds, and an ELISA test was carried out to detect specific antibodies. The median of the pathogenicity indices, the number of lesions and the rate of bacteria reisolation were significantly different (p<0.05 among the origins of the isolates (p<0.05. The pathogenicity index developed in this study allows the classification of Pasteurella multocida pathogenicity and may be an alternative to the pathogenicity models currently used for screening.

Pharmacokinetic/pharmacodynamic integration and modelling of oxytetracycline for the porcine pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida.

Science.gov (United States)

Dorey, L; Pelligand, L; Cheng, Z; Lees, P

2017-10-01

Pharmacokinetic-pharmacodynamic (PK/PD) integration and modelling were used to predict dosage schedules of oxytetracycline for two pig pneumonia pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Minimum inhibitory concentration (MIC) and mutant prevention concentration (MPC) were determined in broth and porcine serum. PK/PD integration established ratios of average concentration over 48 h (C av0-48 h )/MIC of 5.87 and 0.27 μg/mL (P. multocida) and 0.70 and 0.85 μg/mL (A. pleuropneumoniae) for broth and serum MICs, respectively. PK/PD modelling of in vitro time-kill curves established broth and serum breakpoint values for area under curve (AUC 0-24 h )/MIC for three levels of inhibition of growth, bacteriostasis and 3 and 4 log 10 reductions in bacterial count. Doses were then predicted for each pathogen, based on Monte Carlo simulations, for: (i) bacteriostatic and bactericidal levels of kill; (ii) 50% and 90% target attainment rates (TAR); and (iii) single dosing and daily dosing at steady-state. For 90% TAR, predicted daily doses at steady-state for bactericidal actions were 1123 mg/kg (P. multocida) and 43 mg/kg (A. pleuropneumoniae) based on serum MICs. Lower TARs were predicted from broth MIC data; corresponding dose estimates were 95 mg/kg (P. multocida) and 34 mg/kg (A. pleuropneumoniae). © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

Susceptibilidade in vitro a antimicrobianos da Mannheimia haemolytica e da Pasteurella multocida isoladas de ovinos sadios e com doenças respiratórias

Directory of Open Access Journals (Sweden)

Leomar Viana

2007-12-01

Full Text Available Pasteurella multocida e Mannheimia haemolytica (P. haemolytica estão associadas a enfermidades no sistema respiratório de ovinos. Com o objetivo de avaliar a susceptibilidade in vitro destes microrganismos frente aos antimicrobianos, foram colhidas amostras de nasofaringe (n=180 e orofaringe (n=82 de ovinos com e sem enfermidade respiratória. Dentre os antimicrobianos testados, a sensibilidade foi maior para enrofloxacina (100% e florfenicol (100%, considerando-se ambas as espécies bacterianas. Observou-se resistência de M. haemolytica e P. multocida à tetraciclina (15,64% e 17,65%, respectivamente e penicilina (1.82% e 4.2%, respectivamente.

What is the true in vitro potency of oxytetracycline for the pig pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida?

Science.gov (United States)

Dorey, L; Hobson, S; Lees, P

2017-10-01

The pharmacodynamics of oxytetracycline was determined for pig respiratory tract pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Indices of potency were determined for the following: (i) two matrices, broth and pig serum; (ii) five overlapping sets of twofold dilutions; and (iii) a high strength starting culture. For A. pleuropneumoniae, minimum inhibitory concentration (MIC) was similar for the two matrices, but for P. multocida, differences were marked and significantly different. MIC and minimum bactericidal concentration (MBC) serum: broth ratios for A. pleuropneumoniae were 0.83:1 and 1.22:1, respectively, and corresponding values for P. multocida were 22.0:1 and 7.34:1. For mutant prevention concentration (MPC) serum: broth ratios were 0.79:1 (A. pleuropneumoniae) and 20.9:1 (P. multocida). These ratios were corrected for serum protein binding to yield fraction unbound (fu) serum: broth MIC ratios of 0.24:1 (A. pleuropneumoniae) and 6.30:1 (P. multocida). Corresponding fu serum: broth ratios for MPC were almost identical, 0.23:1 and 6.08:1. These corrections for protein binding did not account for potency differences between serum and broth for either species; based on fu serum MICs, potency in serum was approximately fourfold greater than predicted for A. pleuropneumoniae and sixfold smaller than predicted for P. multocida. For both broth and serum and both bacterial species, MICs were also dependent on initial inoculum strength. The killing action of oxytetracycline had the characteristics of codependency for both A. pleuropneumoniae and P. multocida in both growth media. The in vitro potency of oxytetracycline in pig serum is likely to be closer to the in vivo plasma/serum concentration required for efficacy than potency estimated in broths. © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

Oral exposure to culture material extract containing fumonisins predisposes swine to the development of pneumonitis caused by Pasteurella multocida

International Nuclear Information System (INIS)

Halloy, David J.; Gustin, Pascal G.; Bouhet, Sandrine; Oswald, Isabelle P.

2005-01-01

Fumonisin B 1 (FB 1 ) is a mycotoxin produced by Fusarium verticillioides and F. proliferatum that commonly occurs in maize. In swine, consumption of contaminated feed induces liver damage and pulmonary edema. Pasteurella multocida is a secondary pathogen, which can generate a respiratory disorder in predisposed pigs. In this study, we examined the effect of oral exposure to fumonisin-containing culture material on lung inflammation caused by P. multocida. Piglets received by gavage a crude extract of fumonisin, 0.5 mg FB 1 /kg body weight/day, for 7 days. One day later, the animals were instilled intratracheally with a non toxin producing type A strain of P. multocida and followed up for 13 additional days. Pig weight and cough frequency were measured throughout the experiment. Lung lesions, bronchoalveolar lavage fluid (BALF) cell composition and the expression of inflammatory cytokines were evaluated at the autopsy. Ingestion of fumonisin culture material or infection with P. multocida did not affect weight gain, induced no clinical sign or lung lesion, and only had minimal effect on BALF cell composition. Ingestion of mycotoxin extract increased the expression of IL-8, IL-18 and IFN-γ mRNA compared with P. multocida infection that increased the expression of TNF-α. The combined treatment with fumonisin culture material and P. multocida delayed growth, induced cough, and increased BALF total cells, macrophages and lymphocytes. Lung lesions were significantly enhanced in these animals and consisted of subacute interstitial pneumonia. TNF-α, IFN-γ and IL-18 mRNA expression was also increased. Taken together, our data showed that fumonisin culture material is a predisposing factor to lung inflammation. These results may have implications for humans and animals consuming FB 1 contaminated food or feed

Oral exposure to culture material extract containing fumonisins predisposes swine to the development of pneumonitis caused by Pasteurella multocida

Energy Technology Data Exchange (ETDEWEB)

Halloy, David J [Department of Functional Sciences, Unit of Pharmacology, Pharmacotherapy and Toxicology, Faculty of Veterinary Medicine, University of Liege, Liege (Belgium); Gustin, Pascal G [Department of Functional Sciences, Unit of Pharmacology, Pharmacotherapy and Toxicology, Faculty of Veterinary Medicine, University of Liege, Liege (Belgium); Bouhet, Sandrine [INRA, UR66, Laboratory of Pharmacology and Toxicology, 180 Chemin de Tournefeuille, BP3, 31931 Toulouse (France); Oswald, Isabelle P [INRA, UR66, Laboratory of Pharmacology and Toxicology, 180 Chemin de Tournefeuille, BP3, 31931 Toulouse (France)

2005-09-15

Fumonisin B{sub 1} (FB{sub 1}) is a mycotoxin produced by Fusarium verticillioides and F. proliferatum that commonly occurs in maize. In swine, consumption of contaminated feed induces liver damage and pulmonary edema. Pasteurella multocida is a secondary pathogen, which can generate a respiratory disorder in predisposed pigs. In this study, we examined the effect of oral exposure to fumonisin-containing culture material on lung inflammation caused by P. multocida. Piglets received by gavage a crude extract of fumonisin, 0.5 mg FB{sub 1}/kg body weight/day, for 7 days. One day later, the animals were instilled intratracheally with a non toxin producing type A strain of P. multocida and followed up for 13 additional days. Pig weight and cough frequency were measured throughout the experiment. Lung lesions, bronchoalveolar lavage fluid (BALF) cell composition and the expression of inflammatory cytokines were evaluated at the autopsy. Ingestion of fumonisin culture material or infection with P. multocida did not affect weight gain, induced no clinical sign or lung lesion, and only had minimal effect on BALF cell composition. Ingestion of mycotoxin extract increased the expression of IL-8, IL-18 and IFN-{gamma} mRNA compared with P. multocida infection that increased the expression of TNF-{alpha}. The combined treatment with fumonisin culture material and P. multocida delayed growth, induced cough, and increased BALF total cells, macrophages and lymphocytes. Lung lesions were significantly enhanced in these animals and consisted of subacute interstitial pneumonia. TNF-{alpha}, IFN-{gamma} and IL-18 mRNA expression was also increased. Taken together, our data showed that fumonisin culture material is a predisposing factor to lung inflammation. These results may have implications for humans and animals consuming FB{sub 1} contaminated food or feed.

Mucoadhesive and pH-sensitive thiolated Eudragit microspheres for oral delivery of Pasteurella multocida antigens containing dermonecrotoxin.

Science.gov (United States)

Islam, Mohammad Ariful; Jiang, Hu-Lin; Quan, Ji-Shan; Arote, Rohidas B; Kang, Mi-Lan; Yoo, Han-Sang; Yun, Cheol-Heui; Choi, Yun-Jaie; Cho, Chong-Su

2011-05-01

In this study, cysteine was conjugated to the Eudragit to have mucoadhesive and pH-sensitive properties. Pasteurella multocida dermonecrotoxin (PMT) is a major virulence factor as a causative agent of atrophic rhinitis (AR) in swine and, therefore, inactivated P. multocida was used as a candidate vaccine in the current study. PMT-loaded thiolated Eudragit microspheres (TEMS) prepared using W/O/W emulsion-solvent evaporation method were characterized to assess their efficacy in oral vaccination. PMT-loaded TEMS were observed as spherical shapes with smooth surfaces and average particle sizes were 5.2 +/- 0.55 microm. The loading efficiency of PMT in the TEMS was about 75.3%. A significantly higher percentage of PMT from PMT-loaded TEMS was released at pH 7.4 than at pH 1.5. Murine macrophage stimulated with PMT-loaded TEMS facilitated a gradual secretion of tumor necrosis factor-alpha and nitric oxide as immune stimulatory mediators in a time dependent manner, suggesting that the released PMT from PMT-loaded TEMS had immune stimulating activity of AR vaccine in vitro.

Efficacy of a novel Pasteurella multocida vaccine against progressive atrophic rhinitis of swine

Science.gov (United States)

Hsuan, Shih-Ling; Liao, Chih-Ming; Huang, Chienjin; Winton, James R.; Chen, Zeng-Weng; Lee, Wei-Cheng; Liao, Jiunn-Wang; Chen, Ter-Hsin; Chiou, Chwei-Jang; Yeh, Kuang-Sheng; Chien, Maw-Sheng

2009-01-01

The efficacy of a novel vaccine composed of three short recombinant subunit Pasteurella multocida toxin (PMT) proteins in combination with a bi-valent P. multocida whole-cell bacterin (rsPMT–PM) was evaluated in field studies for prevention and control of progressive atrophic rhinitis (PAR) of swine at 15 conventional farrow-to-finish farms. Experimental piglets that were immunized twice with the rsPMT–PM vaccine developed detectable titers of neutralizing antibodies (greater than 1:8) that prevented the growth retardation and pathological lesions typically observed following challenge with authentic PMT. A total of 542 sows were vaccinated once or twice prior to parturition and serum neutralizing antibody titers were evaluated. Both single and double vaccination protocols induced neutralizing antibody titers of 1:16 or higher in 62% and 74% of sows, respectively. Notably, neither sows nor piglets at a farm experiencing a severe outbreak of PAR at the time of the vaccination trial had detectable antibody titers, but antibody titers increased significantly to 1:16 or higher in 40% of sows following double vaccination. During the year after vaccination, clinical signs of PAR decreased in fattening pigs and growth performance improved sufficiently to reduce the rearing period until marketing by 2 weeks. Collectively, these results indicate that the rsPMT–PM vaccine could be used to provide protective immunity for controlling the prevalence and severity of PAR among farm-raised swine.

Modulating the regioselectivity of a Pasteurella multocida sialyltransferase for biocatalytic production of 3'- and 6'-sialyllactose

DEFF Research Database (Denmark)

Guo, Yao; Jers, Carsten; Meyer, Anne S.

2015-01-01

Several bacterial sialyltransferases have been reported to be multifunctional also catalysing sialidase and trans-sialidase reactions. In this study, we examined the trans-sialylation efficacy and regioselectivity of mutants of the multifunctional Pasteurella multocida sialyltransferase (Pm...... activity was abolished. Histidine in this position is conserved in α-2,6-sialyltransferases and has been suggested, and recently confirmed, to be the determinant for strict regiospecificity in the sialyltransferase reaction. Our data verified this theorem. In trans-sialidase reactions, the P34H mutant...... displayed a distinct preference for 6'-sialyllactose synthesis but low levels of 3'-sialyllactose were also produced. The sialyllactose yield was however lower than when using PmSTWT under optimal conditions for 6'-sialyllactose formation. The discrepancy in regiospecificity between the two reactions could...

Occurrence Of Virulence Factors And Antimicrobial Resistance In Pasteurella Multocida Strains Isolated From Slaughter Cattle In Iran

Directory of Open Access Journals (Sweden)

Faham eKhamesipour

2014-10-01

Full Text Available A total of 30 Pasteurella multocida strains isolated from 333 pneumonic and apparently health slaughter cattle were examined for capsule biosynthesis genes and 23 virulence associated genes by polymerase chain reaction. The disc diffusion technique was used to determine antimicrobial resistance profiles among the isolates. Of the isolates, 23 belonged to capsular type A, 5 to capsular type D and two isolates were untypeable. The distribution of the capsular types in pneumonic lungs and in apparently health lungs was statistically similar. All virulence genes tested were detected among the isolates derived from pneumonic lungs; whereas isolates derived from apparently health lungs carried 16 of the 23 genes. The frequently detected genes among isolates from pneumonic lungs were exbD, hgbA, hgbB, ompA, ompH, oma87 and sodC; whereas tadD, toxA and pmHAS genes occurred less frequently. Most of the adhesins and superoxide dismutases; and all of the iron acquisition and protectin proteins occurred at significantly (p≤0.05 higher frequencies in isolates from pneumonic lungs. Isolates from apparently healthy lungs didn’t carry the following genes; hsf-1, hsf-2, tadD, toxA, nanB, nanH and pmHAS. One adhesion (hsf-1 and two iron acquisition (exbD and tonB genes occurred at significantly (p≤0.05 higher frequencies among capA isolates. All the P. multocida isolates were susceptible to ciprofloxacin, co-trimoxazole, doxycycline, enrofloxacin, nitrofurantoin and tetracyclines. Different proportions of the isolates were however resistant to ampicillin, amoxicillin, erythromycin, lincomycin, penicillin, rifampin, streptomycin and florfenicol. Our results reveal presence of virulence factors in P. multocida strains isolated from symptomatic and asymptomatic bovids. A higher frequency of the factors among isolates from symptomatic study animals may suggest their role in pathogenesis of P. multocida-associated bovine respiratory disease. The results further

Isolation, identification, and monitoring of antibiotic resistance in Pasteurella multocida and Mannheimia haemolytica isolated from sheep in East Azerbaijan province, Iran

Directory of Open Access Journals (Sweden)

I. Khalili

2016-09-01

Full Text Available The present study was carried out in order to isolate, identify, and assess the antimicrobial susceptibility of the causative agent(s of pneumonic pasteurellosis in sheep in East Azerbaijan province, northwest of Iran. Pneumonia was detected in 320 cases, and the affected lungs were sampled in the slaughterhouse. The samples were investigated bacteriologically for the isolation of two microorganisms from the Pasteurellaceae family. Pasteurella multocida was isolated from six (1.87% samples, while none of the lung tissues were positive for Mannheimia haemolytica. After the isolation and detection of microorganisms via cultural and morphological tests, the bacteria were identified on the basis of biochemical criteria and polymerase chain reaction (PCR technique. Antimicrobial susceptibility testing was performed on all P. multocida isolates, using broth microdilution method. Evaluation of the minimum inhibitory concentration (MIC of eight antimicrobial agents against the tested isolates showed that all the organisms were resistant to amoxicillin and relatively susceptible to ceftiofur. In conclusion, P. multocida was introduced as the main cause of ovine pneumonic pasteurellosis in the studied district, and the outbreak frequency significantly varied in different seasons of the year (P

Ocorrência de genes tad associados à formação de biofilme em isolados de Pasteurella multocida de pulmões de suínos com pneumonia

OpenAIRE

Moraes, Danny Franciele da S.D.; Brandão, Laila Natasha S.; Pitchenin, Leticia C.; O. Filho, João Xavier; Morés, Nelson; Nakazato, Luciano; Dutra, Valéria

2014-01-01

Os atuais sistemas de criação intensiva de suínos aumentam a pressão de seleção microbiana propiciando a disseminação de doenças respiratórias. A bactéria Pasteurella multocida é associada a diversas patologias respiratórias em animais submetidos a esse tipo de criação, causando grandes perdas econômicas. A formação de biofilme foi descrita in vitro em P. multocida e fatores analisados indicaram a facilitação na colonização dos tecidos, aumentando a resistência às defesas do hospedeiro e aos ...

Isolation and molecular detection of Pasteurella multocida Type A from naturally infected chickens, and their histopathological evaluation in artificially infected chickens in Bangladesh

Directory of Open Access Journals (Sweden)

Sayedun Nahar Panna

2015-09-01

Full Text Available Pasteurella multocida type A is the etiologic agent of fowl cholera, a highly contagious and fatal disease of chickens. The present research work was performed for the isolation, identification and molecular detection of P. multocida Type A from chickens. Liver, heart and spleen of suspected dead chicken (n=35 were collected from Gazipur and Pabna districts in Bangladesh. The targeted bacteria from the samples were isolated, identified and characterized based on their morphology, staining, cultural, biochemical characters, pathogenicity test, histopathological study and Polymerase Chain Reaction (PCR. The P. multocida organism was isolated from 11.42% (n=4/35 samples. The organisms were gram negative, non-spore forming rod, non-motile, occurring singly or pairs in Gram staining, whereas in Leishman's stain, bipolar shaped organisms were observed. All the isolates were found positive for oxidase and catalase tests, produced indole, and fermented glucose, mannitol and sucrose. Necrotic foci in liver and congestion with hemorrhages in heart were found on necropsy. After pathogenicity test, the pathological changes were reconfirmed by histopathology depicting congestion, hemorrhage and lymphocyte infiltration in heart, liver and spleen tissues. In type specific PCR reaction, the organisms were confirmed as P. multocida Type A. In conclusion, P. multocida type A is prevalent among poultry in the studied regions; thus, care must be taken to control of the disease. [J Adv Vet Anim Res 2015; 2(3.000: 338-345

[Effect of lead microparticles introduced into the respiratory system of the sensitivity of mice to Pasteurella multocida infection via aerosol].

Science.gov (United States)

Bouley, G; Dubreuil, A; Arsac, F; Boudène, C

1977-12-19

Lead microparticles, resulting from the pyrolysis of organic lead used as an anti-knock agent in gasoline, were introduced into the lungs of Mice, during a short single exposure. When 6 microgram of lead were retained in the lungs (mean value per Mouse), the phagocytic ability of the pulmonary alveolar macrophages harvested 6 and 18 hrs. later, was significantly reduced. It was observed, in the same conditions, that the resistance of Mice to experimental infection by aerosolized Pasteurella multocida, was significantly reduced. When 3 microgram of lead were retained in the lungs, there was no significant difference between control and intoxicated Mice.

Bronchoalveolar lavage is an ideal tool in evaluation of local immune response of pigs vaccinated with Pasteurella multocida bacterin vaccine

Directory of Open Access Journals (Sweden)

Shiney George

2015-04-01

Full Text Available Aim: The aim was to study the bronchoalveolar lavage (BAL technique in evaluating the local immune response of pig immunized with Pasteurella multocida bacterin vaccine. Materials and Methods: Weaned piglets were immunized with formalin-inactivated P52 strain of P. multocida bacterin and evaluated for pulmonary immune response in BAL fluid. BAL was performed before vaccination and at different post vaccination days. The BAL fluid was assayed using enzyme-linked immunosorbent assay to study the development of P. multocida specific antibody isotypes and also evaluated for different cell populations using standard protocol. Results: The average recovery percentage of BAL fluid varies from 58.33 to 61.33 in vaccinated and control group of piglets. The BAL fluid of vaccinated pigs showed increase in antibody titer up to 60th days post vaccination (8.98±0.33, IgG being the predominant isotype reached maximum titer of 6.12±0.20 on 45th days post vaccination, followed by IgM and a meager concentration of IgA could be detected. An increased concentration of the lymphocyte population and induction of plasma cells was detected in the BAL fluid of vaccinated pigs. Conclusion: Though intranasal vaccination with P. multocida plain bacterin vaccine could not provoke a strong immune response, but is promising as lymphocyte population was increased and plasma cells were detected. BAL can be performed repeatedly up to 3/4 months of age in pigs to study pulmonary immune response without affecting their health.

Ultrastructural Comparison of the Nasal Epithelia of Healthy and Naturally Affected Rabbits with Pasteurella multocida A

Directory of Open Access Journals (Sweden)

Paula Esquinas

2013-01-01

Full Text Available An ultrastructural comparison between the nasal cavities of healthy rabbits and those suffering from two forms of spontaneous infection with Pasteurella multocida was undertaken. Twelve commercially produced rabbits of different ages and respiratory health status were divided into four groups: healthy from 0 to 21 days (G1, n=2; healthy from 23 to 49 days (G2, n=2; healthy from 51 to 69 days (G3, n=2; diseased rabbits with septicemia and the rhinitic form of P. multocida infection (G4, n=3. The main ultrastructural changes observed were a widening of the interepithelial spaces, increased activity and number of goblet cells, the formation of two types of vacuoles in epithelial cells, the degranulation and migration of heterophils between the epithelial cells, and the association of this migration with some of the other changes. No bacteria were observed adhering to the epithelium, and very few were observed free in the mucus. Scant inter-epithelial spaces were found in healthy rabbits, but they were not as large and numerous as those found in diseased animals. We discuss the origin and meaning of these changes but, we focus on the significance of the inter-epithelial spaces and goblet cells for the defense of the upper respiratory airways against the bacterium and its lipopolysaccharide.

Efeito do extrato alcoólico de própolis sobre a Pasteurella multocida “in vitro” e em coelhos - DOI: 10.4025/actascianimsci.v26i1.1952 Effect of alcohol extract of propolis on the Pasteurella multocida in vitro and in the rabbits - DOI: 10.4025/actascianimsci.v26i1.1952

Directory of Open Access Journals (Sweden)

Hélio Langoni

2004-04-01

Full Text Available O ensaio in vitro objetivou avaliar o efeito do álcool PA e de diferentes concentrações (5%, 10% e 15% no Agar, do Extrato Alcoólico de Própolis (EAP, de três regiões do Estado de São Paulo, sobre a Pasteurella multocida, obtida a partir de swab nasal de coelhos. Por meio de outro ensaio, analisou-se o comportamento dessas bactérias em lavado tráqueo-brônquico de coelhos, alimentados com rações contendo álcool PA e diferentes concentrações de EAP (0,1%; 0,2% e 0,3%. O álcool só foi efetivo na inibição do desenvolvimento bacteriano in vitro na concentração mais elevada, enquanto o EAP demonstrou efetividade em todas as concentrações. As amostras de própolis das três regiões não diferiram entre si. No lavado tráqueo-brônquico, o número de Unidades Formadoras de Colônias por mililitro não diferiu entre os tratamentos, porém houve uma tendência de maior efetividade nos tratamentos com EAP em relação ao álcool, acompanhando a ação in vitro.The essay in vitro aimed to evaluate the effect of alcohol and different concentrations (5, 10 and 15% in the agar, of Alcoholic Extract of Propolis (AEP, from three regions of São Paulo State, Brazil, on Pasteurella multocida, obtained from rabbits’ nasal swabs. In other essay the reaction of this bacteria was observed. In tracheal regions of rabbits, fed on diets with alcohol and AEP in different concentrations (0.1; 0.2 and 0.3%. The alcohol was only effective on the inhibition of the bacteria in vitro on highest concentration, while the AEP was effective in all concentrations. The propolis samples from three regions did not differ. In the other assay, there wasn’t any difference between treatments, but the AEP showed to be more active than alcohol against Pasteurella multocida, in the tracheal region of the rabbits, as to the action in vitro.

Field study of pneumonia in vaccinated cattle associated with incorrect vaccination and Pasteurella multocida infection.

Science.gov (United States)

Crawshaw, W M; Caldow, G L

2015-04-25

This field study used data on the vaccine courses against bovine respiratory disease sold by one pharmaceutical company in conjunction with pharmacovigilance data to explore reported suspected lack of expected efficacy and the reasons for this. The study ran from May 1, 2007, to April 30, 2010, and covered vaccines sold in Scotland and part of Northumberland. In total, 83 groups of cattle reported suspected lack of expected efficacy, representing 1.6 per cent of the 804,618 vaccine courses sold. It was possible to investigate 45 of these outbreaks in depth using a standard questionnaire and diagnostic protocol. Vaccine usage outwith the specific product characteristics (SPC) occurred in 47 per cent of cases (21/45). The proportion of vaccination courses used where a pathogen contained in the vaccine was detected in the diseased cattle and vaccine use was consistent with the SPC was estimated at 0.12 per cent of the courses sold. Pasteurella multocida was the most common pathogen detected and was found in 21 of the outbreaks. For outbreaks where a pathogen contained in the vaccine was detected, P. multocida was found at a significantly greater frequency (P=0.03) where vaccine use was compliant with the SPC (five of six outbreaks) compared with outbreaks where vaccine use had not been compliant with the SPC (one of seven outbreaks). The limitations of the study, including the diagnostic tests employed and definition of vaccination outwith the SPC, are discussed. British Veterinary Association.

Pharmacokinetic/pharmacodynamic integration and modelling of florfenicol for the pig pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida.

Directory of Open Access Journals (Sweden)

Lucy Dorey

Full Text Available Pharmacokinetic-pharmacodynamic (PK/PD integration and modelling were used to predict dosage schedules for florfenicol for two pig pneumonia pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Pharmacokinetic data were pooled for two bioequivalent products, pioneer and generic formulations, administered intramuscularly to pigs at a dose rate of 15 mg/kg. Antibacterial potency was determined in vitro as minimum inhibitory concentration (MIC and Mutant Prevention Concentration in broth and pig serum, for six isolates of each organism. For both organisms and for both serum and broth MICs, average concentration:MIC ratios over 48 h were similar and exceeded 2.5:1 and times greater than MIC exceeded 35 h. From in vitro time-kill curves, PK/PD modelling established serum breakpoint values for the index AUC24h/MIC for three levels of inhibition of growth, bacteriostasis and 3 and 4log10 reductions in bacterial count; means were 25.7, 40.2 and 47.0 h, respectively, for P. multocida and 24.6, 43.8 and 58.6 h for A. pleuropneumoniae. Using these PK and PD data, together with literature MIC distributions, doses for each pathogen were predicted for: (1 bacteriostatic and bactericidal levels of kill; (2 for 50 and 90% target attainment rates (TAR; and (3 for single dosing and daily dosing at steady state. Monte Carlo simulations for 90% TAR predicted single doses to achieve bacteriostatic and bactericidal actions over 48 h of 14.4 and 22.2 mg/kg (P. multocida and 44.7 and 86.6 mg/kg (A. pleuropneumoniae. For daily doses at steady state, and 90% TAR bacteriostatic and bactericidal actions, dosages of 6.2 and 9.6 mg/kg (P. multocida and 18.2 and 35.2 mg/kg (A. pleuropneumoniae were required. PK/PD integration and modelling approaches to dose determination indicate the possibility of tailoring dose to a range of end-points.

Investigation of genetic diversity and epidemiological characteristics of Pasteurella multocida isolates from poultry in southwest China by population structure, multi-locus sequence typing and virulence-associated gene profile analysis.

Science.gov (United States)

Li, Zhangcheng; Cheng, Fangjun; Lan, Shimei; Guo, Jianhua; Liu, Wei; Li, Xiaoyan; Luo, Zeli; Zhang, Manli; Wu, Juan; Shi, Yang

2018-04-25

Fowl cholera caused by Pasteurella multocida has always been a disease of global importance for poultry production. The aim of this study was to obtain more information about the epidemiology of avian P. multocida infection in southwest China and the genetic characteristics of clinical isolates. P. multocida isolates were characterized by biochemical and molecular-biological methods. The distributions of the capsular serogroups, the phenotypic antimicrobial resistance profiles, lipopolysaccharide (LPS) genotyping and the presence of 19 virulence genes were investigated in 45 isolates of P. multocida that were associated with clinical disease in poultry. The genetic diversity of P. multocida strains was performed by 16S rRNA and rpoB gene sequence analysis as well as multilocus sequence typing (MLST). The results showed that most (80.0%) of the P. multocida isolates in this study represented special P. multocida subspecies, and 71.1% of the isolates showed multiple-drug resistance. 45 isolates belonged to capsular types: A (100%) and two LPS genotypes: L1 (95.6%) and L3 (4.4%). MLST revealed two new alleles (pmi77 and gdh57) and one new sequence type (ST342). ST129 types dominated in 45 P. multocida isolates. Isolates belonging to ST129 were with the genes ompH+plpB+ptfA+tonB, whereas ST342 included isolates with fur+hgbA+tonB genes. Population genetic analysis and the MLST results revealed that at least one new ST genotype was present in the avian P. multocida in China. These findings provide novel insights into the epidemiological characteristics of avian P. multocida isolates in southwest China.

Serological patterns of Actinobacillus pleuropneumoniae, Mycoplasma hyopneumoniae, Pasteurella multocida and Streptococcus suis in pig herds affected by pleuritis.

Science.gov (United States)

Wallgren, Per; Nörregård, Erik; Molander, Benedicta; Persson, Maria; Ehlorsson, Carl-Johan

2016-10-04

Respiratory illness is traditionally regarded as the disease of the growing pig, and has historically mainly been associated to bacterial infections with focus on Mycoplasma hyopneumoniae and Actinobacillus pleuropneumoniae. These bacteria still are of great importance, but continuously increasing herd sizes have complicated the scenario and the influence of secondary invaders may have been increased. The aim of this study was to evaluate the presence of A. pleuropneumoniae and M. hyopneumoniae, as well as that of the secondary invaders Pasteurella multocida and Streptococcus suis by serology in four pig herds (A-D) using age segregated rearing systems with high incidences of pleuritic lesions at slaughter. Pleuritic lesions registered at slaughter ranged from 20.5 to 33.1 % in the four herds. In herd A, the levels of serum antibodies to A. pleuropneumoniae exceeded A 450  > 1.5, but not to any other microbe searched for. The seroconversion took place early during the fattening period. Similar levels of serum antibodies to A. pleuropneumoniae were also recorded in herd B, with a subsequent increase in levels of antibodies to P. multocida. Pigs seroconverted to both agents during the early phase of the fattening period. In herd C, pigs seroconverted to P. multocida during the early phase of the fattening period and thereafter to A. pleuropneumoniae. In herd D, the levels of antibodies to P. multocida exceeded A 450  > 1.0 in absence (A 450  hyopneumoniae and to S. suis remained below A 450  hyopneumoniae late during the rearing period (herd B-D), or not at all (herd A). Different serological patterns were found in the four herds with high levels of serum antibodies to A. pleuropneumoniae and P. multocida, either alone or in combination with each other. Seroconversion to M. hyopneumoniae late during the rearing period or not at all, confirmed the positive effect of age segregated rearing in preventing or delaying infections with M

Rapid diagnosis of virulent Pasteurella multocida isolated from farm animals with clinical manifestation of pneumonia respiratory infection using 16S rDNA and KMT1 gene

Directory of Open Access Journals (Sweden)

Gamal Mohamedin Hassan

2016-01-01

Full Text Available Objective: To characterize intra-isolates variation between clinical isolates of Pasteurella multocida (P. multocida isolated from sheep, cattle and buffalo at molecular level to check the distribution of pneumonia and hemorrhagic septicemia in some regions of Fayoum, Egypt. Methods: These isolates were obtained from various locations in the Fayoum Governorate, Egypt and they were identified by amplifying 16S rDNA and KMT1 genes using their DNA as a template in PCR reaction. Results: The results demonstrated that the five selective isolates of P. multocida had similar size of PCR products that generated one band of 16S rDNA having 1 471 bp and KMT1 gene having 460 bp. The phylogenetic tree and similarity of the five selective isolates of P. multocida which were collected from GenBank database were calculated and analyzed for the nucleotide sequence of 16S rDNA and KMT1 genes. The sequencing result of 16S rRNA gene product (1 471 bp for the five selective isolates of P. multocida showed that the isolates of sheep (FUP2 shared 94.08%, 88.10% homology with the buffalo isolate (FUP8 and cattle isolate (FUP9 respectively, whereas, the buffalo isolate (FUP5 shared 98.18% and 94.40% homology with the cattle isolates (FUP12 and FUP9. Conclusions: The results indicated the relationships of P. multocida isolated from buffalo and cattle rather than the close relationships between P. multocida isolated from cattle and sheep. Diagnosis of P. multocida by 16S rDNA and KMT1 gene sequences was important to determine the antigen that is responsible for protective cover within the same group of animals and to help for the production of new vaccines for the control of microbial infection for domestic animals.

Distribution of the ompA-types among ruminant and swine pneumonic strains of Pasteurella multocida exhibiting various cap-locus and toxA patterns.

Science.gov (United States)

Vougidou, C; Sandalakis, V; Psaroulaki, A; Siarkou, V; Petridou, E; Ekateriniadou, L

2015-05-01

Pasteurella multocida is an important pathogen in food-producing animals and numerous virulence genes have been identified in an attempt to elucidate the pathogenesis of pasteurellosis. Currently, some of these genes including the capsule biosynthesis genes, the toxA and the OMPs-encoding genes have been suggested as epidemiological markers. However, the number of studies concerning ruminant isolates is limited, while, no attempt has ever been made to investigate the existence of ompA sequence diversity among P. multocida isolates. The aim of the present study was the comparative analysis of 144 P. multocida pneumonic isolates obtained from sheep, goats, cattle and pigs by determining the distribution of the ompA-types in conjunction with the cap-locus and toxA patterns. The ompA genotypes of the isolates were determined using both a PCR-RFLP method and DNA sequence analysis. The most prevalent capsule biosynthesis gene among the isolates was capA (86.1%); a noticeable, however, rate of capD-positive isolates (38.6%) was found among the ovine isolates that had been associated primarily with the capsule type A in the past. Moreover, an unexpectedly high percentage of toxA-positive pneumonic isolates was noticed among small ruminants (93.2% and 85.7% in sheep and goats, respectively), indicating an important epidemiological role of toxigenic P. multocida for these species. Despite their great heterogeneity, certain ompA-genotypes were associated with specific host species, showing evidence of a host preference. The OmpA-based PCR-RFLP method developed proved to be a valuable tool in typing P. multocida strains. Copyright © 2015 Elsevier GmbH. All rights reserved.

Mutant prevention concentration and PK-PD relationships of enrofloxacin for Pasteurella multocida in buffalo calves.

Science.gov (United States)

Balaje, R M; Sidhu, P K; Kaur, G; Rampal, S

2013-12-01

This study validated the use of mutant prevention concentration (MPC) and pharmacokinetic and pharmacodynamic (PK-PD) modeling approach for optimization of dose regimen of enrofloxacin to contain the emergence of Pasteurella multocida resistance. The PK and PD characteristics of enrofloxacin were investigated in buffalo calves after intramuscular administration at a dose rate of 12 mg/kg. The concentration of enrofloxacin and ciprofloxacin in serum were determined by high-performance liquid chromatography. The serum peak concentration (Cmax), terminal half-life (t1/2K10), volume of distribution (Vd(area)/F) and mean residence time (MRT) of enrofloxacin were 1.89 ± 0.35 μg/ml, 5.14 ± 0.66 h, 5.59 ± 0.99 l/kg/h and 8.52 ± 1.29 h, respectively. The percent metabolite conversion ratio of ciprofloxacin to enrofloxacin was 79. The binding of enrofloxacin to plasma proteins was 11%. The MIC, MBC and MPC for enrofloxacin against P. multocida were 0.05, 0.06 μg/ml and 1.50 μg/ml.In vitro and ex-vivo bactericidal activity of enrofloxacin was concentration dependent. Modeling of ex-vivo growth inhibition data to the sigmoid Emax equation provided AUC24h/MIC values to produce bacteriostatic (19 h), bactericidal (43 h) and bacterial eradication (64 h). PK-PD data in conjunction with MPC and MIC90 data predicted dosage schedules for enrofloxacin that may achieve optimum efficacy in respect of bacteriological and clinical cure and minimize the risk of emergence of resistance. Copyright © 2013 Elsevier Ltd. All rights reserved.

ESTUDIOS DE AISLAMIENTO Y FRACCIONAMIENTO DE UN COMPLEJO GLICOPROTEICO DE PASTEURELLA MULTOCIDA

Directory of Open Access Journals (Sweden)

Yolanda de Navarro

2010-07-01

Full Text Available Mediante la extracción con solución de NaCl 2.5% (p/v a 47' C, se obtuvo un complejo glicoproteíco de Pasteurella multocida que fue parcialmente purificado mediante filtración por gel usando Sephacryl S-200. Las fracciones 1, 2 y 3 presentaron líneas de precipitinas en imnunodifusión contra sueros hiperimnunes de conejos inoculados con extracto salino 2.5% (P/V a 47" C y 66' C. Por electroforesis SDS-PAGE. se determinaron bandas de proteínas con pesos moleculares entre 98.800 y 17.700 daltons. Lafracción lyel extracto salino crudo a 47" C se utilizaron como antígenos adsorbidos en gel de Al(OHj y con ellos se efectuaron ensayos de protección en ratones, teniendo como referencia la vacuna comercial contra Septicemia Hemorrágica producida por VECOL S.A. Mediante el método estadístico de Reed Muench se estableció el índice de protección y se encontró que todos los antígenos fueron considerados prolectores, siendo la fracción 1 la de mayor índice de protección con una dosis inferior.

A capsule/lipopolysaccharide/MLST genotype D/L6/ST11 of Pasteurella multocida is likely to be strongly associated with swine respiratory disease in China.

Science.gov (United States)

Peng, Zhong; Wang, Haonan; Liang, Wan; Chen, Yibao; Tang, Xibiao; Chen, Huanchun; Wu, Bin

2018-01-01

Pasteurella multocida is a leading cause of respiratory disease in pigs worldwide. In this study, we determined the genetic characteristics of 115 P. multocida isolates from the lungs of pigs with respiratory disease in China in 2015 using capsular typing, lipopolysaccharide (LPS) genotyping, and virulence genotyping based on the detection of virulence-associated genes. The results showed that the isolates belonged to three capsular types: A (49.6%), D (46.1%), and nontypable (4.3%); and two LPS genotypes: L3 (22.6%) and L6 (77.4%). When combining the capsular types with the LPS genotypes, a genotype group D: L6 (46.1%) was the most prevalent among the strains. Among the 23 virulence-associated genes detected in this study, a small number of them displayed a certain level of "genotype-preference". We found that pfhA, hgbA, and hgbB had a close association with P. multocida LPS genotypes, while tadD was more associated with P. multocida capsular types. In addition, multilocus sequence typing (MLST) on 40 P. multocida isolates identified four sequence types: ST3, ST10, ST11, and ST16, and the distribution of ST11 was significantly higher than the other MLST genotypes. Interestingly, all of the ST11 isolates detected in this study were genotype D: L6 strains and they were 100% positive for hgbB. Our data suggest that a capsule/LPS/MLST genotype D/L6/ST11 is likely to be strongly associated with respiratory clinical manifestation of the disease in pigs.

Pasteurella multocida in backyard chickens in Upper Egypt: incidence with polymerase chain reaction analysis for capsule type, virulence in chicken embryos and antimicrobial resistance.

Science.gov (United States)

Mohamed, Moemen A; Mohamed, Mohamed-Wael A; Ahmed, Ahmed I; Ibrahim, Awad A; Ahmed, Mohamed S

2012-01-01

The prevalence of Pasteurella multocida strains among 275 backyard chickens from different regions of Upper Egypt was studied. A total of 21 isolates of P. multocida were recovered in 21 out of 275 chickens tested (7.6%) and were confirmed using phenotypic characterisation. Somatic serotyping of the 21 isolates resulted in 12 isolates being classed as serotype A:1 (57.14%), 4 as serotype A:3 (19.05%) and 5 could not be typed (23.8%). Capsular typing, using multiplex polymerase chain reaction (PCR), demonstrated that 18 strains were capsular type A (85.7%), and 3 were type D (14.3%). The present findings suggest that a multiplex capsular PCR could be valuable for the rapid identification of P. multocida in cases of fowl cholera infection. A total of 5 isolates of P. multocida were selected to study their pathogenicity in embryonated chicken eggs instead of conducting a study in mature chickens. The results showed a variation in pathogenicity between the strains tested, namely: serotype A:1 strains caused 80% mortality, in contrast to 20% mortality by type D strains. Pathological findings included severe congestion of the entire embryo, haemorrhaging of the skin, feather follicles and toe, and ecchymotic haemorrhages on the liver of the inoculated embryos. The observations in this study indicate that P. multocida serogroup A could be highly pathogenic for mature chickens and therefore might be a cause of considerable economic losses in commercial production. A total of 10 isolates were subjected to antimicrobial susceptibility to determine the minimal inhibitory concentration of 7 antimicrobials. All isolates were susceptible to ciprofloxacin, florfenicol, streptomycin and sulphamethoxazol with trimethoprim and with varying degrees of sensitivity to the other agents.

Serological evidence of avian encephalomyelitis virus and Pasteurella multocida infections in free-range indigenous chickens in Southern Mozambique.

Science.gov (United States)

Taunde, Paula; Timbe, Palmira; Lucas, Ana Felicidade; Tchamo, Cesaltina; Chilundo, Abel; Dos Anjos, Filomena; Costa, Rosa; Bila, Custodio Gabriel

2017-06-01

A total of 398 serum samples from free-range indigenous chickens originating from four villages in Southern Mozambique were tested for the presence of avian encephalomyelitis virus (AEV) and Pasteurella multocida (PM) antibodies through commercial enzyme-linked immunosorbent assay (ELISA) kits. AEV and PM antibodies were detected in all villages surveyed. The proportion of positive samples was very high: 59.5% (95% confidence interval (CI) 51.7-67.7%) for AEV and 71.5% (95% CI 67.7-77.3%) for PM. Our findings revealed that these pathogens are widespread among free-range indigenous chickens in the studied villages and may represent a threat in the transmission of AEV and PM to wild, broiler or layer chickens in the region. Further research is warranted on epidemiology of circulating strains and impact of infection on the poultry industry.

The capsule is a virulence determinant in the pathogenesis of Pasteurella multocida M1404 (B:2).

Science.gov (United States)

Boyce, J D; Adler, B

2000-06-01

Capsules from a range of pathogenic bacteria are key virulence determinants, and the capsule has been implicated in virulence in Pasteurella multocida. We have previously identified and determined the nucleotide sequence of the P. multocida M1404 (B:2) capsule biosynthetic locus (J. D. Boyce, J. Y. Chung, and B. Adler, Vet. Microbiol. 72:121-134, 2000). The cap locus consists of 15 genes, which can be grouped into three functional regions. Regions 1 and 3 contain genes proposed to encode proteins involved in capsule export, and region 2 contains genes proposed to encode proteins involved in polysaccharide biosynthesis. In order to construct a mutant impaired in capsule export, the final gene of region 1, cexA, was disrupted by insertion of a tetracycline resistance cassette by allelic replacement. The genotype of the tet(M) OmegacexA mutant was confirmed by Southern hybridization and PCR. The acapsular phenotype was confirmed by immunofluorescence, and the strain could be complemented and returned to capsule production by the presence of a cloned uninterrupted copy of cexA. Wild-type, mutant, and complemented strains were tested for virulence by intraperitoneal challenge of mice; the presence of the capsule was shown to be a crucial virulence determinant. Following intraperitoneal challenge of mice, the acapsular bacteria were removed efficiently from the blood, spleen, and liver, while wild-type bacteria multiplied rapidly. Acapsular bacteria were readily taken up by murine peritoneal macrophages, but wild-type bacteria were significantly resistant to phagocytosis. Both wild-type and acapsular bacteria were resistant to complement in bovine and murine serum.

Pasteurella multocida in backyard chickens in Upper Egypt: incidence with polymerase chain reaction analysis for capsule type, virulence in chicken embryos and antimicrobial resistance

Directory of Open Access Journals (Sweden)

Moemen A. Mohamed

2012-03-01

Full Text Available The prevalence of Pasteurella multocida strains among 275 backyard chickens from different regions of Upper Egypt was studied. A total of 21 isolates of P. multocida were recovered in 21 out of 275 chickens tested (7.6% and were confirmed using phenotypic characterisation. Somatic serotyping of the 21 isolates resulted in 12 isolates being classed as serotype A:1 (57.14%, 4 as serotype A:3 (19.05% and 5 could not be typed (23.8%. Capsular typing, using multiplex polymerase chain reaction (PCR, demonstrated that 18 strains were capsular type A (85.7%, and 3 were type D (14.3%. The present findings suggest that a multiplex capsular PCR could be valuable for the rapid identification of P. multocida in cases of fowl cholera infection. A total of 5 isolates of P. multocida were selected to study their pathogenicity in embryonated chicken eggs instead of conducting a study in mature chickens. The results showed a variation in pathogenicity between the strains tested, namely: serotype A:1 strains caused 80% mortality, in contrast to 20% mortality by type D strains. Pathological findings included severe congestion of the entire embryo, haemorrhaging of the skin, feather follicles and toe, and ecchymotic haemorrhages on the liver of the inoculated embryos. The observations in this study indicate that P. multocida serogroup A could be highly pathogenic for mature chickens and therefore might be a cause of considerable economic losses in commercial production. A total of 10 isolates were subjected to antimicrobial susceptibility to determine the minimal inhibitory concentration of 7 antimicrobials. All isolates were susceptible to ciprofloxacin, florfenicol, streptomycin and sulphamethoxazol with trimethoprim and with varying degrees of sensitivity to the other agents.

Characterization of Pasteurella multocida involved in rabbit infections

DEFF Research Database (Denmark)

Massacci, Francesca Romana; Magistrali, Chiara Francesca; Cucco, Lucilla

2018-01-01

In rabbit, P. multocida is considered a predominant pathogenic agent; despite this, few data on the molecular epidemiology are available so far. The aim of this work was to characterize P. multocida isolates from rabbit affected by various diseases in Italy. Comparison was made to reference strains...... belonged to the LPS genotypes 3 (22/39) or 6 (17/39). The clonal relationships of the Italian strains from rabbit had similarity to previously reported rabbit isolates that belonged to ST9, ST74, ST204 and ST206, however, they differed from other rabbit references strains that belonged to six other STs....... In particular, ST9 with capsular type F has been previously reported from diseased rabbit in Czech Republic and ST74 has been observed for older rabbit isolates. ST50 has probably been reported from Spain. ST9 and ST50 have previously also been reported from birds and pig, respectively, whereas ST74 has...

Determination of the minimum inhibitory concentration (MIC and mutant prevention concentration (MPC of selected antimicrobials in bovine and swine Pasteurella multocida, Escherichia coli, and Staphylococcus aureus isolates

Directory of Open Access Journals (Sweden)

Kateřina Nedbalcová

2015-01-01

Full Text Available We compared the values of the minimum inhibitory concentration (MIC and mutant prevention concentration (MPC values ​​of three antimicrobial agents for 72 bovine isolates of Pasteurella multocida, 80 swine isolates of P. multocida, 80 bovine isolates of Escherichia coli, 80 swine isolates of E. coli, and 80 isolates of Staphylococcus aureus from bovine mastitis. The ratio of MIC90​​/MPC90 which limited mutant selection window (MSW was ≤ 0.12/4 mg/l for enrofloxacin, 0.5/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in bovine P. multocida isolates, ≤ 0.12/2 mg/l for enrofloxacin, 0.5/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in swine P. multocida isolates, 1/16 mg/l for enrofloxacin, 8/≥ 64 mg/l for florfenicol and 8/≥ 128 mg/l for tulathromycin in bovine E. coli isolates, 0.5/16 mg/l for enrofloxacin, ≥ 64/≥ 64 mg/l for florfenicol and 8/≥ 128 mg/l for tulathromycin in swine E. coli isolates, and 0.25/16 mg/l for enrofloxacin, 4/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in S. aureus isolates. These findings indicate that the dosage of antimicrobial agents to achieve serum concentration equal to or higher than MPC could reduce selection of resistant bacterial subpopulation.

Clinico-pathology, hematology and biochemistry responses in buffaloes towards Pasteurella multocida type B: 2 immunogen lypopolysaccharide via oral and intravenous routes of infection.

Science.gov (United States)

Chung, Eric Lim Teik; Abdullah, Faez Firdaus Jesse; Ibrahim, Hayder Hamzah; Marza, Ali Dhiaa; Zamri-Saad, Mohd; Haron, Abdul Wahid; Lila, Mohd Azmi Mohd; Norsidin, Mohd Jefri

2016-02-01

Haemorrhagic septicaemia is a disease caused by Pasteurella multocida serotype B: 2 and E: 2. The organism causes acute, highly fatal septicaemic disease with high morbidity and mortality in cattle and more susceptible in buffaloes. Lipopolysaccharide can be found on the outer cell wall of the organism. Lipopolysaccharide is released during multiplication which leads to inflammatory reaction. It represents the endotoxin of P. multocida type B: 2 and responsible for toxicity in haemorrhagic septicaemia which plays an important role in the pathogenesis of the disease. Therefore, the aim of this study was to investigate the clinical signs, blood parameters, gross post mortem lesions and histopathology changes caused by P. multocida type B:2 immunogen lipopolysaccharide infections initiated through intravenous and oral routes of infection. 9 buffalo heifers were divided equally into 3 treatment groups. Group 1 was inoculated orally with 10 ml of phosphate buffer saline (PBS); Group 2 and 3 were inoculated with 10 ml of lipopolysaccharide broth intravenously and orally respectively. For the clinical signs, there were significant differences (p hematology and biochemistry findings, there were significant differences (p 0.05) in the MCHC, leukocytes, band neutrophils, basophils, thrombocytes, plasma protein, icterus index, total protein, globulin and A:G ratio between intravenous and oral group. For Group 2 buffaloes, there were gross lesions in the lung, trachea, heart, liver, spleen, and kidney. In contrast, lesions were only observed in the lung, trachea and liver of Group 3 buffaloes. There were significant differences (p 0.05) in edema lesion between groups. In conclusion, this study is a proof that oral route infection of P. multocida type B:2 immunogen lipopolysaccharide can be used to stimulate host cell responses where oral vaccine through feed could be developed in the near future. Copyright © 2015 Elsevier Ltd. All rights reserved.

Identificação de transcritos diferencialmente expressos por Pasteurella multocida em condições de privação de ferro

Directory of Open Access Journals (Sweden)

Mayara I.V. Silva

Full Text Available RESUMO: Ferro (Fe é um elemento essencial e a capacidade de adquiri-lo in vivo têm sido descrita em diversos agentes patogênicos através de fatores de virulência. Análises de transcritos durante a privação de Fe tem sido descritos através da técnica de "microarray", entretanto a técnica de RNA-seq recentemente tem demonstrado resultados superiores. Neste trabalho, o isolado de Pasteurella multocida (Pm 16759 altamente patogênico em suínos foi cultivado em duas condições com diferentes concentrações de Fe (controle e privação com o objetivo de analisar transcritos diferencialmente expressos. O RNA total das duas condições foi extraído e sequenciado através da plataforma de nova geração Ion Torrent. Os dados foram analisados no Software Ion Reporter(tm e processados no programa Rockhopper. Foram obtidas 1.341.615 leituras com tamanho médio de 81pb, com 96% de alinhamento com o genoma de Pasteurella multocida subsp. multocida 3480 e 98,8% de acurácia. No mapeamento das leituras das duas condições, observou-se 2,652 transcritos e destes, 177 (6,7% foram diferencialmente expressos, sendo 93 na condição controle (Fe+ e 84 na condição de privação (Fe-. Na condição de privação de Fe, o perfil de transcritos foram associados a função de transporte celular (fbp ABC, permease de alta afinidade com Fe2+/Pb2+ e proteína periplasmática de alta afinidade com Fe2+ , reguladores transcricionais e proteínas hipotéticas. O perfil na condição controle (Fe+ apresentou transcritos diferencialmente expressos associados ao RNAs anti-sense (asRNA e genes do metabolismo energético (fructose-1,6-bisfosfatase. O estudo comprovou que a restrição de Fe aumenta a expressão de genes envolvidos no transporte celular, reguladores transcricionais, proteínas hipotéticas e desconhecidas e permitiu ainda a identificação de novos genes como a permease de alta afinidade com Fe2+/Pb2+ e proteina periplasmática de alta afinidade

Development of fowl cholera vaccine: I. Protection of Pasteurella multocida local isolate vaccine against challenge of homologous and heterologous strains.

Directory of Open Access Journals (Sweden)

Supar

2001-03-01

Full Text Available Pasteurella multocida locally isolated from chicken and ducks (BCC 299, BCC 2331, DY1, DY2, 12TG, 15TG andimported strains (BCC 1359, 1362; HEDDLESTON group 1 and 6 respectively had been tested for its pathogenicity in theprevious study. The aims of this experiment were to study the preparation of local isolate pasteurellosis vaccines and to determine the protective effect of that vaccines in chicken against the highly pathogenic local isolates of P. multocida. Killed monovalent, bivalent and polyvalent pasteurellosis vaccines were prepared and each was adjunvanted with aluminum hydroxide gel at a final concentration of 1.5% and the cell concentration was equal to the No 10 of MacFarland tube standard. Each of the vaccine prepared was used to vaccinated on a group of six week old of layer chicken (8 per group. Each chicken was subcutaneously injected with 0.2 ml of vaccine, four weeks later each was boostered with similar vaccine with the same dose. Two weeks after giving the boostered vaccine each group of chicken were challenged, half with life bacterium of P. Multocida BCC 2331 and other with DY2. Any chick which survive after challenge was designated as protected by vaccination. Before vaccination 1 ml of blood was drawn from each of chicken and then two weeks apart up to challenge. Serum from each sample was separated and kept in deep freeze until tested by enzyme-linked immunosorbent assay (ELISA. Chicken vaccinated with killed whole cell P. multocida vaccines of monovalent (BCC 2331 or DY2 and bivalent (BCC 2331 + DY2 were protected against challenge with live bacterium of either BCC 2331 or DY2 at rate 67-100%. There was no protection in chicken vaccinated with either BCC 299, DY1, 12TG, 15TG, BCC 1359, or 1362 killed vaccine. Similarly no protection of chicken vaccinated with either DY1 + BCC299, 12TG + 15TG or BCC 1359 + BCC 1362 bivalent vaccines. The protection rate of the polyvalent local isolate vaccine was at average 50-75%. All

Evaluación de dos técnicas de subtipificación molecular para el estudio de Pasteurella multocida Evaluation of two techniques of molecular subtyping to study Pasteurella multocida

Directory of Open Access Journals (Sweden)

G. A. Leotta

2006-12-01

Full Text Available Se determinó la tipibilidad, la reproducibilidad y el poder discriminatorio de ERIC-PCR y ApaI-PFGE para establecer la relación genética de cepas de Pasteurella multocida. Se estudiaron 49 cepas de diferente origen, subespecie, biotipo, grupo capsular, serotipo somático y perfil de resistencia antimicrobiana. Por ERIC-PCR se establecieron 31 patrones, los que presentaron entre 10 y 14 bandas en un rango comprendido entre 0,2 y 1,2 kb. Por ApaI-PFGE se detectaron 37 patrones de restricción, los cuales presentaron entre 7 y 15 bandas bien definidas de 34 a 450 kb. La tipibilidad de ERIC-PCR fue del 100% (T=1 y la de ApaI-PFGE del 94% (T=0,94. La reproducibilidad de ambas técnicas fue del 100% (R=1; sin embargo, el poder discriminatorio de ERIC-PCR fue 93% (D=0,93 y el de ApaI-PFGE 98% (D=0,98. Mediante ambas técnicas fue posible agrupar las cepas con relación epidemiológica y diferenciar claramente las cepas no relacionadas. Se demostró el valor de ERIC-PCR y ApaI-PFGE para complementar estudios epidemiológicos, principalmente si las cepas en estudio son analizadas por ambas técnicas.Typeability, reproducibility, and discriminatory power of ERIC-PCR and ApaI-PFGE to establish the genetic relation of P. multocida strains were determined. Forty-nine strains of different source, biotype, capsular group, somatic serotype, and resistance to antimicrobials were studied. By ERIC-PCR, 31 patterns were defined with 10 to 14 bands in a rank of 0.2 and 1.2 kb. By ApaI-PFGE, 37 restriction patterns were established with 7 to 15 bands of 34 to 450 kb. Typeability was 100% (T=1 for ERIC-PCR, and 94% (T=0.94 for ApaI-PFGE. Reproducibility of both techniques was 100% (R=1. Discriminatory power was 93% (D=0.93 for ERIC-PCR, and 98% (D=0.98 for ApaI-PFGE. By using both techniques, epidemiologically related strains were grouped, and unrelated strains were clearly differentiated. The value of ERIC-PCR and ApaI-PFGE as complements to epidemiologic studies

Molecular analysis of Pasteurella multocida strains isolated from fowl cholera infection in backyard chickens

Directory of Open Access Journals (Sweden)

Mohamed-Wael Abdelazeem Mohamed

2014-01-01

Conclusion: Based on the previous findings, there are three spreading clusters that may indicate the association of a small number of P. multocida variants with the majority of cases suggesting that certain clones of P. multocida are able to colonize the examined backyard chickens. Also, the ease and rapidity of RAPD-PCR support the use of this technique as alternative to the more labour-intensive SDS-PAGE system for strain differentiation and epidemiological studies of avian P. multocida. Further application of RAPD technology to the examination of avian cholera outbreaks in commercially available flocks may facilitate more effective management of this disease by providing the potential to investigate correlations of P. multocida genotypes, to identify affiliations between bird types and bacterial genotypes, and to elucidate the role of specific bird species in disease transmission.

Surveillance of antimicrobial resistance in clinical isolates of Pasteurella multocida and Streptococcus suis from Ontario swine

Science.gov (United States)

Glass-Kaastra, Shiona K.; Pearl, David L.; Reid-Smith, Richard J.; McEwen, Beverly; Slavic, Durda; Fairles, Jim; McEwen, Scott A.

2014-01-01

Susceptibility results for Pasteurella multocida and Streptococcus suis isolated from swine clinical samples were obtained from January 1998 to October 2010 from the Animal Health Laboratory at the University of Guelph, Guelph, Ontario, and used to describe variation in antimicrobial resistance (AMR) to 4 drugs of importance in the Ontario swine industry: ampicillin, tetracycline, tiamulin, and trimethoprim–sulfamethoxazole. Four temporal data-analysis options were used: visualization of trends in 12-month rolling averages, logistic-regression modeling, temporal-scan statistics, and a scan with the “What’s strange about recent events?” (WSARE) algorithm. The AMR trends varied among the antimicrobial drugs for a single pathogen and between pathogens for a single antimicrobial, suggesting that pathogen-specific AMR surveillance may be preferable to indicator data. The 4 methods provided complementary and, at times, redundant results. The most appropriate combination of analysis methods for surveillance using these data included temporal-scan statistics with a visualization method (rolling-average or predicted-probability plots following logistic-regression models). The WSARE algorithm provided interesting results for quality control and has the potential to detect new resistance patterns; however, missing data created problems for displaying the results in a way that would be meaningful to all surveillance stakeholders. PMID:25355992

Comparison of gene expression of Toll-like receptors and cytokines between Piau and Commercial line (Landrace×Large White crossbred) pigs vaccinated against Pasteurella multocida type D.

Science.gov (United States)

Sousa, Katiene Régia Silva; Ribeiro, André Mauric Frossard; Dantas, Waleska de Melo Ferreira; Oliveira, Leandro Licursi de; Gasparino, Eliane; Guimarães, Simone Eliza Facioni

2017-10-01

We aimed to compare Toll-like receptors (TLR) and cytokines expression in local Piau breed and a Commercial line (Landrace×Large White crossbred) pigs in response to vaccination against Pasteurella multocida type D. Seronegative gilts for Pasteurella multocida type D and Mycoplasma hyopneumoniae were used, from which peripheral blood mononuclear cells (PBMC) were collected in four time points (T0, T1, T2 and T3; before and after each vaccination dose). For bronchoalveolar lavage fluid cells (BALF), we set groups of vaccinated and unvaccinated animals for both genetic groups. Gene expression was evaluated on PBMC and BALF. In PBMC, when we analyzed time points within breeds, significant differences in expression for TLRs and cytokines, except TGFβ, were observed for Commercial animals. For the Piau pigs, only TGFβ showed differential expression. Comparing the expression among genetic groups, the Commercial pigs showed higher expression for TLRs after first vaccination dose, while for IL2, IL6, IL12 and IL13, higher expression was also observed in T3 and IL8 and IL10, in T1 and T3. Still comparing the breeds, the crossbred animals showed higher expression for TNFα in T1 and T2, while for TGFβ only in T2. For gene expression in BALF, vaccinated Commercial pigs showed higher expression of TLR6, TLR10, IL6, IL8, IL10, TNFα and TGFβ genes than vaccinated Piau pigs. The Commercial line pigs showed higher sensitivity to vaccination, while in local Piau breed lower responsiveness, which may partly explain genetic variability in immune response and will let us better understand the tolerance/susceptibility for pasteurellosis. Copyright © 2017 Elsevier Ltd. All rights reserved.

[In vitro activity of 12 antibiotics used in veterinary medicine against Mannheimia haemolytica and Pasteurella multocida isolated from calves in the Netherlands].

Science.gov (United States)

Mevius, D J; Hartman, E G

2000-03-01

Results of susceptibility tests of clinical isolates of animal pathogens are periodically summarized and reported by the Animal Health Service. However, these results are based upon qualitative test methods. In the present paper results of quantitative susceptibility tests of twelve antibacterial agents against Mannheimia haemolytica (MHA) and Pasteurella multocida (PMU) isolated from Dutch calves in 1996 and 1997 are presented. Minimum inhibitory concentrations of amoxicillin, ceftiofur, tetracycline, trimethoprim-sulphamethoxazole, tilmicosin, neomycin, gentamicin, spectinomycin, flumequine, enrofloxacin, chloramphenicol and florfenicol were determined. No resistance was detected for ceftiofur and florfenicol. Three strains had an intermediate susceptibility to tilmicosin. The resistance percentages of MHA and PMU for neomycin, gentamicin, spectinomycin, flumequine, enrofloxacin, and chloramphenicol varied from 2% to 16%. Higher resistance percentages (16%-53%) were observed for amoxicillin, tetracycline, and trimethoprim-sulphamethoxazole. The MIC breakpoints used to determine whether a strain is susceptible, intermediate, or resistant are arbitrary and discussed in this paper.

Pasteurella multocida isolated from wild birds of North America: a serotype and DNA fingerprint study of isolates from 1978 to 1993

Science.gov (United States)

Wilson, M.A.; Duncan, R.M.; Nordholm, G.E.; Berlowski, B.M.

1995-01-01

Serotype and DNA fingerprint methods were used to study Pasteurella multocida isolated from 320 wild birds of North America. Isolates were collected during 1978-93. The HhaI profiles of 314 isolates matched the HhaI profile of somatic reference type 1, strain X-73; somatic type 1 antigen was expressed by 310 isolates, and the serotype of four isolates was undetected. Differentiation of the 314 isolates was observed by digestion of DNA with HpaII. None of the HpaII profiles matched the HpaII profile of X-73 (designated HhaI 001/HpaII 001). Three HpaII profiles were recognized among the somatic type 1 isolates: HpaII 002 (n = 18), HpaII 003 (n = 122), and HpaII 004 (n = 174). Profile HpaII 002 was found among isolates collected during 1979-83. Profile HpaII 003 was identified from isolates collected during 1979-89, with the exception of two isolates in 1992. The HpaII 004 profile was identified from isolates collected during 1983-93. Of the six remaining isolates, four expressed somatic type 4 and had HhaI profiles identical to the somatic type 4 reference strain P-1662 profile (designated HhaI 004); these isolates were differentiated by digestion of DNA with HpaII. One isolate was identified as serotype F:11, and another was serotype A:3,4. In the present study, 314 of 316 (99.4%) isolates from wild birds in the Central, Mississippi, and Pacific flyways during 1978-93, were P. multocida somatic type 1.

Cellular defense of the avian respiratory system: effects of Pasteurella multocida on respiratory burst activity of avian respiratory tract phagocytes.

Science.gov (United States)

Ochs, D L; Toth, T E; Pyle, R H; Siegel, P B

1988-12-01

The respiratory tract of healthy chickens contain few free-residing phagocytic cells. Intratracheal inoculation with Pasteurella multocida stimulated a significant (P less than 0.05) migration of cells to the lungs and air sacs of White Rock chickens within 2 hours after inoculation. We found the maximal number of avian respiratory tract phagocytes (22.9 +/- 14.0 x 10(6] at 8 hours after inoculation. Flow cytometric analysis of these cells revealed 2 populations on the basis of cell-size and cellular granularity. One of these was similar in size and granularity to those of blood heterophils. Only this population was capable of generating oxidative metabolites in response to phorbol myristate acetate. The ability of the heterophils to produce hydrogen peroxide, measured as the oxidation of intracellularly loaded 2',7'-dichlorofluorescein, decreased with time after inoculation. These results suggest that the migration of heterophils, which are capable of high levels of oxidative metabolism, to the lungs and air sacs may be an important defense mechanism of poultry against bacterial infections of the respiratory tract.

Demonstration that Australian Pasteurella multocida isolates from sporadic outbreaks of porcine pneumonia are non-toxigenic (toxA-) and display heterogeneous DNA restriction endonuclease profiles compared with toxigenic isolates from herds with progressive atrophic rhinitis.

Science.gov (United States)

Djordjevic, S P; Eamens, G J; Ha, H; Walker, M J; Chin, J C

1998-08-01

Capsular types A and D of Pasteurella multocida cause economic losses in swine because of their association with progressive atrophic rhinitis (PAR) and enzootic pneumonia. There have been no studies comparing whole-cell DNA profiles of isolates associated with these two porcine respiratory diseases. Twenty-two isolates of P. multocida from diseased pigs in different geographic localities within Australia were characterised genotypically by restriction endonuclease analysis (REA) with the enzyme CfoI. Seven of 12 P. multocida isolates from nasal swabs from pigs in herds where PAR was either present or suspected displayed a capsular type D phenotype. These were shown to possess the toxA gene by polymerase chain reaction (PCR) and Southern hybridisation, and further substantiated by production of cytotoxin in vitro. The CfoI profile of one of these seven isolates, which was from the initial outbreak of PAR in Australia (in Western Australia, WA), was identical with profiles of all six other toxigenic isolates from sporadic episodes in New South Wales (NSW). The evidence suggests that the strain involved in the initial outbreak was responsible for the spread of PAR to the eastern states of Australia. Another 10 isolates, representing both capsular types A and D, were isolated exclusively from porcine lung lesions after sporadic outbreaks of enzootic pneumonia in NSW and WA. CfoI restriction endonuclease profiles of these isolates revealed considerable genomic heterogeneity. Furthermore, none of these possessed the toxA gene. This suggests that P. multocida strains with the toxA gene do not have a competitive survival advantage in the lower respiratory tract or that toxin production does not play a role in the pathology of pneumonic lesions, or both. REA with polyacrylamide gel electrophoresis and silver staining was found to be a practical and discriminatory tool for epidemiological tracing of P. multocida outbreaks associated with PAR or pneumonia in pigs.

Hematology of layers chickens vaccinated with fowl cholera vaccine and experimentally inoculated with virulent Pasteurella multocida serotypes in Zaria, Nigeria

Directory of Open Access Journals (Sweden)

Yusuf Madaki Lekko

2017-09-01

Conclusion The PCV significantly decrease P≤0.05 in layers vaccinated and inoculated with P. multocida but increase in unvaccinated layers inoculated P. multocida. The mean serum ALP concentration significantly increase P≤0.05 in unvaccinated layers inoculated with P. multocida when compared to layers vaccinated and inoculated with P. multocida. [J Adv Vet Anim Res 2017; 4(3.000: 234-240

Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

Directory of Open Access Journals (Sweden)

Stefan Carle

2017-01-01

Full Text Available The AB-type protein toxin from Pasteurella multocida (PMT contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases.

Antimicrobial susceptibility, serotypes and genotypes of Pasteurella multocida isolates associated with swine pneumonia in Taiwan.

Science.gov (United States)

Yeh, Jih-Ching; Lo, Dan-Yuan; Chang, Shao-Kuang; Chou, Chi-Chung; Kuo, Hung-Chih

2017-09-21

Pasteurella multocida (PM) can cause progressive atrophic rhinitis and suppurative bronchopneumonia in pigs. The present study performed antimicrobial susceptibility testing and serotype and genotype identification on the 62 PM strains isolated from the lungs of diseased pigs with respiratory symptoms. Antimicrobial susceptibility testing examined 13 antimicrobial agents (amoxicillin, cefazolin, doxycycline, flumequine, enrofloxacin, florfenicol, kanamycin, lincomycin, Linco-Spectin (lincomycin and spectinomycin), erythromycin, tylosin, tilmicosin and tiamulin). Antimicrobial resistance ratios were over 40% in all of the antimicrobial agents except for cefazolin. The highest levels of resistance (100%) were found for kanamycin, erythromycin and tylosin. The majority of isolated strains was serotype D:L6 (n=35) followed by A:L3 (n=17). Comparison of the antimicrobial resistance levels between the two serotypes showed that the antimicrobial resistance rates were higher in D:L6 than in A:L3 for all the tested antimicrobials except for tylosin and tilmicosin. For PM with erm (B), erm (T) or erm (42), the results showed no significant difference compared with non-resistance gene strains in phenotype. Pulsed-field gel electrophoresis genotyping using Apa I restriction digestion of the genomic DNA demonstrated that there were 17 distinct clusters with a similarity of 85% or more, and the genotyping result was similar to that of serotyping. The results of the present study demonstrated that the PM isolated from diseased pigs in Taiwan was resistant to multiple antimicrobials, and the distribution of antimicrobial resistance was associated with pulsotype and serotype. © British Veterinary Association (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Cross protection against fowl cholera disease with the use of recombinant Pasteurella multocida FHAB2 peptides vaccine

Science.gov (United States)

It has been demonstrated that fhaB2 (filamentous hemagglutinin) is an important virulence factor for P. multocida in development of fowl cholera disease and that recombinant FHAB2 peptides derived from P. multocida, Pm-1059, protect turkeys against Pm-1059 challenge. To test the hypothesis that rFHA...

Arf6-Dependent Intracellular Trafficking of Pasteurella multocida Toxin and pH-Dependent Translocation from Late Endosomes

Directory of Open Access Journals (Sweden)

Tracy P. M. Chong

2011-03-01

Full Text Available The potent mitogenic toxin from Pasteurella multocida (PMT is the major virulence factor associated with a number of epizootic and zoonotic diseases caused by infection with this respiratory pathogen. PMT is a glutamine-specific protein deamidase that acts on its intracellular G-protein targets to increase intracellular calcium, cytoskeletal, and mitogenic signaling. PMT enters cells through receptor-mediated endocytosis and then translocates into the cytosol through a pH-dependent process that is inhibited by NH4Cl or bafilomycin A1. However, the detailed mechanisms that govern cellular entry, trafficking, and translocation of PMT remain unclear. Co-localization studies described herein revealed that while PMT shares an initial entry pathway with transferrin (Tfn and cholera toxin (CT, the trafficking pathways of Tfn, CT, and PMT subsequently diverge, as Tfn is trafficked to recycling endosomes, CT is trafficked retrograde to the ER, and PMT is trafficked to late endosomes. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of PMT. Translocation of PMT from the endocytic vesicle occurs through a pH-dependent process that is also dependent on both microtubule and actin dynamics, as evidenced by inhibition of PMT activity in our SRE-based reporter assay, with nocodazole and cytochalasin D, respectively, suggesting that membrane translocation and cytotoxicity of PMT is dependent on its transfer to late endosomal compartments. In contrast, disruption of Golgi-ER trafficking with brefeldin A increased PMT activity, suggesting that inhibiting PMT trafficking to non-productive compartments that do not lead to translocation, while promoting formation of an acidic tubulovesicle system more conducive to translocation, enhances PMT translocation and activity.

Feeding of waste milk to Holstein calves affects antimicrobial resistance of Escherichia coli and Pasteurella multocida isolated from fecal and nasal swabs.

Science.gov (United States)

Maynou, G; Bach, A; Terré, M

2017-04-01

The use of milk containing antimicrobial residues in calf feeding programs has been shown to select for resistant fecal Escherichia coli in dairy calves. However, information is scarce about the effects of feeding calves waste milk (WM) on the prevalence of multidrug-resistant bacteria. The objective of this study was to determine the antimicrobial resistance patterns of fecal E. coli and nasal Pasteurella multocida isolates from calves fed either milk replacer (MR) or WM in 8 commercial dairy farms (4 farms per feeding program). Fecal and nasal swabs were collected from 20 ± 5 dairy calves at 42 ± 3.2 d of age, and from 10 of these at approximately 1 yr of age in each study farm to isolate the targeted bacteria. Furthermore, resistance of E. coli isolates from calf-environment and from 5 calves at birth and their dams was also evaluated in each study farm. Resistances were tested against the following antimicrobial agents: amoxicillin-clavulanic acid, ceftiofur, colistin, doxycycline (DO), enrofloxacin (ENR), erythromycin, florfenicol, imipenem, and streptomycin. A greater number of fecal E. coli resistant to ENR, florfenicol, and streptomycin and more multidrug-resistant E. coli phenotypes were isolated in feces of calves fed WM than in those fed MR. However, the prevalence of fecal-resistant E. coli was also influenced by calf age, as it increased from birth to 6 wk of age for ENR and DO and decreased from 6 wk to 1 yr of age for DO regardless of the feeding program. From nasal samples, an increase in the prevalence of colistin-resistant P. multocida was observed in calves fed WM compared with those fed MR. The resistance patterns of E. coli isolates from calves and their dams tended to differ, whereas similar resistance profiles among E. coli isolates from farm environment and calves were observed. The findings of this study suggest that feeding calves WM fosters the presence of resistant bacteria in the lower gut and respiratory tracts of dairy calves

Characterization of Pasteurella multocida associated with ovine pneumonia using multi-locus sequence typing (MLST) and virulence-associated gene profile analysis and comparison with porcine isolates.

Science.gov (United States)

García-Alvarez, Andrés; Vela, Ana Isabel; San Martín, Elvira; Chaves, Fernando; Fernández-Garayzábal, José Francisco; Lucas, Domínguez; Cid, Dolores

2017-05-01

Pasteurella multocida is a pathogen causing disease in a wide range of hosts including sheep and pigs. Isolates from ovine pneumonia were characterized by MLST (Multi-host and RIRDC databases) and virulence-associated gene (VAG) typing and compared with porcine isolates. Ovine and porcine isolates did not share any STs as determined by both schemes and exhibited different VAG profiles. With the Multi-host database, sixteen STs were identified among 43 sheep isolates with two STs (ST50 and ST19) comprising 53.5% of the isolates, and seven MLST genotypes (ST3, ST11 and ST62 included 75% of the isolates) among the 48 pig isolates. The most frequent VAG profile among sheep isolates was tbpA+/toxA+ (69.8% of isolates) and pfhA+ (62.5%) and hgbB+ (33.3%) among pig isolates. Representative ovine and porcine isolates of those STs identified by the Multi-host scheme were further typed using the RIRDC scheme. Seven STs were identified among the ovine isolates (ST95 RIRDC , ST131 RIRDC , ST203 RIRDC , ST320 RIRDC , ST324 RIRDC , ST321 RIRDC , and ST323 RIRDC ), with the latter four sequence types being new STs identified in this study, and six STs (ST9 RIRDC , ST13 RIRDC , ST27 RIRDC , ST50 RIRDC , and ST74 RIRDC and a new sequence type ST322 RIRDC ) among the porcine isolates. STs identified among ovine isolates have been detected exclusively in small ruminants, suggesting an adaptation to these hosts, while the genotypes identified among pig isolates have been previously identified in multiple hosts and therefore they are not restricted to pigs. The differences in genotypes and VAG profiles between ovine and pig isolates suggest they could represent different subpopulations of P. multocida. Copyright © 2017 Elsevier B.V. All rights reserved.

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

Utilización de lectinas en la inhibición de la adhesión de Pasteurella multocida

Directory of Open Access Journals (Sweden)

Magda Patricia Carrillo Lamus

2013-06-01

Full Text Available El primer paso de la infección es la adhesión de los organismos patógenos a las células blanco. Esta característica les permite no solo penetrar y desplegar las estrategias ofensivas para iniciar la colonización, sino contribuir a la protección y el resguardo de estos a los mecanismos de defensa tanto inmunológicos como mecánicos del hospedero. Este proceso se lleva a cabo en gran medida por la interacción de lectinas, que son proteínas de origen no inmune con la capacidad de reconocer y aglutinar carbohidratos. Este mecanismo ha sido reportado para muchos microorganismos como virus y bacterias. En el caso particular de la Pasteurella multocida, que es una bacteria gramnegativa, patógena oportunista, que inicia la infección en el epitelio respiratorio de muchos animales, se han descrito sobre su superficie sustancias lectinas como la fimbria tipo IV y carbohidratos como el lipopolisacárido o la cápsula que reconocen carbohidratos y lectinas, respectivamente, sobre la superficie de las células epiteliales del tubo respiratorio, circunstancia que le permite adherirse y resguardarse del efecto mucociliar. Debido a que para la gran mayoría de estos microorganismos —incluida P. multocida— es evidente la disminución de la susceptibilidad a los antibacterianos y a la efectividad de las vacunas, se han buscado nuevas tácticas terapéuticas y profilácticas con el fin de interrumpir la infección de los patógenos por medio del bloqueo por competencia de la unión carbohidratos-lectina, donde se ve disminuida la unión del microorganismo al tejido y, por consiguiente, la infección.

Specific detection of Pasteurella multocida in chickens with fowl cholera and in pig lung tissues using fluorescent rRNA in situ hybridization

DEFF Research Database (Denmark)

Mbuthia, P.G.; Christensen, H.; Boye, Mette

2001-01-01

in formalin-fixed paraffin-embedded lung tissues from experimental fowl cholera in chickens and infections in pigs. In chicken lung tissues P. multocida cells were detected singly, in pairs, as microcolonies, and as massive colonies within air capillaries (septa and lumen), parabronchial septa, and blood...... and fast method for specific detection of P. multocida in histological formalin-fixed tissues. The test was replicable and reproducible and is recommended as a supplementary test for diagnosis and as a tool in pathogenesis studies of fowl cholera and respiratory tract infections in pigs due to P. multocida....

Mannan-binding lectin (MBL) in two chicken breeds and the correlation with experimental Pasteurella multocida infection

DEFF Research Database (Denmark)

Schou, Torben Wilde; Permin, Anders; Christensen, Jens Peter

2010-01-01

of the chickens, suggesting that MBL plays an important role against P. multocida. A statistically significant negative correlation was found between the specific antibody response and the genetic serum MBL concentration for both breeds. This indicates that MBL in chickens is capable of acting as the first line...

21 CFR 520.2218 - Sulfamerazine, sulfamethazine, and sulfaquinoxaline powder.

Science.gov (United States)

2010-04-01

...) As an aid in the control of acute fowl cholera caused by Pasteurella multocida susceptible to... days. If disease recurs, repeat treatment. (ii) Limitations. Make fresh solution daily. Do not treat... acute fowl cholera caused by Pasteurella multocida susceptible to sulfamerazine, sulfamethazine, and...

Molecular diagnosis of Haemorrhagic Septicaemia - A Review

Directory of Open Access Journals (Sweden)

Ranjan Rajeev

2011-08-01

Full Text Available Pasteurella multocida is associated with hemorrhagic septicaemia in cattle and buffaloes, pneumonic pasteurellosis in sheep and goats, fowl cholera in poultry, atrophic rhinitis in pigs and snuffles in rabbits. Haemorrhagic septicaemia is caused by Pasteurella multocida type B:2, B:2,5 and B:5 in Asian countries and type E:2 in African countries. Pasteurella multocida have five types of capsular serotype i.e. type A, B, D, E and F. Diagnosis of the disease is mainly based on the clinical sign and symptom, post mortem findings. Confirmatory diagnosis is done by isolation and identification of causative agent. A variety of laboratory diagnostic techniques have been developed over the years for pasteurellosis and used routinely in the laboratory. Among these techniques molecular techniques of diagnosis is most important. This technique not only gives diagnosis but it also provides information regarding capsular type of Pasteurella multocida. Techniques which are used for molecular diagnosis of haemorrhagic septicaemia are PCR based diagnosis, Restriction endonuclease analysis (REA, Ribotyping, Colony hybridization assay, Filled alternation gel electrophoresis (FAGE, Detection of Pasteurella multocida by Real Time PCR. Among these techniques real time PCR is most sensitive and specific. [Vet. World 2011; 4(4.000: 189-192

Pasteurella multocida from outbreaks of avian cholera in wild and captive birds in Denmark

DEFF Research Database (Denmark)

Pedersen, Karl; Dietz, Hans-Henrik; Jørgensen, J.C.

2003-01-01

An outbreak of avian cholera was observed among wild birds in a few localities in Denmark in 2001. The highest mortalities were among breeding ciders (Somateria mollissima) and gulls (Larus spp.). Pulsed-field gel electrophoresis (PFGE) was conducted using ApaI and SmaI as restriction enzymes...... the outbreak strain. Among 68 isolates from wild birds, only one PFGE and one REA pattern were demonstrated, whereas among 23 isolates from domestic poultry, 14 different SmaI, 12 different ApaI, and 10 different HpaII patterns were found. The results suggest that a P. multocida strain has survived during...

Virulence Genotyping of Pasteurella multocida Isolated from Multiple Hosts from India

Directory of Open Access Journals (Sweden)

Laxmi Narayan Sarangi

2014-01-01

Full Text Available In this study, 108 P. multocida isolates recovered from various host animals such as cattle, buffalo, swine, poultry (chicken, duck, and emu and rabbits were screened for carriage of 8 virulence associated genes. The results revealed some unique information on the prevalence of virulence associated genes among Indian isolates. With the exception of toxA gene, all other virulence associated genes were found to be regularly distributed among host species. Association study between capsule type and virulence genes suggested that pfhA, nanB, and nanH genes were regularly distributed among all serotypes with the exception of CapD, whereas toxA gene was found to be positively associated with CapD and CapA. The frequency of hgbA and nanH genes among swine isolates of Indian origin was found to be less in comparison to its equivalents around the globe. Interestingly, very high prevalence of tbpA gene was observed among poultry, swine, and rabbit isolates. Likewise, very high prevalence of pfhA gene (95.3% was observed among Indian isolates, irrespective of host species origin.

Virulence genotyping of Pasteurella multocida isolated from multiple hosts from India.

Science.gov (United States)

Sarangi, Laxmi Narayan; Priyadarshini, Adyasha; Kumar, Santosh; Thomas, Prasad; Gupta, Santosh Kumar; Nagaleekar, Viswas Konasagara; Singh, Vijendra Pal

2014-01-01

In this study, 108 P. multocida isolates recovered from various host animals such as cattle, buffalo, swine, poultry (chicken, duck, and emu) and rabbits were screened for carriage of 8 virulence associated genes. The results revealed some unique information on the prevalence of virulence associated genes among Indian isolates. With the exception of toxA gene, all other virulence associated genes were found to be regularly distributed among host species. Association study between capsule type and virulence genes suggested that pfhA, nanB, and nanH genes were regularly distributed among all serotypes with the exception of CapD, whereas toxA gene was found to be positively associated with CapD and CapA. The frequency of hgbA and nanH genes among swine isolates of Indian origin was found to be less in comparison to its equivalents around the globe. Interestingly, very high prevalence of tbpA gene was observed among poultry, swine, and rabbit isolates. Likewise, very high prevalence of pfhA gene (95.3%) was observed among Indian isolates, irrespective of host species origin.

Efforts Towards The Development Of Recombinant Vaccines Against

African Journals Online (AJOL)

ABSTRACT. Hemorrhagic septicemia is caused by gram-negative bacterium of Pasteurella multocida (P. multocida) strains. Most of the current vaccines against P. multocida have shortcomings. Presently, there is increasing efforts towards construction of recombinant clone for vaccine development against P. multocida.

The origin of Pasteurella multocida impacts pathology and inflammation when assessed in a mouse model

DEFF Research Database (Denmark)

Pors, Susanne E.; Chadfield, Mark S.; Sorensen, Dorte B.

2016-01-01

dose dependent and consisted of exudative bronchopneumonia, abscess formation in liver and a lower bacterial load in lung and liver. Both isolates caused increased expression of MMP9 and TIMP1. In conclusion, evaluation and comparison of pathogenicity and host-pathogen interaction of P. multocida......) of an isolate from porcine pneumonia or fowl cholera showed marked differences between the two isolates. The avian isolate was highly pathogenic with severe signs of necrotizing pneumonia, liver necrosis and high bacterial load in lung and liver. Clinical signs and pathology related to the porcine isolate were...

Efforts towards the development of recombinant Vaccines against ...

African Journals Online (AJOL)

Hemorrhagic septicemia is caused by gram-negative bacterium of Pasteurella multocida (P. multocida) strains. Most of the current vaccines against P. multocida have shortcomings. Presently, there is increasing efforts towards construction of recombinant clone for vaccine development against P. multocida. In this review an ...

The ability of lipopolysaccharide (LPS) of Pasteurella multocida B:2 to induce clinical and pathological lesions in the nervous system of buffalo calves following experimental inoculation.

Science.gov (United States)

Marza, Ali Dhiaa; Jesse Abdullah, Faez Firdaus; Ahmed, Ihsan Muneer; Teik Chung, Eric Lim; Ibrahim, Hayder Hamzah; Zamri-Saad, Mohd; Omar, Abdul Rahman; Abu Bakar, Md Zuki; Saharee, Abdul Aziz; Haron, Abdul Wahid; Alwan, Mohammed Jwaid; Mohd Lila, Mohd Azmi

2017-03-01

Lipopolysaccharide (LPS) of P. multocida B:2, a causative agent of haemorrhagic septicaemia (HS) in cattle and buffaloes, is considered as the main virulence factor and contribute in the pathogenesis of the disease. Recent studies provided evidences about the involvement of the nervous system in pathogenesis of HS. However, the role of P. multocida B:2 immunogens, especially the LPS is still uncovered. Therefore, this study was designed to investigate the role of P. multocida B:2 LPS to induce pathological changes in the nervous system. Nine eight-month-old, clinically healthy buffalo calves were used and distributed into three groups. Calves of Group 1 and 2 were inoculated orally and intravenously with 10 ml of LPS broth extract represent 1 × 10 12  cfu/ml of P. multocida B:2, respectively, while calves of Group 3 were inoculated orally with 10 ml of phosphate buffer saline as a control. Significant differences were found in the mean scores for clinical signs, post mortem and histopathological changes especially in Group 2, which mainly affect different anatomic regions of the nervous system, mainly the brain. On the other hand, lower scores have been recorded for clinical signs, gross and histopathological changes in Group 1. These results provide for the first time strong evidence about the ability of P. multocida B:2 LPS to cross the blood brain barrier and induce pathological changes in the nervous system of the affected buffalo calves. Copyright © 2017 Elsevier Ltd. All rights reserved.

In vitro activity of flumequine in comparison with several other antimicrobial agents against five pathogens isolated in calves in The Netherlands.

Science.gov (United States)

Mevius, D J; Breukink, H J; van Miert, A S

1990-10-01

The in vitro activity of flumequine in comparison with several other drugs was tested against 17 P. multocida, 16 P. haemolytica, 21 S. dublin, 21 S. typhimurium and 21 E. coli strains, isolated in (veal) calves in the Netherlands. The MIC50 of flumequine for the respective pasteurellas was 0.25 and 1 microgram/ml, for the salmonellas and E. coli 0.5 micrograms/ml. In comparison with flumequine, enrofloxacin and ciprofloxacin showed higher in vitro activity, with MIC50 less than or equal to 0.008 micrograms/ml for ciprofloxacin. Decreased susceptibility of the pasteurellas was found for kanamycin, neomycin, streptomycin, gentamicin, oxytetracycline and doxycycline. The MIC50 of minocycline for P. multocida was 0.5 micrograms/ml and there was no cross resistance with the other tetracyclines. P. multocida was very susceptible to ampicillin (MIC50 less than or equal to 0.03 micrograms/ml), P. haemolytica, however, was 100% resistant to this drug. Both pasteurellas were susceptible to cephalothin and approximately 50% of the strains of both bacteria were resistant to chloramphenicol. The MIC50 of either spiramycin or tylosin was greater than or equal to their respective breakpoint-MIC values. Both pasteurellas were susceptible to the combination of trimethoprim and sulphamethoxazole. However, for P. multocida, the addition of sulphamethoxazole to trimethoprim had no synergistic effect on its MIC. In comparison with trimethorpim, aditoprim was less potent. Therefore only P. multocida was susceptible to aditoprim.

Aspectos patológicos e microbiológicos das doenças respiratórias em suínos de terminação no Brasil

Directory of Open Access Journals (Sweden)

Marcos A.Z. Morés

2015-08-01

Full Text Available Resumo: Para avaliação dos aspectos patológicos e microbiológicos de casos clínicos de doenças respiratórias em suínos de terminação foram analisados 75 suínos doentes oriundos de 36 lotes. Suínos que apresentavam sinais clínicos respiratórios evidentes foram necropsiados para avaliação macroscópica e colheita de amostras para análise histopatológica e microbiológica. Foram realizados testes de isolamento bacteriano para as principais bactérias do sistema respiratório dos suínos, PCR para Mycoplasma hyorhinis, imuno-histoquímica para Influenza A, Circovirus suíno tipo 2 e Mycoplasma hyopneumoniae. A sensibilidade antimicrobiana de 24 amostras de Pasteurella multocida tipo A foi avaliada por testes de concentração inibitória mínima para os principais antimicrobianos utilizados em suinocultura. Mycoplasma hyopneumoniae e Pasteurella multocida tipo A foram os agentes infecciosos mais prevalentes. Broncopneumonia supurativa e pleurite foram as principais lesões respiratórias encontradas. Pasteurella multocida tipo A, quando presente, aumentou a extensão das lesões pulmonares. Todas as amostras de Pasteurella multocida testadas foram sensíveis aos antimicrobianos Doxiciclina, Enrofloxacina e Tilmicosina. Em 58% das amostras foi identificado mais de um agente infeccioso, evidenciando a alta prevalência da associação de agentes nas doenças respiratórias de suínos em terminação.

One-Step Multiplex RT-qPCR Assay for the detection of Peste des petits ruminants virus, Capripoxvirus, Pasteurella multocida and Mycoplasma capricolum subspecies (ssp.) capripneumoniae

International Nuclear Information System (INIS)

Settypalli, T.B.K.; Lamien, C.; Spergser, J.; Lelenta, M.; Wade, A.; Gelaye, E.; Loitsch, A.; Minoungou, G.; Thiaucourt, F.; Diallo, A.

2016-01-01

Full text: Respiratory infections, although showing common clinical symptoms like pneumonia, are caused by bacterial, viral or parasitic agents. These are often reported in sheep and goats populations and cause huge economic losses to the animal owners in developing countries. Detection of these diseases is routinely done using ELISA or microbiological methods which are being reinforced or replaced by molecular based detection methods including multiplex assays, where detection of different pathogens is carried out in a single reaction. In the present study, a one-step multiplex RT-qPCR assay was developed for simultaneous detection of Capripoxvirus (CaPV), Peste de petits ruminants virus (PPRV), Pasteurella multocida (PM) and Mycoplasma capricolum ssp. capripneumonia (Mccp) in pathological samples collected from small ruminants with respiratory disease symptoms. The test performed efficiently without any cross-amplification. The multiplex PCR efficiency was 98.31%, 95.48%, 102.77% and 91.46% whereas the singleplex efficiency was 93.43%, 98.82%, 102.55% and 92.0% for CaPV, PPRV, PM and Mccp, respectively. The correlation coefficient was greater than 0.99 for all the targets in both multiplex and singleplex. Based on cycle threshold values, intra and inter assay variability, ranged between the limits of 2%–4%, except for lower concentrations of Mccp. The detection limits at 95% confidence interval (CI) were 12, 163, 13 and 23 copies/reaction for CaPV, PPRV, PM and Mccp, respectively. The multiplex assay was able to detect CaPVs from all genotypes, PPRV from the four lineages, PM and Mccp without amplifying the other subspecies of mycoplasmas. The discriminating power of the assay was proven by accurate detection of the targeted pathogen (s) by screening 58 viral and bacterial isolates representing all four targeted pathogens. Furthermore, by screening 81 pathological samples collected from small ruminants showing respiratory disease symptoms, CaPV was detected in

One-Step Multiplex RT-qPCR Assay for the Detection of Peste des petits ruminants virus, Capripoxvirus, Pasteurella multocida and Mycoplasma capricolum subspecies (ssp. capripneumoniae.

Directory of Open Access Journals (Sweden)

Tirumala Bharani Kumar Settypalli

Full Text Available Respiratory infections, although showing common clinical symptoms like pneumonia, are caused by bacterial, viral or parasitic agents. These are often reported in sheep and goats populations and cause huge economic losses to the animal owners in developing countries. Detection of these diseases is routinely done using ELISA or microbiological methods which are being reinforced or replaced by molecular based detection methods including multiplex assays, where detection of different pathogens is carried out in a single reaction. In the present study, a one-step multiplex RT-qPCR assay was developed for simultaneous detection of Capripoxvirus (CaPV, Peste de petits ruminants virus (PPRV, Pasteurella multocida (PM and Mycoplasma capricolum ssp. capripneumonia (Mccp in pathological samples collected from small ruminants with respiratory disease symptoms. The test performed efficiently without any cross-amplification. The multiplex PCR efficiency was 98.31%, 95.48%, 102.77% and 91.46% whereas the singleplex efficiency was 93.43%, 98.82%, 102.55% and 92.0% for CaPV, PPRV, PM and Mccp, respectively. The correlation coefficient was greater than 0.99 for all the targets in both multiplex and singleplex. Based on cycle threshold values, intra and inter assay variability, ranged between the limits of 2%-4%, except for lower concentrations of Mccp. The detection limits at 95% confidence interval (CI were 12, 163, 13 and 23 copies/reaction for CaPV, PPRV, PM and Mccp, respectively. The multiplex assay was able to detect CaPVs from all genotypes, PPRV from the four lineages, PM and Mccp without amplifying the other subspecies of mycoplasmas. The discriminating power of the assay was proven by accurate detection of the targeted pathogen (s by screening 58 viral and bacterial isolates representing all four targeted pathogens. Furthermore, by screening 81 pathological samples collected from small ruminants showing respiratory disease symptoms, CaPV was detected in

Effect of radiation on bacterial cells pathogenesis

International Nuclear Information System (INIS)

Szulc, M.; Tropilo, J.; Zajaczkowska, E.

1983-01-01

In order to determine the effect of X rays on the pathogeny of Erysipelothrix rhusiopathiae and Pasteurella multocida 334 mice were infected subcutaneously with the germs exposed to 10 Gy and D 10 . It was found that a single exposition of E. rhusiopathiae and P. multocida to 10 Gy and D 10 did not change pathogenic properties of these cells. P. multocida showed higher sensitivity to X rays: D 10 for that species was 94 Gy and for E. rhusiopathiae - 156 Gy. (author)

Bacteremia and Peritonitis in a Patient With Cirrhosis: A Life-Threatening Case From a Prick of a Cactus

Directory of Open Access Journals (Sweden)

Jodi-Anne Wallace MD

2017-08-01

Full Text Available A 58-year-old male with nonalcoholic steatohepatitis cirrhosis presents with right lower extremity cellulitis, abdominal tenderness, and severe sepsis after sustaining puncture injury from a cactus on a property with feral cats. Blood cultures and diagnostic paracentesis were consistent with spontaneous bacterial peritonitis due to Pasteurella multocida , a gram-negative coccobacillus found in the respiratory tract of domestic animals. The patient received timely antibiotic coverage with resolution of spontaneous bacterial peritonitis and sepsis after 14-day treatment. This case emphasizes the life-threatening nature of systemic Pasteurella multocida infection as well as an indirect way of acquiring a zoonotic infection in a patient with end-stage liver disease.

Demonstration of Ornithobacterium rhinotracheale in pheasants (Phasianus colchicus) with pneumonia and airsacculitis

DEFF Research Database (Denmark)

Welchman, D. de B.; Ainsworth, H. L.; Jensen, Tim Kåre

2013-01-01

type 2, avian coronavirus, Mycoplasma gallisepticum, Mycoplasma synoviae and other Mycoplasma species, Escherichia coli, Pasteurella multocida, other Pasteurellaceae and Syngamus trachea, suggesting synergism with other agents. Exposure to other intercurrent factors, including adverse weather...

Indução de empiema em ratos através da inoculação pleural de bactérias Experimental empyema in rats through intrapleural injection of bacteria

Directory of Open Access Journals (Sweden)

José Carlos Fraga

2001-12-01

Full Text Available OBJETIVOS: avaliar a indução experimental de empiema em ratos, através da inoculação intrapleural de duas bactérias (Pasteurella multocida e Staphylococcus aureus, utilizando técnica cirúrgica simples e de fácil execução. MÉTODOS: foram utilizados 24 ratos albinos da raça Wistar, de ambos os sexos, pesando entre 250 e 300g, que, após a anestesia geral, foram submetidos à toracotomia anterior direita, afastamento da musculatura e inoculação de 0,2ml de solução, conforme descrição a seguir: grupo I (n=12, inoculação de Pasteurella multocida, 10(10 unidades formadoras de colônia/ml cultivados em caldo cérebro-coração; grupo II (n=8, inoculação de Staphylococcus aureus, 10(10 unidades formadoras de colônia/ml cultivados em caldo cérebro-coração; e grupo III (n=4, inoculação de caldo cérebro-coração estéril (controle. Os animais foram sacrificados em até 7 dias e a intensidade da reação pleural, analisada macroscopicamente conforme escala padronizada. Também foram avaliados a mortalidade, o volume de líquido na cavidade pleural e o exame bacteriológico (animais mortos e líquido pleural. RESULTADOS: no grupo I (Pasteurella multocida, sete ratos morreram nas primeiras 48 horas de experimento. Cinco ratos foram sacrificados no período programado, mas nenhum deles apresentava empiema. No grupo II (Staphylococcus aureus, somente um animal morreu nas primeiras 24 horas, os outros 7 (88% foram sacrificados e apresentavam empiema. No grupo III, considerados controles, todos os animais sobreviveram, não se observando nenhuma anormalidade torácica ao sacrifício. Analisando conjuntamente os grupos, a indução de empiema esteve associada de maneira significativa à inoculação de Staphylococcus aureus no espaço pleural (p OBJECTIVE: to evaluate empyema formation in rats through the injection of two bacteria (Pasteurella multocida and Staphylococcus aureus, using a simple, easy-to-use surgical technique

Disease: H00306 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available found in the animal's oral cavity. Disseminated Pasteurella infections can lead to serious diseases including septic shock and menin...gitis mostly in infants and pregnant women. Many patients with P. multocida-related

21 CFR 558.586 - Sulfaquinoxaline.

Science.gov (United States)

2010-04-01

... use. As an aid in the control of acute fowl cholera caused by Pasteurella multocida susceptible to.... Treatment to be started after weaning. Feed continuously for 30 days or feed medicated feed for 2 days out...

Avian cholera

Science.gov (United States)

Friend, Milton

1999-01-01

Avian cholera is a contagious disease resulting from infection by the bacterium Pasteurella multocida. Several subspecies of bacteria have been proposed for P. multocida, and at least 16 different P. multocida serotypes or characteristics of antigens in bacterial cells that differentiate bacterial variants from each other have been recognized. The serotypes are further differentiated by other methods, including DNA fingerprinting. These evaluations are useful for studying the ecology of avian cholera (Fig. 7.1), because different serotypes are generally found in poultry and free-ranging migratory birds. These evaluations also show that different P. multocida serotypes are found in wild birds in the eastern United States than those that are found in the birds in the rest of the Nation (Fig. 7.2).

Inhibition of protein synthesis on the ribosome by tildipirosin compared with other veterinary macrolides

DEFF Research Database (Denmark)

Andersen, Niels Møller; Poehlsgaard, Jacob; Warrass, Ralf

2012-01-01

Tildipirosin is a 16-membered-ring macrolide developed to treat bacterial pathogens, including Mannheimia haemolytica and Pasteurella multocida, that cause respiratory tract infections in cattle and swine. Here we evaluated the efficacy of tildipirosin at inhibiting protein synthesis...

The isolation and antibiogram of aerobic nasal bacterial flora of ...

African Journals Online (AJOL)

The following microorganisms were identified from the normal flora of the grasscutters, they are; Staphylococcus epidermidis, Staphylococcus aureus, Enterococcus sp, Micrococcus sp, Bacillus cerus , E. coli, Serratia sp, Streptococcus sp, Pasteurella multocida, Streptacoccus, sp., Mannheimia heamolytica, Klebsiella sp., ...

Quantification and characterization of enzymatically produced hyaluronan with fluorophore-assisted carbohydrate electrophoresis

NARCIS (Netherlands)

Kooy, F.K.; Muyuan Ma,; Beeftink, H.H.; Eggink, G.; Tramper, J.; Boeriu, C.G.

2009-01-01

Hyaluronan (HA) is a polysaccharide with high-potential medical applications, depending on the chain length and the chain length distribution. Special interest goes to homogeneous HA oligosaccharides, which can be enzymatically produced using Pasteurella multocida hyaluronan synthase (PmHAS). We

21 CFR 558.630 - Tylosin and sulfamethazine.

Science.gov (United States)

2010-04-01

... grams sulfamethazine. (2) Indications for use-(i) Maintaining weight gains and feed efficiency in the presence of atrophic rhinitis; lowering the incidence and severity of Bordetella bronchiseptica rhinitis... (Pasteurella multocida and/or Corynebacterium pyogenes); for reducing the incidence of cervical lymphadenitis...

75 FR 1274 - Implantation or Injectable Dosage Form New Animal Drugs; Florfenicol and Flunixin

Science.gov (United States)

2010-01-11

... flunixin meglumine), a combination injectable solution, for treatment of bovine respiratory disease (BRD... treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida... female dairy cattle 20 months of age or older. Use of florfenicol in this class of cattle may cause milk...

21 CFR 522.955 - Florfenicol.

Science.gov (United States)

2010-04-01

... treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida... cause milk residues. A withdrawal period has not been established in preruminating calves. Do not use in... use. For control of respiratory disease in cattle at high risk of developing BRD associated with...

21 CFR 520.2260b - Sulfamethazine sustained-release boluses.

Science.gov (United States)

2010-04-01

... pneumonia caused or complicated by Pasteurella multocida; as an aid in the treatment of foot rot, mastitis... sulfamethazine-sensitive organisms as follows: bacterial pneumonia and bovine respiratory disease complex... mastitis and acute metritis caused by Streptococcus spp.)1 (iii) Limitations. After 72 hours, all animals...

Fulminant infection by uncommon organisms in animal bite wounds.

Science.gov (United States)

Dutta, J K

1998-10-01

In 1995 and 1996, 215 patients exposed to different species of animals were treated at the Amarnath Polyclinic, Balasore, in India. Among them were two children infected by uncommon organisms, i.e., Capnocytophaga canimorsus and Pasteurella multocida; the patients recovered with appropriate antibiotic therapy.

Fulminant infection by uncommon organisms in animal bite wounds.

OpenAIRE

Dutta, J. K.

1998-01-01

In 1995 and 1996, 215 patients exposed to different species of animals were treated at the Amarnath Polyclinic, Balasore, in India. Among them were two children infected by uncommon organisms, i.e., Capnocytophaga canimorsus and Pasteurella multocida; the patients recovered with appropriate antibiotic therapy.

Management of common animal bites in the emergency centre

African Journals Online (AJOL)

Professor Engelbrecht's current fields of interest are bites, stings and poisonous plants. Correspondence to: ... Cross War Memorial Children's Hospital in. Cape Town ... infections. Wound infection with Pasteurella multocida usually occurs early (within 12 ..... Dog bite prevention: an assessment of child knowledge. J Pediatr ...

(PCR) for the identification of Mycoplasma capricolum subsp.

African Journals Online (AJOL)

ajl yemi

2011-10-07

Oct 7, 2011 ... lactalbumin hydrolysate, 1% MEM, 20% decomplemented horse serum, 5% fresh yeast extract, 1% thallium acetate and 0.4% sodium pyruvate) in a high security laboratory. The DNA of. Pasteurella multocida and Mannheimia haemolytica was maintained in the State Key Laboratory of Veterinary Etiological ...

Forekomst af resistente bakterier og forbrug af antibiotika til hunde

DEFF Research Database (Denmark)

Pedersen, Karl; Pedersen, Kristina; Jensen, Helene

2007-01-01

), Pasteurella multocida (n=25), Bordetella bronchiseptica (n=14), Proteus spp. (n=29), og E. coli (n=449). I undersøgelsen anvendtes data fra VetStat databasen. Størstedelen af de antibiotika, der bruges til hunde er bredspektrede. Penicilliner med udvidet spektrum, cephalosporiner samt sulphonamider...

In vitro screening of methanol plant extracts for their antibacterial activity

International Nuclear Information System (INIS)

Hussain, T.; Arshad, M.; Khan, S.; Sattar, H.

2011-01-01

The purpose of this study was to observe the antibacterial activity of aqueous methanolic extracts of 10 plants against 2-gram negative bacteria (Pasteurella multocida, Escherichia coli) and 3-gram positive bacteria (Bacillus cereus, Staphylococcus aureus, Corynebacterium bovis) by using disc diffusion method. The minimum inhibitory concentration (MIC) was determined by agar well diffusion method and agar dilution method. All the bacteria were susceptible to different plant extracts. Lawsonia inermis, Embellia ribes and Santalum album showed antibacterial activity against all the tested bacteria. The extract of Santalum album showed maximum antibacterial activity of the 10 plant extracts used. Bacillus cereus and Pasteurella multocida were the most sensitive bacteria against most of the plant extracts. It is clear from the results of the present studies that the plant extracts have great potential as antimicrobial compounds against bacteria. However, there is a need of further research to isolate the active ingredients for further pharmacological evaluation. (author)

21 CFR 522.2471 - Tilmicosin.

Science.gov (United States)

2010-04-01

...) Indications for use. For the treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida, and Histophilus somni. For the control of respiratory disease in cattle at... dairy cattle 20 months of age or older. Use of this antibiotic in this class of cattle may cause milk...

Gamma-Irradiated Mannheimia (Pasteurella) Haemolytica Identified by rRNA Gene Sequencing as a Potential Vaccine in Mice

International Nuclear Information System (INIS)

Araby, E.

2014-01-01

Pneumonic pasteurellosis is a significant disease in beef production medicine. The most information suggests that this disease is a $700 million dollar per year economic burden in bovine food animal production. The current study was designed to assess the immune efficacy of whole cell killed of M. haemolytica strain from satisfactory cases (infected lung from sheep). The efficacy of gamma- irradiated M. haemolytica vaccine (GIV) was evaluated in mice in comparison to the classical aqueous formalized (AFV) one. The bacteria under study were cultivation on blood agar, purification and genetically identified. Then the bacterial cells were exposed to different doses of gamma radiation (2- 20 kGy) with 2 kGy intervals and the dose response curve of the survivors was plotted and 20 kGy was selected as the dose for the preparation of the vaccine. A total of 30 male mice (two weeks – old) were used for the further experimental investigations. Animals were divided into three equal groups each of 10 animals. The first group (group A) was given GIV . The second group (group B) received AFV. The third group (group C) was injected with sterile saline solution and represents the control. Animals were vaccinated via intraperitoneal (i.p) injection with 1x10 8 CFU per treated mouse. After vaccination, the immuno response was determined by cellular surface antigens-reactive antibodies using a modified protein- electrophoresis procedure. Antibody-antigen hybrids was visualized at molecular weight more than 225 KDa in samples represented M. haemolytica antibodies group (A, B) against both bacterial samples (M. haemolytica and Pasteurella multocida ) , while non-treated bacterial cells in which cells incubated with serum of mice group (C) revealed no hybridization reaction, this results verify that, there is shared cellular surface antigens among the two Pasteurella species. Also, the bacterial distribution with (LD 50 ) 2x10 7 CFU of a live M. heamolytica into vaccinated and non

Pasteurella aerogenes as an Asymptomatic Bacteriuria Agent.

Science.gov (United States)

Alaygut, Demet; Engin, Aynur

2018-02-01

'Asymptomatic bacteriuria' (ASB) is isolation of a specified quantitative count of bacteria in an appropriately collected urine specimen obtained from a person without symptoms or signs referable to urinary infection. Catheterized specimens are less likely to be contaminated compared with voided specimens; therefore, positive cultures of catheterized specimens are more likely to reflect true bladder bacteriuria even with low colony counts. The common pathogens for ASB are Escherichia coli, Klebsiella and Streptococcus spp. Pasteurella spp. was not previously reported as an ASB agent. ASB is important for pregnant women, children, individuals with obstructive uropathy, chronic renal failure and neutropenia, before the urologic procedures and after renal transplantation. Treatment of ASB is required for above situations. We report an 11-year-old-girl with neurogenic bladder who made clean intermittent catheterization and had Pasteurella aerogenes as an ASB agent. © The Author [2017]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Application of Enrofloxacin and Orbifloxacin Disks Approved in Japan for Susceptibility Testing of Representative Veterinary Respiratory Pathogens

Science.gov (United States)

HARADA, Kazuki; USUI, Masaru; ASAI, Tetsuo

2014-01-01

ABSTRACT In this study, susceptibilities of Pasteurella multocida, Mannheimia haemolytica and Actinobacillus pleuropneumoniae to enrofloxacin and orbifloxacin were tested using an agar diffusion method with the commercial disks and a broth microdilution method. Good correlation between the 2 methods for enrofloxacin and orbifloxacin was observed for P. multocida (r = −0.743 and −0.818, respectively), M. haemolytica (r = −0.739 and −0.800, respectively) and A. pleuropneumoniae (r = −0.785 and −0.809, respectively). Based on the Clinical and Laboratory Standards Institute interpretive criteria for enrofloxacin, high-level categorical agreement between the 2 methods was found for P. multocida (97.9%), M. haemolytica (93.8%) and A. pleuropneumoniae (92.0%). Our findings indicate that the tested commercial disks can be applied for susceptibility testing of veterinary respiratory pathogens. PMID:25008965

Phenotypic variability among strains of Pasteurella multocida ...

African Journals Online (AJOL)

STORAGESEVER

2008-05-02

May 2, 2008 ... Available online at http://www.academicjournals.org/AJB. ISSN 1684–5315 ... extended phenotypic characterization methods supported by DNA ... septicaemia African (Obudu) strain (E:2) which are currently employed as ...

9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

Avian cholera causes marine bird mortality in the Bering Sea of Alaska

Science.gov (United States)

Bodenstein, Barbara L.; Kimberlee Beckmen,; Gay Sheffield,; Kathy Kuletz,; Van Hemert, Caroline R.; Berlowski-Zier, Brenda M.; Shearn-Bochsler, Valerie I.

2015-01-01

The first known avian cholera outbreak among wild birds in Alaska occurred during November 2013. Liver, intestinal, and splenic necrosis consistent with avian cholera was noted, and Pasteurella multocida serotype 1 was isolated from liver and lung or spleen in Crested Auklets (Aethia cristatella), Thick-billed Murres (Uria lomvia), Common Eider (Somateria mollissima), Northern Fulmars (Fulmarus glacialis), and Glaucous-winged Gulls (Larus glaucescens).

Septicemic pasteurellosis in free-ranging neonatal pronghorn in Oregon

Science.gov (United States)

Dunbar, Michael R.; Wolcott, Mark J.; Rimler, R.B.; Berlowski, Brenda M.

2000-01-01

As part of a study to determine the cause(s) of population decline and low survival of pronghorn (Antilocapra americana) neonates on Hart Mountain National Antelope Refuge (HMNAR), Oregon (USA), 55 of 104 neonates captured during May 1996 and 1997 were necropsied (n = 28, 1996; n = 27, 1997) to determine cause of death. Necropsies were conducted on fawns that died during May, June, or July of each year. The objectives of this study were to report the occurrence and pathology of pasteurellosis in neonates and determine if the isolated strain of Pasteurella multocida was unique. Septicemic pasteurellosis, caused by P. multocida, was diagnosed as the cause of death for two neonates in May and June 1997. Necropsy findings included widely scattered petechial and ecchymotic hemorrhages found over a large portion of the subcutaneous tissue, meninges of the brain, epicardium, skeletal muscle, and serosal surface of the thorasic and abdominal cavities. Histological examination of lung tissues revealed diffuse congestion and edema and moderate to marked multifocal infiltrate of macrophages, neutrophils, and numerous bacteria within many terminal bronchioles and alveoli. Pasteurella multocida serotypes A:3,4, and B:1 were isolated from several tissues including lung, intestinal, thorasic fluid, and heart blood. Each B:1 isolate had DNA restriction endonuclease fingerprint profiles distinct from isolates previously characterized from domestic cattle, swan (Olor spp.), moose (Alces alces), and pronghorn from Montana (USA). This is the first report of pasteurellosis in pronghorn from Oregon and the B:1 isolates appear to be unique in comparison to DNA fingerprint profiles from selected domestic and wild species.

Use of radioactively labelled bacteria in animal experiments. 4

International Nuclear Information System (INIS)

Flossmann, K.D.; Mueller, G.; Heilmann, P.; Finsterbusch, L.; Hubald, J.

1981-01-01

Intratracheal administration of 3 H-, 14 C-, 59 Fe- or 125 I-labelled Pasteurella multocida germs to mice resulted in a more or less differentiated, nuclidedependent distribution of radioactivity in blood, spleen, liver, lung, kidney, and gastrointestinal tract, and was comparable to that following subcutaneous application. The elimination of the antigen from the lungs and other organs could be characterised by an e function, after having reached a certain level of distribution. Some of the antigen was persistent in the lung not less than 14 days. Extremely high activity concentration and persistence was recordable, following the use of 59 Fe complete antigen. Phagocytosis of Pasteurella multocida germs through alveolar macrophages of the lung was secured by autoradiography. Most of the antigen seemed to be discharged from the lungs through the digestive tract. Antigen distribution recorded from immunized and non-immunized mice seemed to suggest that the fate of antigen applied was affected by the kind of immunization. No difference in antigen distribution between non-immunized and subcutaneously immunized animals were provable, following intratracheal antigen application, but is was clearly provable, following intratracheal immunization. Elimination of antigen from the lungs of intratracheally immunized animals was found to occur faster than it did from non-immunized animals. (author)

Isolation of obligate and facultative anaerobic bacteria from feline subcutaneous abscesses.

Science.gov (United States)

Hoshuyama, S; Kanoe, M; Amimoto, A

1996-03-01

A total of 113 specimens collected from purulent skin lesions of household cats was examined bacteriologically. Ninety seven isolates obtained from 74 specimens (65.5%). Of these, 11 specimens (9.7%) contained obligate anaerobes only, 18 specimens (15.9%) yielded both obligate and facultative anaerobes. In the obligate anaerobes detected, genus Fusobacterium was the most frequently observed and F. nucleatum was most common species. Pasteurella multocida was the facultative anaerobe which was most frequently detected.

Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil - doi: 10.4025/actascibiolsci.v32i3.5471 Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil - doi: 10.4025/actascibiolsci.v32i3.5471

Directory of Open Access Journals (Sweden)

Adolfo Jatoba

2010-09-01

Full Text Available This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and the effects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrio alginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by experimental infection with V. alginolyticus. Decrease in the total haemocyte count and increase in the phenoloxidase activity and the serum agglutinate titre (p V. alginolyticus isolated from larvae and juvenile reared marine shrimp.This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and the effects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrio alginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by

Antibacterial Activity of the Hydro-Alcoholic Extract of Juglans regia L. Stem Bark on Human Bacterial Infection

Directory of Open Access Journals (Sweden)

Moori Bakhtiari N.* PhD,

2015-12-01

Full Text Available Aims Bovine mastitis continues to be the most costly disease to the dairy farmers. It dominates in Iran as one of the most prevalent diseases in dairy cattle among the dairy farms. Mastitis treatment with antibiotics leads to the development of antibiotic resistant strains and consumer health problem.This study was performed for the first time to analyze in vitro effects of hydro-alcoholic extract of Juglans regia L. stem bark on 6 mastitis pathogens. Materials & Methods the susceptibility of 6 strains of bacteria (Staphylococcus aureus, Escherichia coli, Klebsiella pneumoniae, Streptococcus spp., Pasteurella multocida and Mannheimia haemolytica were analyzed against hydro-alcoholic extract of Juglans regia L. stem bark with minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC methods. Findings Hydro-alcoholic extract did not have antibacterial effects on E. coli and K. pneumoniae. Minimum inhibitory concentration for S. aureus, P. multocida, M. haemolytica and Streptococcus spp. was 62.5mg/ml of hydro-alcoholic extract. There was not any significant response with concentrations below 100mg/disc on S. aureus, Streptococcus species, P. multocida and M. haemolytica. Minimum bactericidal concentration of this extract was 100mg/ml in all isolates. Conclusion Juglans regia L. have some antibacterial effects on S. aureus, P. multocida, M. haemolytica and Streptococcus species.

Birds in Human Modified Environments and Bird Damage Control: Social, Economic, and Health Implications

Science.gov (United States)

1989-12-01

Paratyphoid (Salmonella typhimurium) x x x + + .+ + + . + + + + Pasteurellasis (Fowl cholera ) (Pasteurella multocida) x x...enteritis (Clostridlum colinum) x 0 0 Vibriosis ( Vibrio fetu) x 30 Table 4 (ContWd Carriers r. .14 0 C c to to z ca -W V 0 4 w .,.4 ". Ca 0 3d ca DI .C...endemic vector of EEE in North America (Reeves et al. 1958, Howard and Wallis 1974). This species breeds in freshwater swamps from the Gulf of Mexico

A longitudinal study of serological patterns of respiratory infections in nine infected Danish swine herds

DEFF Research Database (Denmark)

Andreasen, Margit; Nielsen, Jens; Bækbo, Poul

2000-01-01

Sixteen litters of seven pigs from each of nine Danish farrow-to-finish herds were followed to investigate the serological patterns caused by natural infection with Mycoplasma hyponeumoniae, Pasteurella multocida toxin and Actinobacillus pleuroneumoniae serotypes 2, 5-7, 12. In seven of the herds......, pigs were followed as two separate cohorts started 4 weeks apart, and in two herds only one cohort was followed. A total of 999 pigs were included in the study. The pigs were blood sampled at weaning and subsequently every fourth week until slaughter. All pigs were examined for antibodies against M....... hyopneumoniae (enzyme-linked immunosorbent assay), P. multocida toxin (enzyme-linked immunosorbent assay) and A. pleuropneumoniae serotypes 2, 5-7, 12 (complement-fixation tests). The most-common pattern (28%) of seroconversion was that of pigs first seroconverting to A. pleuropneumoniae serotype 2, followed...

Occurrence of antimicrobial resistance in bacteria from diagnostic samples from dogs

DEFF Research Database (Denmark)

Pedersen, Karl; Pedersen, Kristina; Jensen, Helene

2007-01-01

Pseudomonas aeruginosa, 25 Pasteurella multocida, 29 Proteus spp. and 449 Escherichia coli isolates from clinical submissions from dogs were determined by a broth-dilution method for determination of minimal inhibitory concentration. Data for consumption of antimicrobials were retrieved from Vet....... intermedius and Proteus isolates. Conclusions: This investigation provided data on occurrence of antimicrobial resistance in important pathogenic bacteria from dogs, which may be useful for the small animal practitioner. Resistance was low to the compounds that were most often used, but unfortunately...

Avian cholera in waterfowl: the role of lesser snow and Ross's geese as carriers of avian cholera in the Playa Lakes region

Science.gov (United States)

Samuel, M.D.; Shadduck, D.J.; Goldberg, Diana R.; Johnson, W.P.

2005-01-01

We collected samples from apparently healthy geese in the Playa Lakes Region (USA) during the winters of 2000a??01 and 2001a??02 to determine whether carriers of Pasteurella multocida, the bacterium that causes avian cholera, were present in wild populations. With the use of methods developed in laboratory challenge trials (Samuel et al., 2003a) and a serotype-specific polymerase chain reaction method for identification of P. multocida serotype 1, we found that a small proportion of 322 wild birds (cholera infection. Our results confirm the hypothesis that wild waterfowl are carriers of avian cholera and add support for the hypothesis that wild birds are a reservoir for this disease. In concert with other research, this work indicates that enzootic infection with avian cholera occurs in lesser snow goose (Chen caerulescens caerulescens) populations throughout their annual cycle. Although fewer Rossa??s geese (Chen rossii) were sampled, we also found these birds were carriers of P. multocida. Even in the absence of disease outbreaks, serologic evidence indicates that chronic disease transmission and recent infection are apparently occurring year-round in these highly gregarious birds and that a small portion of these populations are potential carriers with active infection.

An Investigation of the Pathology and Pathogens Associated with Porcine Respiratory Disease Complex in Denmark

DEFF Research Database (Denmark)

Hansen, Mette Sif; Pors, S. E.; Jensen, H. E.

2010-01-01

), porcine reproductive and respiratory syndrome virus (both European and US type), porcine circovirus type 2 (PCV2), porcine respiratory coronavirus, porcine cytomegalovirus, Mycoplasma hyopneumoniae and Mycoplasma hyorhinis. All cases had cranioventral lobular bronchopneumonia consistent with PRDC....... There was a broad range of microscopical lesions and the cases were characterized as acute (n=10), subacute (n=24) or chronic (n=114) bronchopneumonia. Five bacterial species, five viruses and two Mycoplasma spp. were detected in different combinations. PCV2, M. hyopneumoniae, M. hyorhinis and Pasteurella multocida...

Fatal pneumonia of bighorn sheep following association with domestic sheep.

Science.gov (United States)

Foreyt, W J; Jessup, D A

1982-04-01

During 1979-1980 acute fibrinopurulent bronchopneumonia resulted in high mortality or total loss of herds of bighorn sheep (Ovis canadensis) in California and Washington. Contact with domestic sheep occurred shortly before the onset of disease in each case. Circumstantial evidence indicated that the apparently healthy domestic sheep transmitted pathogenic bacteria to the bighorns, resulting in mortality. Pasteurella multocida and Corynebacterium pyogenes were isolated from pulmonary tissue of dead bighorns. The presence of domestic sheep may have been an important stress which initiated or compounded the disease.

Biased distribution of DNA uptake sequences towards genome maintenance genes

DEFF Research Database (Denmark)

Davidsen, T.; Rodland, E.A.; Lagesen, K.

2004-01-01

Repeated sequence signatures are characteristic features of all genomic DNA. We have made a rigorous search for repeat genomic sequences in the human pathogens Neisseria meningitidis, Neisseria gonorrhoeae and Haemophilus influenzae and found that by far the most frequent 9-10mers residing within...... in these organisms. Pasteurella multocida also displayed high frequencies of a putative DUS identical to that previously identified in H. influenzae and with a skewed distribution towards genome maintenance genes, indicating that this bacterium might be transformation competent under certain conditions....

Antimicrobial susceptibility monitoring of respiratory tract pathogens isolated from diseased cattle and pigs across Europe: the VetPath study.

Science.gov (United States)

de Jong, Anno; Thomas, Valérie; Simjee, Shabbir; Moyaert, Hilde; El Garch, Farid; Maher, Kirsty; Morrissey, Ian; Butty, Pascal; Klein, Ulrich; Marion, Hervé; Rigaut, Delphine; Vallé, Michel

2014-08-06

VetPath is an ongoing pan-European antibiotic susceptibility monitoring programme collecting pathogens from diseased antimicrobial non-treated cattle, pigs and poultry. In the current study, 1001 isolates from cattle and pig respiratory tract infections were tested for their antimicrobial susceptibilities. Non-replicate lung samples or nasopharyngeal/nasal swabs were collected from animals with acute clinical signs in 11 countries during 2002-2006. Pasteurella multocida and Mannheimia haemolytica from cattle and P. multocida, Actinobacillus pleuropneumoniae and Streptococcus suis from pigs were isolated by standard methods. S. suis was also isolated from meningitis cases. MICs of 16 antibiotics were assessed centrally by broth microdilution following CLSI recommendations. Results were interpreted using CLSI breakpoints where available. P. multocida (231) and M. haemolytica (138) isolates were all susceptible to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin and trimethoprim/sulfamethoxazole. Resistance to florfenicol and spectinomycin was 0.4% and 3.5% in P. multocida, respectively, and absent in M. haemolytica isolates. Tetracycline resistance was 5.7% and 14.6% for P. multocida and M. haemolytica. In pigs, 230 P. multocida, 220 A. pleuropneumoniae and 182 S. suis isolates were recovered. Resistance to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin, florfenicol, tiamulin and tilmicosin was absent or <1%. Trimethoprim/sulfamethoxazole resistance was 3-6% and tetracycline resistance varied from 14.7% in A. pleuropneumoniae to 81.8% in S. suis. In conclusion, low resistance to antibiotics with defined clinical breakpoints, except for tetracycline, was observed among the major respiratory tract pathogens recovered from cattle and pigs. Since for approximately half of the antibiotics in this panel no CLSI-defined breakpoints were available, setting of the missing veterinary breakpoints is important. Copyright © 2014 Elsevier B.V. All rights reserved.

Microbiological and serological monitoring in hooded crow (Corvus corone cornix in the Region Lombardia, Italy

Directory of Open Access Journals (Sweden)

Guido Grilli

2010-01-01

Full Text Available The health status of 276 hooded crows (Corvus corone cornix from various provinces of Lombardy was monitored for three years. Bacteriological examination detected E. coli (76%, Campylobacter jejuni (17%, Salmonella typhimurium (11.6%, Yersinia spp. (6.5%, Clamydophila abortus and C. psittaci (2.6%; from six birds showing severe prostration Pasteurella multocida was isolated. Virological and serological tests were negative for Avian Influenza virus (AIV, West Nile virus (WNV and only three samples were positive for Newcastle disease virus (NDV but only at serology (titre 1:16.

Development of pneumonia in desert bighorn sheep after exposure to a flock of exotic wild and domestic sheep.

Science.gov (United States)

Callan, R J; Bunch, T D; Workman, G W; Mock, R E

1991-03-15

From 1986 to 1989, 5 desert bighorn sheep (3 Ovis canadensis mexicana and 2 O c nelsoni), ranging in age from 2 to 3 years, were exposed to a flock of exotic wild and domestic sheep to potentially achieve naturally acquired pneumonia. Pasteurella multocida was isolated from nasal samples from 4 of 6 sheep randomly sampled from the flock. Bighorn sheep were exposed individually and each exposure period was a trial. Treatment before and after exposure varied and included combinations of alpha interferon, antibiotics, anti-inflammatory drugs, and vaccines. Treatments were chosen on the basis of recommendations of others for treating pneumonia in desert bighorn sheep as well as our own experience in sheep and cattle. Regardless of treatment used, bighorn sheep in trials 1 to 4 developed signs of pneumonia within 10 to 14 days of exposure. Bighorn sheep in trials 1 to 3 died within 11 to 17 days of initial exposure. In trial 4, the bighorn sheep was isolated from the carrier sheep for treatment of pneumonia on day 14 and died on day 30. Pasteurella multocida was isolated from lung tissue in 3 of the 4 bighorn sheep. On the basis of results of trials 1 to 4, a more in depth clinical study was conducted in trial 5. Nasal and blood specimens were collected prior to and during trial 5 for bacteriologic culturing and serologic testing for bovine viral diarrhea virus, infectious bovine rhinotracheitis, parainfluenza-3 virus, and respiratory syncytial virus.(ABSTRACT TRUNCATED AT 250 WORDS)

[Pasteurella] caballi infection not limited to horses - a closer look at taxon 42 of Bisgaard

DEFF Research Database (Denmark)

Christensen, Henrik; Hommez, J.; Olsen, John Elmerdahl

2006-01-01

Aim To investigate if taxon 42 of Bisgaard isolated from pigs represents genuine [Pasteurella] caballi which has previously only been isolated from horses. Methods and Results A total of 15 field isolates from horses and pigs from 5 different countries representing three continents were to subjec...

Pasteurella testudinis associated with respiratory disease and septicaemia in leopard (Geochelone pardalis and other tortoises in South Africa

Directory of Open Access Journals (Sweden)

M.M. Henton

2003-07-01

Full Text Available The first recorded isolates of Pasteurella testudinis from South African tortoises kept in captivity is presented. P. testudinis was found in association with respiratory disease in affected animals.

RESPIRATORY SYNDROME: A MAJOR THREAT TO THE LIVESTOCK FARMERS AND ITS ECONOMIC IMPACT

Directory of Open Access Journals (Sweden)

A. B. ZAHUR, U. FAROOQ, M. HUSSAIN1, S. H. HASHMI2 AND R. MUNEER

2007-10-01

Full Text Available Epidemiology of a respiratory syndrome was studied at Landhi Dairy Colony (LDC, Karachi, Pakistan and its economic impact was estimated. Among 5889 buffaloes examined, 2.3% animals were suffering from this syndrome. From some of the sick animals, Pasteurella multocida, the causative agent of haemorrhagic septicaemia, was isolated. In the present study, an average loss of Rs. 0.2 million per farm was calculated and the extrapolated values for 0.2 and 0.8 million animals present in LDC and other dairy colonies in Karachi were Rs. 225.6 and Rs. 1128.1 million, respectively.

Effects of Enrofloxacin on Porcine Phagocytic Function

Science.gov (United States)

Schoevers, E. J.; van Leengoed, L. A. M. G.; Verheijden, J. H. M.; Niewold, T. A.

1999-01-01

The interaction between enrofloxacin and porcine phagocytes was studied with clinically relevant concentrations of enrofloxacin. Enrofloxacin accumulated in phagocytes, with cellular concentration/extracellular concentration ratios of 9 for polymorphonuclear leukocytes (PMNs) and 5 for alveolar macrophages (AMs). Cells with accumulated enrofloxacin brought into enrofloxacin-free medium released approximately 80% (AMs) to 90% (PMNs) of their enrofloxacin within the first 10 min, after which no further release was seen. Enrofloxacin affected neither the viability of PMNs and AMs nor the chemotaxis of PMNs at concentrations ranging from 0 to 10 μg/ml. Enrofloxacin (0.5 μg/ml) did not alter the capability of PMNs and AMs to phagocytize fluorescent microparticles or Actinobacillus pleuropneumoniae, Pasteurella multocida, and Staphylococcus aureus. Significant differences in intracellular killing were seen with enrofloxacin at 5× the MIC compared with that for controls not treated with enrofloxacin. PMNs killed all S. aureus isolates in 3 h with or without enrofloxacin. Intracellular S. aureus isolates in AMs were less susceptible than extracellular S. aureus isolates to the bactericidal effect of enrofloxacin. P. multocida was not phagocytosed by PMNs. AMs did not kill P. multocida, and similar intra- and extracellular reductions of P. multocida isolates by enrofloxacin were found. Intraphagocytic killing of A. pleuropneumoniae was significantly enhanced by enrofloxacin at 5× the MIC in both PMNs and AMs. AMs are very susceptible to the A. pleuropneumoniae cytotoxin. This suggests that in serologically naive pigs the enhancing effect of enrofloxacin on the bactericidal action of PMNs may have clinical relevance. PMID:10471554

Phenotypic and genotypic characterization of Mannheimia (Pasteurella) haemolytica-like strains isolated from diseased animals in Denmark

DEFF Research Database (Denmark)

Angen, Øystein; Ahrens, Peter; Bisgaard, M.

2002-01-01

Trehalose-negative strains of the Pasteurella haemolytica complex have recently been transferred to a new genus, Mannheimia. This genus presently consists of five named species: M. haemolytica, M. glucosida, M. granulomatis, M. ruminalis and M. varigena. The purpose of this study was to investigate...

Clonal outbreaks of [ Pasteurella] pneumotropica biovar Heyl in two mouse colonies

DEFF Research Database (Denmark)

Adhikary, Sadhana; Bisgaard, Magne; Dagnæs-Hansen, Frederik

2017-01-01

The aim of this study was to document the pathogenic role of biovar Heyl of [Pasteurella] pneumotropica in mouse colonies. Fifty-three isolates associated with mastitis and orbital, cutaneous and vaginal abscesses as well as isolates from the nose and vagina of healthy mice were investigated...... strains with the same rpoB sequence type, as shown by the PFGE profiles. The investigation documented that members of biovar Heyl of [P.] pneumotropica caused disease outbreaks in mouse colonies since the clonality indicated a primary role of [P.] pneumotropica biovar Heyl in the infections observed....

Outbreak of Pasteurella pneumotropica in a closed colony of STOCK-Cd28(tm1Mak) mice

DEFF Research Database (Denmark)

Artwohl, J.E.; Flynn, J.C.; Bunte, R.M.

2000-01-01

Fifteen mice with Pasteurella pneumotropica orbital abscesses were noted in mice that were homozygous for a targeted Cd28 gene mutation. Only one mouse heterozygous for the Cd28 mutation was affected. According to phenotypic reactions and 16S rDNA sequencing, the isolates were most similar to bio...

Standard PK/PD concepts can be applied to determine a dosage regimen for a macrolide: the case of tulathromycin in the calf.

Science.gov (United States)

Toutain, P-L; Potter, T; Pelligand, L; Lacroix, M; Illambas, J; Lees, P

2017-01-01

The pharmacokinetic (PK) profile of tulathromycin, administered to calves subcutaneously at the dosage of 2.5 mg/kg, was established in serum, inflamed (exudate), and noninflamed (transudate) fluids in a tissue cage model. The PK profile of tulathromycin was also established in pneumonic calves. For Mannheimia haemolytica and Pasteurella multocida, tulathromycin minimum inhibitory concentrations (MIC) were approximately 50 times lower in calf serum than in Mueller-Hinton broth. The breakpoint value of the PK/pharmacodynamic (PD) index (AUC (0-24 h) /MIC) to achieve a bactericidal effect was estimated from in vitro time-kill studies to be approximately 24 h for M. haemolytica and P. multocida. A population model was developed from healthy and pneumonic calves and, using Monte Carlo simulations, PK/PD cutoffs required for the development of antimicrobial susceptibility testing (AST) were determined. The population distributions of tulathromycin doses were established by Monte Carlo computation (MCC). The computation predicted a target attainment rate (TAR) for a tulathromycin dosage of 2.5 mg/kg of 66% for M. haemolytica and 87% for P. multocida. The findings indicate that free tulathromycin concentrations in serum suffice to explain the efficacy of single-dose tulathromycin in clinical use, and that a dosage regimen can be computed for tulathromycin using classical PK/PD concepts. © 2016 John Wiley & Sons Ltd.

Dicty_cDB: AFK338 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFK338 (Link to dictyBase) - - - - AFK338P (Link to Original s...ite) AFK338F 659 AFK338Z 221 AFK338P 880 - - Show AFK338 Library AF (Link to library) Clone ID AFK338 (Link to dic...01175_2502( CP001175 |pid:none) Listeria monocytogenes HCC23, c... 40 0.099 AY714838_16( AY714838 |pid:none) Unculture...A sequence. 44 3.0 1 AE006080 |AE006080.1 Pasteurella multocida PM70 section 47 o... 0.003 BX294148_242( BX294148 |pid:none) Rhodopirellula baltica SH 1 comp... 44 0.005 CP000910_1528( CP00091

Experimental contact transmission of Pasteurella haemolytica from clinically normal domestic sheep causing pneumonia in Rocky Mountain bighorn sheep.

Science.gov (United States)

Onderka, D K; Wishart, W D

1988-10-01

Two Rocky Mountain bighorn lambs (Ovis canadensis canadensis) were held in captivity for 120 days before being housed with two domestic sheep. The lambs were clinically normal and had no Pasteurella spp. on nasal swab cultures. The domestic sheep were known to carry Pasteurella haemolytica biotype A in the nasal passages. After being in close contact for 19 days. P. haemolytica biotype A was cultured from nasal swabs of one of the bighorn lambs. By 26 days, both bighorn sheep developed coughs, were anorectic and became lethargic and nasal swabs yielded P. haemolytica biotype T, serotype 10. Twenty-nine days after contact, the lambs were necropsied and found to have extensive fibrinous bronchopneumonia. From affected tissues pure cultures of beta-hemolytic P. haemolytica biotype T, serotype 10 were grown. Both domestic sheep remained clinically normal and had no gross or microscopic lesions, but they carried the same P. haemolytica serotype in their tonsils. Behavioural observations gave no indication of stress in the bighorn lambs.

Fatal pneumonia following inoculation of healthy bighorn sheep with Pasteurella haemolytica from healthy domestic sheep.

Science.gov (United States)

Foreyt, W J; Snipes, K P; Kasten, R W

1994-04-01

In a series of three experiments, isolates of Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1, from healthy domestic sheep, were inoculated intratracheally into eight bighorn sheep (Ovis canadensis canadensis) and seven domestic sheep with doses of bacteria ranging from 5.3 x 10(8) to 8.6 x 10(11) colony forming units. Seven of eight inoculated bighorn sheep died from acute pneumonia within 48 hr of inoculation, whereas all seven domestic sheep inoculated with comparable or greater doses of bacteria remained healthy. One contact control bighorn sheep also died 6 days after its penmates received P. haemolytica. Three other noncontact control bighorn sheep remained healthy during the experiments. Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1 in the inocula was recovered from one or more tissues from all bighorns that died; whereas, it was not detected in any bighorn sheep before inoculation. Three different ribotypes of P. haemolytica A2 were recovered from bighorn sheep; however, only the ribotype reference WSU-1 in the domestic sheep-origin inoculum was recovered from all dead bighorn sheep, and was not recovered from bighorn sheep that survived the experiments. Thus, a relatively nonpathogenic and common isolate of P. haemolytica from healthy domestic sheep was lethal in bighorn sheep under experimental conditions.

Comparative studies on [Pasteurella] testudinis and [P.] testudinis-like bacteria and proposal of Chelonobacter oris gen. nov., sp. nov. as a new member of the family Pasteurellaceae

DEFF Research Database (Denmark)

Gregersen, Rikke Heidemann; Neubauer, Claudia; Christensen, Henrik

2009-01-01

Abstract A collection of 12 strains isolated from diseased tortoises tentatively identified as [Pasteurella] testudinis-like based on phenotypical characters were compared with three reference strains of [Pasteurella] testudinis. All strains could be separated from the reference strains with resp...

Mycoplasma ovipneumoniae - A Primary Cause of Severe Pneumonia Epizootics in the Norwegian Muskox (Ovibos moschatus) Population

Science.gov (United States)

Handeland, Kjell; Tengs, Torstein; Kokotovic, Branko; Vikøren, Turid; Ayling, Roger D.; Bergsjø, Bjarne; Sigurðardóttir, Ólöf G.; Bretten, Tord

2014-01-01

The Norwegian muskox (Ovibos moschatus) population lives on the high mountain plateau of Dovre and originates from animals introduced from Greenland. In the late summers of 2006 and 2012, severe outbreaks of pneumonia with mortality rates of 25-30% occurred. During the 2012 epidemic high quality samples from culled sick animals were obtained for microbiological and pathological examinations. High throughput sequencing (pyrosequencing) of pneumonic lung tissue revealed high concentrations of Mycoplasma ovipneumoniae in all six animals examined by this method and Pasteurella multocida subsp. multocida in four animals, whereas no virus sequences could be identified. Mycoplasma ovipneumoniae and P. multocida multocida were also isolated by culture. Using real time PCR on lung swabs, M. ovipneumoniae was detected in all of the 19 pneumonic lungs examined. Gross pathological examination revealed heavy consolidations primarily in the cranial parts of the lungs and it also identified one case of otitis media. Histologically, lung lesions were characterized as acute to subacute mixed exudative and moderately proliferative bronchoalveolar pneumonia. Immunohistochemical (IHC) examination revealed high load of M. ovipneumoniae antigens within lung lesions, with particularly intensive staining in the neutrophils. Similar IHC finding were observed in archived lung tissue blocks from animals examined during the 2006 epidemic. An M. ovipneumoniae specific ELISA was applied on bio-banked muskox sera from stray muskoxen killed in the period 2004–2013 and sick muskoxen culled, as well as sera from wild reindeer (Rangifer tarandus tarandus) on Dovre and muskoxen from Greenland. Serology and mycoplasma culturing was also carried out on sheep that had been on pasture in the muskox area during the outbreak in 2012. Our findings indicated separate introductions of M. ovipneumoniae infection in 2006 and 2012 from infected co-grazing sheep. Salt licks shared by the two species were a

Mycoplasma ovipneumoniae--a primary cause of severe pneumonia epizootics in the Norwegian Muskox (Ovibos moschatus population.

Directory of Open Access Journals (Sweden)

Kjell Handeland

Full Text Available The Norwegian muskox (Ovibos moschatus population lives on the high mountain plateau of Dovre and originates from animals introduced from Greenland. In the late summers of 2006 and 2012, severe outbreaks of pneumonia with mortality rates of 25-30% occurred. During the 2012 epidemic high quality samples from culled sick animals were obtained for microbiological and pathological examinations. High throughput sequencing (pyrosequencing of pneumonic lung tissue revealed high concentrations of Mycoplasma ovipneumoniae in all six animals examined by this method and Pasteurella multocida subsp. multocida in four animals, whereas no virus sequences could be identified. Mycoplasma ovipneumoniae and P. multocida multocida were also isolated by culture. Using real time PCR on lung swabs, M. ovipneumoniae was detected in all of the 19 pneumonic lungs examined. Gross pathological examination revealed heavy consolidations primarily in the cranial parts of the lungs and it also identified one case of otitis media. Histologically, lung lesions were characterized as acute to subacute mixed exudative and moderately proliferative bronchoalveolar pneumonia. Immunohistochemical (IHC examination revealed high load of M. ovipneumoniae antigens within lung lesions, with particularly intensive staining in the neutrophils. Similar IHC finding were observed in archived lung tissue blocks from animals examined during the 2006 epidemic. An M. ovipneumoniae specific ELISA was applied on bio-banked muskox sera from stray muskoxen killed in the period 2004-2013 and sick muskoxen culled, as well as sera from wild reindeer (Rangifer tarandus tarandus on Dovre and muskoxen from Greenland. Serology and mycoplasma culturing was also carried out on sheep that had been on pasture in the muskox area during the outbreak in 2012. Our findings indicated separate introductions of M. ovipneumoniae infection in 2006 and 2012 from infected co-grazing sheep. Salt licks shared by the two

Virulencia de cepas de Listeria monocytogenes procedentes de cabras y sus derivados

OpenAIRE

Guicela Ramírez Bernal; Alma Virginia Lara Sagahón; Carlos Gerardo García Tovar; Efrén Díaz Aparicio; Víctor Rubén Tenorio Gutiérrez

2014-01-01

Se evaluó la virulencia de cepas de Listeria monocytogenes todas de serotipo 4b procedentes de cabras y sus derivados. Se observaron niveles de virulencia variables cuando se comparó la virulencia relativa (porcentaje de letalidad) en ratones BALB/c inoculados vía intravenosa o intragástrica y su capacidad para infectar macrófagos J774A.1, y células epiteliales Caco-2. Dos cepas obtenidas de alimento de cabras produjeron 100 % de letalidad por ambas vías de inoculación y no mostraron diferenc...

Comparison of the diagnostic performance of bacterial culture of nasopharyngeal swab and bronchoalveolar lavage fluid samples obtained from calves with bovine respiratory disease.

Science.gov (United States)

Capik, Sarah F; White, Brad J; Lubbers, Brian V; Apley, Michael D; DeDonder, Keith D; Larson, Robert L; Harhay, Greg P; Chitko-McKown, Carol G; Harhay, Dayna M; Kalbfleisch, Ted S; Schuller, Gennie; Clawson, Michael L

2017-03-01

OBJECTIVE To compare predictive values, extent of agreement, and gamithromycin susceptibility between bacterial culture results of nasopharyngeal swab (NPS) and bronchoalveolar lavage fluid (BALF) samples obtained from calves with bovine respiratory disease (BRD). ANIMALS 28 beef calves with clinical BRD. PROCEDURES Pooled bilateral NPS samples and BALF samples were obtained for bacterial culture from calves immediately before and at various times during the 5 days after gamithromycin (6 mg/kg, SC, once) administration. For each culture-positive sample, up to 12 Mannheimia haemolytica, 6 Pasteurella multocida, and 6 Histophilus somni colonies underwent gamithromycin susceptibility testing. Whole-genome sequencing was performed on all M haemolytica isolates. For paired NPS and BALF samples collected 5 days after gamithromycin administration, the positive and negative predictive values for culture results of NPS samples relative to those of BALF samples and the extent of agreement between the sampling methods were determined. RESULTS Positive and negative predictive values of NPS samples were 67% and 100% for M haemolytica, 75% and 100% for P multocida, and 100% and 96% for H somni. Extent of agreement between results for NPS and BALF samples was substantial for M haemolytica (κ, 0.71) and H somni (κ, 0.78) and almost perfect for P multocida (κ, 0.81). Gamithromycin susceptibility varied within the same sample and between paired NPS and BALF samples. CONCLUSIONS AND CLINICAL RELEVANCE Results indicated culture results of NPS and BALF samples from calves with BRD should be interpreted cautiously considering disease prevalence within the population, sample collection relative to antimicrobial administration, and limitations of diagnostic testing methods.

Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil = Infecção experimental em larvas e juvenis de Litopaenaeus vannamei cultivados no Estado de Santa Catarina, Brasil

Directory of Open Access Journals (Sweden)

Celso Carlos Buglione

2010-07-01

Full Text Available This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and theeffects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrioalginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by experimental infection with V. alginolyticus. Decrease in the total haemocyte count and increase in the phenoloxidase activity and the serum agglutinate titre (p Este estudo avaliou as características patogênicas de cepas de bactérias isoladas de Litopenaeus vannamei durante surto de mortalidade no Laboratório de Camarões Marinhos, UFSC, Estado de Santa Catarina, Brasil. Seu potencial de virulência em larvas e juvenis de camarão marinho e os efeitos sobre a contagem total de hemócito, atividade de fenoloxidase e título aglutinante do soro foramavaliados após infecção experimental. As cepas bacterianas foram isoladas de larvas e de camarões adultos e identificadas bioquimicamente pelo sistema API20E como: duas cepas de Vibrio alginolyticus, três de Aeromonas salmonicida e uma de Pasteurella sp. e P. multocida. Todas as cepas isoladas provocaram mortalidade em L. vannamei, e uma de V. alginolyticus resultou em mortalidade de 97,3 e 88,7% para larvas e juvenis de camarões, respectivamente. O sistema imunológico dos camarões juvenis sofreu influência da infecção experimental

Short communication: Interaction of the isomers carvacrol and thymol with the antibiotics doxycycline and tilmicosin: In vitro effects against pathogenic bacteria commonly found in the respiratory tract of calves.

Science.gov (United States)

Kissels, W; Wu, X; Santos, R R

2017-02-01

Bovine respiratory disease is the major problem faced by cattle, specially calves, leading to reduced animal performance and increased mortality, consequently causing important economic losses. Hence, calves must be submitted to antibiotic therapy to counteract this infection usually initiated by the combination of environmental stress factors and viral infection, altering the animal's defense mechanism, and thus allowing lung colonization by the opportunistic bacteria Mannheimia haemolytica and Pasteurella multocida. Essential oils appear to be candidates to replace antibiotics or to act as antibiotic adjuvants due to their antimicrobial properties. In the present study, we aimed to evaluate the 4 essential oil components carvacrol, thymol, trans-anethole, and 1,8 cineole as antibacterial agents or as adjuvants for the antibiotics doxycycline and tilmicosin against M. haemolytica and P. multocida. Bacteria were cultured according to standard protocols, followed by the determination of minimum inhibitory concentration (MIC) and minimum bactericidal concentration. A checkerboard assay was applied to detect possible interactions between components, between antibiotics, and between components and antibiotics. Doxycycline at 0.25 and 0.125 μg/mL inhibited the growth of P. multocida and M. haemolytica, respectively, whereas tilmicosin MIC values were 1.0 and 4.0 μg/mL for P. multocida and M. haemolytica, respectively. Carvacrol MIC values were 2.5 and 1.25 mM for P. multocida and M. haemolytica, respectively, whereas thymol MIC values were 1.25 and 0.625 mM for P. multocida and M. haemolytica, respectively. Trans-anethole and 1,8 cineole did not present any antibacterial effect even at 40 mM against the investigated pathogens. All minimum bactericidal concentration values were the same as MIC, except when thymol was tested against M. haemolytica, being twice the MIC data (i.e., 1.25 mM thymol). Based on fractional inhibitory concentration checkerboard assay, no

Investigation of genome sequences within the family Pasteurellaceae

DEFF Research Database (Denmark)

Angen, Øystein; Ussery, David

Introduction The bacterial genome sequences are now available for an increasing number of strains within the family Pasteurellaceae. At present, 24 Pasteurellaceae genomes are publicly available through internet databases, and another 40 genomes are being sequenced. This investigation will describe...... the core genome for both the family Pasteurellaceae and for the species Haemophilus influenzae. Methods Twenty genome sequences from the following species were included: Haemophilus influenzae (11 strains), Haemophilus ducreyi (1 strain), Histophilus somni (2 strains), Haemophilus parasuis (1 strain......), Actinobacillus pleuropneumoniae (2 strains), Actinobacillus succinogenes (1 strain), Mannheimia succiniciproducens (1 strain), and Pasteurella multocida (1 strain). The predicted proteins for each genome were BLASTed against each other, and a set of conserved core gene families was determined as described...

Aspects relating to use of radioactively labelled bacteria in animal experiments. 7

International Nuclear Information System (INIS)

Heilmann, P.; Flossmann, K.D.; Mueller, G.; Finsterbusch, L.

1983-01-01

Two different types of aerosol dispensers were used in an aerosol compartment to apply 59 Fe-labelled bacteria (Pasteurella multocida) to SPE Mini-LEWE piglets as well as to conventionally raised piglets and calves. Germ intake was verified by detection of radioactivity in the lungs. Antigen deposition on each lung amounted to 2-3 . 10 8 in mini-piglets, 6-8 . 10 8 in ordinary piglets, and 2 . 10 9 in conventionally raised calves, as determined by SAG-1, a Soviet model of aerosol dispenser. More or less equally high concentrations of aerosol particles were retained in the pulmonary lobes, independent of the animal species used. Antigen intake could not be influenced by addition of skim milk or by restriction of germ suspensions. (author)

Rapport for Center for Vildtsundhed 1. halvår 2012

DEFF Research Database (Denmark)

Chriél, Mariann; Enemark, Heidi L.; Therkildsen, Ole Roland

for vurderingen af parasitbelastningen hos raske ederfugle. Redemateriale til undersøgelse af Pasteurella multocida, der forårsager udbrud af fjerkrækolera, fortsættes i et specialestudie af de dyrkbare bakterier. Med henblik på kortlægning af rævens dværgbændelorm (Echinococcus multilocularis) hos mårhund og ræv...... Danmark siden 2000, og det er første gang bændelormen er påvist i jyske ræve. Echinococcus multilocularis kan smitte til mennesker, hvor de i larvestadiet angriber leveren, hvilket kan have fatale følger, så det er vigtigt, at folk er opmærksomme på risikoen og tager deres forbehold. Mennesker smittes...

Toll-like receptor 4-positive macrophages protect mice from Pasteurella pneumotropica-induced pneumonia

Science.gov (United States)

Hart, Marcia L.; Mosier, Derek A.; Chapes, Stephen K.

2003-01-01

This study investigates Toll-like receptor 4 (TLR4)-positive macrophages in early recognition and clearance of pulmonary bacteria. TLR4 is a trans-membrane receptor that is the primary recognition molecule for lipopolysaccharide of gram-negative bacteria. The TLR4(Lps-del) mouse strains C57BL10/ScN (B10) and STOCK Abb(tm1) TLR4(Lps-del) Slc11a1(s)(B10 x C2D) are susceptible to pulmonary infections and develop pneumonia when naturally or experimentally infected by the opportunistic bacterium Pasteurella pneumotropica. Since these mice have the TLR4(Lps-del) genotype, we hypothesized that reconstitution of mice with TLR4-positive macrophages would provide resistance to this bacterium. A cultured macrophage cell line (C2D macrophages) and bone marrow cells from C2D mice were adoptively transferred to B10 and B10 x C2D mice by intraperitoneal injection. C2D macrophages increased B10 and B10 x C2D mouse resistance to P. pneumotropica. In C2D-recipient mice there was earlier transcription of tumor necrosis factor alpha and chemokines JE and macrophage inflammatory protein 2 (MIP-2) in the lungs of B10 and B10 x C2D mice, and there was earlier transcription of KC and MIP-1alpha in B10 x C2D mice. In addition, the course of inflammation following experimental Pasteurella challenge was altered in C2D recipients. C2D macrophages also protected B10 x C2D mice, which lack CD4(+) T cells. These data indicate that macrophages are critical for pulmonary immunity and can provide host resistance to P. pneumotropica. This study indicates that TLR4-positive macrophages are important for early recognition and clearance of pulmonary bacterial infections.

Pathological and molecular based study of pneumonic pasteurellosis in cattle and buffalo (bubalus bubalis)

International Nuclear Information System (INIS)

Hussain, R.

2014-01-01

In present study the clinico-pathological findings were recorded in naturally infected cattle and buffaloes due to pasteurella multocida during an outbreak at different livestock herds. There was no significant difference in mortality among various groups of buffaloes (p>0.78) and cattle (p>0.49). The infected animals showed clinical signs of moderate to acute anorexia, salivation, fever, depression, dysponea, submandibular edema, mucopurulent nasal discharge and respiratory grunts. Few of infected animals died due to septicemia. the necropsy of dead animals was performed and visceral organs lungs, kidneys, heart and lymph nodes were observed for gross and histopathological lesions. The tissue samples from these organs were fixed in formalin for pathological changes. Necropsy of dead animals revealed severe pneumonia, consolidation of lungs and intense pleural adhesions. serosanguinous fluid was accumulated in pericardium and peritoneal cavities. Histopathologically affected lungs exhibited severe congestion, mononuclear cell infiltration, thick interlobular septae punctuated with macrophages, plasma cells and peri-vascular cuffing. Liver, kidneys and lymph nodes had degenerative changes in histological sections. The specificity of p. multocida was determined by colony characteristics on macconkey's agar and morphological features with gram's iodine. The pcr product size approximately 511bp from lung tissues confirmed a total of 82% (19/23) bacterial isolates from dead animals. (author)

Fatal Pasteurella haemolytica pneumonia in bighorn sheep after direct contact with clinically normal domestic sheep.

Science.gov (United States)

Foreyt, W J

1989-03-01

Six Rocky Mountain bighorn sheep were raised in captivity from birth (n = 5) or taken from the wild as a lamb (n = 1). After the bighorn sheep were in captivity for over a year, 6 clinically normal domestic sheep were placed on the 2 ha of pasture on which the bighorn sheep were kept. Nasal swab specimens were obtained from all sheep at the time the domestic sheep were introduced. Pasteurella haemolytica was isolated from swab specimens obtained from 4 of 6 domestic sheep, but not from specimens obtained from the bighorn sheep. All 6 bighorn sheep died of acute hemorrhagic pneumonia after exposure to domestic sheep. Death in the bighorn sheep occurred on days 4, 27, 27, 29, 36, or 71 after initial exposure to domestic sheep. Pasteurella haemolytica was isolated from respiratory tract tissue specimens of all bighorn sheep at the time of death. None of the domestic sheep were clinically ill during the study. At the end of the study, 3 of 6 domestic sheep were euthanatized, and at necropsy, P haemolytica was isolated from 2 of them. The most common serotypes in bighorn and domestic sheep were P haemolytica T-3 and A-2. Other serotypes isolated included P haemolytica A-1, A-9, and A-11 in bighorn sheep and A-1 in domestic sheep. On the basis of results of this study and of other reports, domestic sheep and bighorn sheep should not be managed in proximity to each other because of the potential fatal consequences in bighorn sheep.

Phylogeny of 54 representative strains of species in the family Pasteurellaceae as determined by comparison of 16S rRNA sequences.

Science.gov (United States)

Dewhirst, F E; Paster, B J; Olsen, I; Fraser, G J

1992-03-01

Virtually complete 16S rRNA sequences were determined for 54 representative strains of species in the family Pasteurellaceae. Of these strains, 15 were Pasteurella, 16 were Actinobacillus, and 23 were Haemophilus. A phylogenetic tree was constructed based on sequence similarity, using the Neighbor-Joining method. Fifty-three of the strains fell within four large clusters. The first cluster included the type strains of Haemophilus influenzae, H. aegyptius, H. aphrophilus, H. haemolyticus, H. paraphrophilus, H. segnis, and Actinobacillus actinomycetemcomitans. This cluster also contained A. actinomycetemcomitans FDC Y4, ATCC 29522, ATCC 29523, and ATCC 29524 and H. aphrophilus NCTC 7901. The second cluster included the type strains of A. seminis and Pasteurella aerogenes and H. somnus OVCG 43826. The third cluster was composed of the type strains of Pasteurella multocida, P. anatis, P. avium, P. canis, P. dagmatis, P. gallinarum, P. langaa, P. stomatis, P. volantium, H. haemoglobinophilus, H. parasuis, H. paracuniculus, H. paragallinarum, and A. capsulatus. This cluster also contained Pasteurella species A CCUG 18782, Pasteurella species B CCUG 19974, Haemophilus taxon C CAPM 5111, H. parasuis type 5 Nagasaki, P. volantium (H. parainfluenzae) NCTC 4101, and P. trehalosi NCTC 10624. The fourth cluster included the type strains of Actinobacillus lignieresii, A. equuli, A. pleuropneumoniae, A. suis, A. ureae, H. parahaemolyticus, H. parainfluenzae, H. paraphrohaemolyticus, H. ducreyi, and P. haemolytica. This cluster also contained Actinobacillus species strain CCUG 19799 (Bisgaard taxon 11), A. suis ATCC 15557, H. ducreyi ATCC 27722 and HD 35000, Haemophilus minor group strain 202, and H. parainfluenzae ATCC 29242. The type strain of P. pneumotropica branched alone to form a fifth group. The branching of the Pasteurellaceae family tree was quite complex. The four major clusters contained multiple subclusters. The clusters contained both rapidly and slowly evolving

Pasteurella haemolytica bacteriophage: identification, partial characterization, and relationship of temperate bacteriophages from isolates of Pasteurella haemolytica (biotype A, serotype 1)

International Nuclear Information System (INIS)

Richards, A.B.; Renshaw, H.W.; Sneed, L.W.

1985-01-01

Pasteurella haemolytica (biotype A, serotype 1) isolates (n = 15) from the upper respiratory tract of clinically normal cattle, as well as from lung lesions from cases of fatal bovine pasteurellosis, were examined for the presence of bacteriophage after irradiation with UV light. Treatment of all P haemolytica isolates with UV irradiation resulted in lysis of bacteria due to the induction of vegetative development of bacteriophages. The extent of growth inhibition and bacterial lysis in irradiated cultures was UV dose-dependent. Bacterial cultures exposed to UV light for 20 s reached peak culture density between 60 and 70 minutes after irradiation; thereafter, culture density declined rapidly, so that by 120 minutes, it was approximately 60% of the original value. When examined ultrastructurally, lytic cultures from each isolate revealed bacteriophages with an overall length of approximately 200 nm and that appeared to have a head with icosahedral symmetry and a contractile tail. Cell-free filtrate from each noninduced bacterial isolate was inoculated onto the other bacterial isolates in a cross-culture sensitivity assay for the presence of phages lytic for the host bacterial isolates. Zones of lysis (plaques) did not develop when bacterial lawns grown from the different isolates were inoculated with filtrates from the heterologous isolates

Antimicrobial Susceptibility of Bacteria That Cause Bovine Respiratory Disease Complex in Alberta, Canada

Directory of Open Access Journals (Sweden)

R. Michele Anholt

2017-12-01

Full Text Available Bovine respiratory disease (BRD is the most important illness of feedlot cattle. Disease management targets the associated bacterial pathogens, Mannheimia haemolytica, Mycoplasma bovis, Pasteurella multocida, Histophilus somni, and Trueperella pyogenes. We conducted a cross-sectional study to measure the frequencies of antimicrobial-resistant BRD pathogens using a collaborative network of veterinarians, industry, government, and a diagnostic laboratory. Seven private veterinary practices in southern Alberta collected samples from both living and dead BRD-affected animals at commercial feedlots. Susceptibility testing of 745 isolates showed that 100% of the M. haemolytica, M. bovis, P. multocida, and T. pyogenes isolates and 66.7% of the H. somni isolates were resistant to at least one antimicrobial class. Resistance to macrolide antimicrobials (90.2% of all isolates was notable for their importance to beef production and human medicine. Multidrug resistance (MDR was high in all target pathogens with 47.2% of the isolates resistant to four or five antimicrobial classes and 24.0% resistance to six to nine classes. We compared the MDR profiles of isolates from two feedlots serviced by different veterinary practices. Differences in the average number of resistant classes were found for M. haemolytica (p < 0.001 and P. multocida (p = 0.002. Compared to previous studies, this study suggests an increasing trend of resistance in BRD pathogens against the antimicrobials used to manage the disease in Alberta. For the veterinary clinician, the results emphasize the importance of ongoing susceptibility testing of BRD pathogens to inform treatment protocols. Surveillance studies that collect additional epidemiological information and manage sampling bias will be necessary to develop strategies to limit the spread of resistance.

Aqueous Humor Antimicrobial Activity: In Vitro Analysis after Topical 0.5% Chloramphenicol Application.

Science.gov (United States)

Cagini, Carlo; Dragoni, Annalisa; Orsolini, Giampaolo; Fiore, Tito; Beccasio, Alfredo; Spadea, Leopoldo; Moretti, Amedeo; Mencacci, Antonella

2017-06-01

To assess aqueous humor antimicrobial activity in vitro after topical 0.5% chloramphenicol application. This investigation included 63 eyes from 65 cataract surgery patients. The study group of 48 eyes received preoperatively four topical applications of 0.5% chloramphenicol. The control group of 15 eyes was given no topical applications. Aqueous humor samples were collected for in vitro antimicrobial analysis using Streptococcus pneumoniae, Haemophilus influenzae, Moraxella catarrhalis, and Pasteurella multocida organisms by means of disk diffusion test. No inhibition halo was observed around all aqueous humor samples from all chloramphenicol-treated patients, irrespective of the sample quantity added to the paper disks, with no significant difference from aqueous humor from untreated control patients. Aqueous humor displayed no bactericidal effect against any of the microorganisms evaluated after topical 0.5% chloramphenicol application.

Elimination of Pasteurella pneumotropica from a Mouse Barrier Facility by Using a Modified Enrofloxacin Treatment Regimen

Science.gov (United States)

Towne, Justin W; Wagner, April M; Griffin, Kurt J; Buntzman, Adam S; Frelinger, Jeffrey A; Besselsen, David G

2014-01-01

Multiple NOD.Cg-Prkdcscid Il2rgtm1WjlTg(HLA-A2.1)Enge/Sz (NSG/A2) transgenic mice maintained in a mouse barrier facility were submitted for necropsy to determine the cause of facial alopecia, tachypnea, dyspnea, and sudden death. Pneumonia and soft-tissue abscesses were observed, and Pasteurella pneumotropica biotype Jawetz was consistently isolated from the upper respiratory tract, lung, and abscesses. Epidemiologic investigation within the facility revealed presence of this pathogen in mice generated or rederived by the intramural Genetically Engineered Mouse Model (GEMM) Core but not in mice procured from several approved commercial vendors. Epidemiologic data suggested the infection originated from female or vasectomized male ND4 mice obtained from a commercial vendor and then comingled by the GEMM Core to induce pseudopregnancy in female mice for embryo implantation. Enrofloxacin delivered in drinking water (85 mg/kg body weight daily) for 14 d was sufficient to clear bacterial infection in normal, breeding, and immune-deficient mice without the need to change the antibiotic water source. This modified treatment regimen was administered to 2400 cages of mice to eradicate Pasteurella pneumotropica from the facility. Follow-up PCR testing for P. pneumotropica biotype Jawetz remained uniformly negative at 2, 6, 12, and 52 wk after treatment in multiple strains of mice that were originally infected. Together, these data indicate that enrofloxacin can eradicate P. pneumotropica from infected mice in a less labor-intensive approach that does not require breeding cessation and that is easily adaptable to the standard biweekly cage change schedule for individually ventilated cages. PMID:25255075

Elimination of Pasteurella pneumotropica from a mouse barrier facility by using a modified enrofloxacin treatment regimen.

Science.gov (United States)

Towne, Justin W; Wagner, April M; Griffin, Kurt J; Buntzman, Adam S; Frelinger, Jeffrey A; Besselsen, David G

2014-09-01

Multiple NOD. Cg-Prkdc(scid)Il2rg(tm1Wjl)Tg(HLA-A2.1)Enge/Sz (NSG/A2) transgenic mice maintained in a mouse barrier facility were submitted for necropsy to determine the cause of facial alopecia, tachypnea, dyspnea, and sudden death. Pneumonia and soft-tissue abscesses were observed, and Pasteurella pneumotropica biotype Jawetz was consistently isolated from the upper respiratory tract, lung, and abscesses. Epidemiologic investigation within the facility revealed presence of this pathogen in mice generated or rederived by the intramural Genetically Engineered Mouse Model (GEMM) Core but not in mice procured from several approved commercial vendors. Epidemiologic data suggested the infection originated from female or vasectomized male ND4 mice obtained from a commercial vendor and then comingled by the GEMM Core to induce pseudopregnancy in female mice for embryo implantation. Enrofloxacin delivered in drinking water (85 mg/kg body weight daily) for 14 d was sufficient to clear bacterial infection in normal, breeding, and immune-deficient mice without the need to change the antibiotic water source. This modified treatment regimen was administered to 2400 cages of mice to eradicate Pasteurella pneumotropica from the facility. Follow-up PCR testing for P. pneumotropica biotype Jawetz remained uniformly negative at 2, 6, 12, and 52 wk after treatment in multiple strains of mice that were originally infected. Together, these data indicate that enrofloxacin can eradicate P. pneumotropica from infected mice in a less labor-intensive approach that does not require breeding cessation and that is easily adaptable to the standard biweekly cage change schedule for individually ventilated cages.

An ecologic study comparing distribution of Pasteurella trehalosi and Mannheimia haemolytica between Sierra Nevada bighorn sheep, White Mountain bighorn sheep, and domestic sheep.

Science.gov (United States)

Tomassini, Letizia; Gonzales, Ben; Weiser, Glen C; Sischo, William

2009-10-01

The prevalence and phenotypic variability of Pasteurella and Mannheimia isolates from Sierra Nevada bighorn sheep (Ovis canadensis sierrae), White Mountain bighorn sheep (Ovis canadensis nelsoni), and domestic sheep (Ovis aries) from California, USA, were compared. The White Mountain bighorn sheep population had a recent history of pneumonia-associated mortality, whereas the Sierra Nevada bighorn sheep population had no recent history of pneumonia-associated mortality. The domestic sheep flocks were pastured in areas geographically near both populations but were not known to have direct contact with either bighorn sheep population. Oropharyngeal swab samples were collected from healthy domestic and bighorn sheep and cultured to characterize bacterial species, hemolysis, biogroups, and biovariants. Pasteurella trehalosi and Mannheimia haemolytica were detected in all of the study populations, but the relative proportion of each bacterial species differed among sheep populations. Pasteurella trehalosi was more common than M. haemolytica in the bighorn sheep populations, whereas the opposite was true in domestic sheep. Mannheimia haemolytica was separated into 11 biogroups, and P. trehalosi was characterized into two biogroups. Biogroup distributions for M. haemolytica and P. trehalosi differed among the three populations; however, no difference was detected for the distribution of P. trehalosi biogroups between the Sierra Nevada bighorn sheep and domestic sheep. The prevalence odds ratios (pOR) for the distribution of M. haemolytica biogroups suggested little difference between White Mountain bighorn sheep and domestic sheep compared with Sierra Nevada bighorn sheep and domestic sheep, although these comparisons had relatively large confidence intervals for the point estimates. Hemolytic activity of the isolates was not different among the sheep populations for M. haemolytica but was different for P. trehalosi. No clear evidence of association was found in the

Susceptibility of Rocky Mountain bighorn sheep and domestic sheep to pneumonia induced by bighorn and domestic livestock strains of Pasteurella haemolytica.

OpenAIRE

Onderka, D K; Rawluk, S A; Wishart, W D

1988-01-01

Bighorn sheep were inoculated intratracheally with suspensions of nonhemolytic Pasteurella haemolytica biotype T (10(12) organisms) unique to wild bighorns, with beta-hemolytic P. haemolytica biotype T (10(12) organisms) isolated from clinically normal domestic sheep or intradermally with half a dose of a cattle vaccine containing P. haemolytica biotype A (10(5) organisms). The bighorn strain caused lobar necrotizing bronchopneumonia whereas both domestic livestock strains precipitated fatal ...

Monitoring of antimicrobial susceptibility of respiratory tract pathogens isolated from diseased cattle and pigs across Europe, 2009-2012: VetPath results.

Science.gov (United States)

El Garch, Farid; de Jong, Anno; Simjee, Shabbir; Moyaert, Hilde; Klein, Ulrich; Ludwig, Carolin; Marion, Hervé; Haag-Diergarten, Silke; Richard-Mazet, Alexandra; Thomas, Valérie; Siegwart, Ed

2016-10-15

VetPath is an ongoing pan-European antibiotic susceptibility monitoring programme that collects pathogens from diseased cattle, pigs and poultry. In the current study, 996 isolates from cattle and pig respiratory tract infections were tested for their antimicrobial susceptibilities. Non-replicate lung samples or nasopharyngeal/nasal swabs were collected from animals with acute clinical signs in 10 countries during 2009-2012. Pasteurella multocida, Mannheimia haemolytica and Histophilus somni from cattle and P. multocida, Actinobacillus pleuropneumoniae, Haemophilus parasuis, Bordetella bronchiseptica and Streptococcus suis from pigs were isolated by standard methods. S. suis was also isolated from meningitis cases. MIC values of 16 or 17 antibiotics were assessed centrally by broth microdilution following CLSI standards. Results were interpreted using CLSI breakpoints where available. Cattle isolates were generally highly susceptible to most antibiotics, except to tetracycline (3.0-12.0% resistance). Low levels of resistance (0-4.0%) were observed for the macrolide antibiotics. Resistance to spectinomycin varied from 0 to 6.0%. In pig isolates similar observations were made. Resistance to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin, florfenicol, tulathromycin, tiamulin and tilmicosin was absent or <2%. Trimethoprim/sulfamethoxazole resistance varied from 1.9 to 5.3%, but tetracycline resistance varied from 20.4% in P. multocida to 88.1% in S. suis. For most antibiotics and pathogens the percentage resistance remained unchanged or only increased numerically as compared to that of the period 2002-2006. In conclusion, absence or low resistance to antibiotics with defined clinical breakpoints, except for tetracycline, was observed among the major respiratory tract pathogens recovered from livestock. Comparison of all antibiotics and organisms was hampered since for almost half of the antibiotics no CLSI-defined breakpoints were available. Copyright © 2016

مطالعه بر روی ایمنی زایی یک واکسن آزمایشی سپتی سمی هموراژیک با ادجوان روغنی در گاو

Directory of Open Access Journals (Sweden)

ا. ستوده نیا

2005-01-01

Full Text Available An oil adjuvant vaccine (OAV was prepared from a local strain of Pasteurella multocida. Strain 6:B was cultured and inactivated by formalin. Bacterial pellet was prepared by centrifugation and subsequently adjuvanted by Montannide oil ISA-70. A dose of prepared vaccine containing 3ml (2mg dry weight/ml was injected into five calves by IM route. Animals were bled before and at 24, 90, 150, and 200 days post-vaccination. Collected sera were used in passive mouse protection test (PMPT. Active mouse protection test (AMPT was carried out for OAV according to standard method. Results of PMPT showed 100% protection up to 150 days and 66-83% up to 200 days post-vaccination. In AMPT, 4 log of protection was gained. In this experiment the immunity induced by OAV adjuvanted by ISA-70 could protect the calves.

Combinations of macrolide resistance determinants in field isolates of Mannheimia haemolytica and Pasteurella multocida

DEFF Research Database (Denmark)

Desmolaize, Benoit; Rose, Simon; Wilhelm, Cornelia

2011-01-01

of these species exhibit resistance to veterinary macrolides with phenotypes that fall into three distinct classes. The first class has type I macrolide, lincosamide, and streptogramin B antibiotic resistance and, consistent with this, the 23S rRNA nucleotide A2058 is monomethylated by the enzyme product......(E) genes within an isogenic Escherichia coli background to assess their individually contributions to resistance. Our findings indicate what types of compounds might have driven the selection for these resistance determinants....

Purification, crystallization and preliminary crystallographic characterization of the α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224

International Nuclear Information System (INIS)

Okino, Nozomu; Kakuta, Yoshimitsu; Kajiwara, Hitomi; Ichikawa, Masako; Takakura, Yoshimitsu; Ito, Makoto; Yamamoto, Takeshi

2007-01-01

Crystallization of the α2,6-sialyltransferase from Photobacterium. Sialyltransferases transfer sialic acid from cytidine-5-monophospho-N-acetylneuraminic acid (CMP-NeuAc) to the nonreducing termini of the oligosaccharyl structures of various glycoproteins and glycolipids. The newly cloned α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224 (from the Vibrionaceae family) is composed of two domains: an unknown N-terminal domain and a catalytic C-terminal domain which shares significant homology with the Pasteurella multocida multifunctional sialyltransferase. The putative mature form of JT-ISH-224 α2,6-sialyltransferase was overproduced in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method at 293 K. The crystal belonged to space group P3 1 21 or P3 2 21, with unit-cell parameters a = b = 90.29, c = 204.33 Å. X-ray diffraction data were collected to 2.5 Å resolution

Pneumonia in slaughtered sheep in south-western Iran: pathological characteristics and aerobic bacterial aetiology.

Science.gov (United States)

Azizi, Shahrzad; Korani, Farzad Shahrani; Oryan, Ahmad

2013-01-01

In this study, the lungs of 1,000 sheep carcasses were subjected to gross examination and those suspected to be infected with pneumonia were studied at histopathological level as well as examined for presence of bacteria. Pneumonia was detected in 42 (4.2%) carcasses. Based on histopathological lesions, 45.24% were affected with suppurative bronchopneumonia, 20.93% with interstitial pneumonia, 11.9% bronchointerstitial pneumonia, 7.14% with fibrinous bronchopneumonia and 2.38% with embolic pneumonia. In addition, 11.9% of the lungs showed lung abscesses and 2.33% were affected with pleuritis without involving pulmonary parenchyma. Bacteriological examination revealed presence of ovine pathogens, such as Pasteurella multocida (24.53%), Staphylococcus aureus (20.75%), Klebsiella pneumoniae (15.09%), Corynebacterium pseudotuberculosis (7.55%) and Actinomyces pyogenes (1.89%). The most common form of pneumonia was suppurative bronchopneumonia with moderate amounts of fibrin deposits on the pleural surface and inside the bronchioles and alveoli.

Una alabarda procedente del valle del Manzanares (Madrid

Directory of Open Access Journals (Sweden)

Miguel Ángel de BLAS CORTINA

2009-12-01

Full Text Available RESUMEN: Se estudia una alabarda metálica procedente —sin datos precisos de su localización— del valle del Manzanares (Madrid. Posiblemente apareciera con otros materiales (¿puntas Palmela?, pero el hecho no pudo ser comprobado. Fundida en un molde monovalvo que proporciona un acabado homogéneo a una sola de las caras, se integra metalúrgicamente en el grupo E 01 (cobres arsenicales propio de la Península Ibérica durante el Calcolítico y el Bronce Antiguo. Tipológicamente puede ser clasificada como integrante del grupo Carrapatas al que pertenecen un conjunto de alabardas procedentes del N.E. de Portugal (Bragança y Tras os Montes del que se conocen escasos testimonios fuera del área característica. Especialmente significativo es el hallazgo de la finca de la Paloma (Pantoja, Toledo que muestra la asociación entre las alabardas Carrapatas y elementos propios del campaniforme tardío de España y Portugal, circunstancia que permite fechar el tipo entre el 1700-1500 a. de J.C., datación similar a las fechas admitidas para las alabardas irlandesas con las que algunos autores ven posibles relaciones. La existencia de alabardas grabadas en estelas más tardías o en rocas al aire libre plantea el problema de su perduración. No obstante, el carácter simbólico de las armas grabadas puede hacer que sea solamente la imagen representada la que superviva, aunque el arma como tal haya perdido vigencia. La alabarda del Manzanares, junto con las de Pantoja, señala la presencia en la Meseta Sur de elementos metalúrgicos propios del N.W. de la Península en un momento sincrónico con las fases finales del campaniforme.ABSTRACT: We study a metallic halberd found in an indeterminate place in the valley of the river Manzanares (Madrid. It might have appeared with other materials (Palmela Points?, although this fact could not be confirmed. Made in a single-faced mould which allows a homogeneous finish to only one of the sides, it belongs from

Development of colloidal gold immunochromatographic strips for detection of Riemerella anatipestifer.

Directory of Open Access Journals (Sweden)

Wanwan Hou

Full Text Available Riemerella anatipestifer is one of the most important bacterial pathogen of ducks and causes a contagious septicemia. R. anatipestifer infection causes serositis syndromes similar to other bacterial infections in ducks, including infection by Escherichia coli, Salmonella enterica and Pasteurella multocida. Clinically differentiating R. anatipestifer infections from other bacterial pathogen infections is usually difficult. In this study, MAb 1G2F10, a monoclonal antibody against R. anatipestifer GroEL, was used to develop a colloidal gold immunochromatographic strip. Colloidal gold particles were prepared by chemical synthesis to an average diameter of 20 ± 5.26 nm by transmission electron microscope imaging. MAb 1G2F10 was conjugated to colloidal gold particles and the formation of antibody-colloidal gold conjugates was monitored by UV/Vis spectroscopy. Immunochromatographic strips were assembled in regular sequence through different accessories sticked on PVC plate. Strips specifically detected R. anatipestifer within 10 min, but did not detect E. coli, S. enterica and P. multocida. The detection limit for R. anatipestifer was 1 × 10(6 colony forming units, which was 500 times higher than a conventional agglutination test. Accuracy was 100% match to multiplex PCR. Assay stability and reproducibility were excellent after storage at 4°C for 6 months. The immunochromatographic strips prepared in this study offer a specific, sensitive, and rapid detection method for R. anatipestifer, which is of great importance for the prevention and control of R. anatipestifer infections.

Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site

Energy Technology Data Exchange (ETDEWEB)

Gangi Setty, Thanuja [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India); Cho, Christine [Carver College of Medicine, University of Iowa, Iowa City, IA 52242-1109 (United States); Govindappa, Sowmya [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India); Apicella, Michael A. [Carver College of Medicine, University of Iowa, Iowa City, IA 52242-1109 (United States); Ramaswamy, S., E-mail: ramas@instem.res.in [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India)

2014-07-01

Structure–function studies of sialic acid-binding proteins from F. nucleatum, P. multocida, V. cholerae and H. influenzae reveal a conserved network of hydrogen bonds involved in conformational change on ligand binding. Sialic acids are a family of related nine-carbon sugar acids that play important roles in both eukaryotes and prokaryotes. These sialic acids are incorporated/decorated onto lipooligosaccharides as terminal sugars in multiple bacteria to evade the host immune system. Many pathogenic bacteria scavenge sialic acids from their host and use them for molecular mimicry. The first step of this process is the transport of sialic acid to the cytoplasm, which often takes place using a tripartite ATP-independent transport system consisting of a periplasmic binding protein and a membrane transporter. In this paper, the structural characterization of periplasmic binding proteins from the pathogenic bacteria Fusobacterium nucleatum, Pasteurella multocida and Vibrio cholerae and their thermodynamic characterization are reported. The binding affinities of several mutations in the Neu5Ac binding site of the Haemophilus influenzae protein are also reported. The structure and the thermodynamics of the binding of sugars suggest that all of these proteins have a very well conserved binding pocket and similar binding affinities. A significant conformational change occurs when these proteins bind the sugar. While the C1 carboxylate has been identified as the primary binding site, a second conserved hydrogen-bonding network is involved in the initiation and stabilization of the conformational states.

Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site

International Nuclear Information System (INIS)

Gangi Setty, Thanuja; Cho, Christine; Govindappa, Sowmya; Apicella, Michael A.; Ramaswamy, S.

2014-01-01

Structure–function studies of sialic acid-binding proteins from F. nucleatum, P. multocida, V. cholerae and H. influenzae reveal a conserved network of hydrogen bonds involved in conformational change on ligand binding. Sialic acids are a family of related nine-carbon sugar acids that play important roles in both eukaryotes and prokaryotes. These sialic acids are incorporated/decorated onto lipooligosaccharides as terminal sugars in multiple bacteria to evade the host immune system. Many pathogenic bacteria scavenge sialic acids from their host and use them for molecular mimicry. The first step of this process is the transport of sialic acid to the cytoplasm, which often takes place using a tripartite ATP-independent transport system consisting of a periplasmic binding protein and a membrane transporter. In this paper, the structural characterization of periplasmic binding proteins from the pathogenic bacteria Fusobacterium nucleatum, Pasteurella multocida and Vibrio cholerae and their thermodynamic characterization are reported. The binding affinities of several mutations in the Neu5Ac binding site of the Haemophilus influenzae protein are also reported. The structure and the thermodynamics of the binding of sugars suggest that all of these proteins have a very well conserved binding pocket and similar binding affinities. A significant conformational change occurs when these proteins bind the sugar. While the C1 carboxylate has been identified as the primary binding site, a second conserved hydrogen-bonding network is involved in the initiation and stabilization of the conformational states

CARACTERÍSTICAS FÍSICAS DE LA MADERA DE PINO PROCEDENTE DE RALEOS EN EL NOROESTE DE ESPAÑA

OpenAIRE

Riesco Muñoz,G; Díaz González,J

2007-01-01

Se estudió la densidad, contracción, higroscopicidad y punto de saturación de la pared celular en la madera de ejemplares jóvenes de tres especies importantes en la producción maderera española: Pinus pinaster, Pinus sylvestris y Pinus radiata. Se muestrearon 29 pinos procedentes de raleos efectuados en diferentes masas forestales de Galicia (noroeste de España). El material de ensayo fueron probetas de pequeñas dimensiones sin defectos. La madera de Pinus pinaster resultó semipesada y más in...

Caracterización del efecto anticanceroso e identificación de dianas moleculares de principios activos procedentes de "Serratia marcescens"

OpenAIRE

Soto Cerrato, Vanessa

2007-01-01

Este trabajo de tesis presenta la caracterización del efecto anticanceroso y la identificación de dianas moleculares de principios activos procedentes de la bacteria "Serratia marcescens". En particular, se ha evaluado la capacidad anticancerosa "in vitro" y "ex vivo" del ciclodepsipéptido serratamolide (AT514) en varias células cancerosas y no cancerosas de diverso origen tisular, obteniendo una mayor sensibilidad al tratamiento por parte de las células cancerosas. También hemos realizado es...

[Transformation from chronic subdural hematoma into subdural empyema following cat bites: a case report].

Science.gov (United States)

Konno, Takuya; Yamada, Kei; Kasahara, Sou; Umeda, Yoshitaka; Oyake, Mutsuo; Fujita, Nobuya

2015-01-01

A 69-year-old man developed motor aphasia and right hemiparesis with severe headache, during the treatment of cellulitis and sepsis due to cat bites. Brain CT showed a low density, crescent-shaped lesion in the left subdural space, which was hypointense on brain diffusion-weighted imaging (DWI). One week later, when his neurological symptoms had worsened, the signal of the subdural lesion had changed to hyperintense on DWI. The lesion was capsule-shaped when enhanced by Gadolinium. The signal changes on DWI of the lesion indicated the existing hematoma had changed to an empyema, or so-called infected subdural hematoma, due to a hematogenous bacterial infection. Pasteurella multocida, a resident microbe in the oral cavity of cats, could be the responsible pathogen in this case. The patient recovered completely after treatment with intravenous high dose antibiotics. This is an important case report describing the transformation from a chronic subdural hematoma into a subdural empyema by DWI.

Clinical and microbiological study of otitis externa in sheep

Directory of Open Access Journals (Sweden)

M. I. Al-Farwachi

2008-01-01

Full Text Available In this study one hundred Awassi sheep were examined clinically and bacteriologically for isolation and identification of the bacterial agents of otitis externa in sheep. The main clinical signs appeared included weakness, pale mucus membrane, auricular discharge, cough, anorexia, emaciation, and nasal discharge. Results revealed isolation of bacteria from (45% examined swabs. The most being from right ear. Younger animals were more frequently infected than older animals. Pseudomonas aeruginosa, Staphylococcus aureus, Mannheimia haemolytica, Staph. epidermidis, Pasteurella multocida, Streptococcus spp., Acintobacter spp., Escherichia coli and Klebsiella pneumonia were isolated. The results revealed that the most bacterial isolates were resistance to the bactericidal effect of the normal serum included Streptococcus pneumonia, Staphylococcus aureus, Mannheimia haemolytica. While the most bacterial isolates were produced hydroxymate siderophore included Staphylococcus aureus, Mannheimia haemolytica, Streptococcus pneumonia. The obtained results indicated to the importance of determination of serum resistance as a bacterial virulence factor in otitis externa in sheep.

Enzymatic production of human milk oligosaccharides

DEFF Research Database (Denmark)

Guo, Yao

. A recombinant Pasteurella multocida sialyltransferase (EC 2.4.99.-), namely PmST, exhibiting promiscuous trans-sialidase activities was examined. The enzyme catalysed α-2,3- and α-2,6- sialylation of lactose using either 2- O -(p-nitrophenyl)-α- D - N -acetylneuraminic acid or casein glycomacropeptide...... galactooligosaccharides with use of galactooligosaccharides as acceptors. Secondly, we examined the regioselectivity of five designed mutants of PmST catalysing synthesis of 3'- and 6'-sialyllactoses using casein glycomacropeptide and lactose as substrates. The mutants PmST E271F , PmST R313Y and PmST E271F/R313Y...... was almost abolished. The k cat / K m value for PmST P34H catalysing 6'-sialyllactose synthesis using 3'-sialyllactose as donor was 31.2 M -1 s -1 . Moreover, both the wild type enzyme and PmST P34H were capable of catalysing the hydrolysis and transfer of α-2,6 bound sialic acid....

New derivatives of salicylamides: Preparation and antimicrobial activity against various bacterial species.

Science.gov (United States)

Pauk, Karel; Zadražilová, Iveta; Imramovský, Aleš; Vinšová, Jarmila; Pokorná, Michaela; Masaříková, Martina; Cížek, Alois; Jampílek, Josef

2013-11-01

Three series of salicylanilides, esters of N-phenylsalicylamides and 2-hydroxy-N-[1-(2-hydroxyphenylamino)-1-oxoalkan-2-yl]benzamides, in total thirty target compounds were synthesized and characterized. The compounds were evaluated against seven bacterial and three mycobacterial strains. The antimicrobial activities of some compounds were comparable or higher than the standards ampicillin, ciprofloxacin or isoniazid. Derivatives 3f demonstrated high biological activity against Staphylococcus aureus (⩽0.03μmol/L), Mycobacterium marinum (⩽0.40μmol/L) and Mycobacterium kansasii (1.58μmol/L), 3g shows activity against Clostridium perfringens (⩽0.03μmol/L) and Bacillus cereus (0.09μmol/L), 3h against Pasteurella multocida (⩽0.03μmol/L) and M. kansasii (⩽0.43μmol/L), 3i against methicillin-resistant S. aureus and B. cereus (⩽0.03μmol/L). The structure-activity relationships are discussed for all the compounds. Copyright © 2013 Elsevier Ltd. All rights reserved.

Aerobic bacteria occurring in the vagina of bitches with reproductive disorders.

Science.gov (United States)

Bjurström, L

1993-01-01

A retrospective survey was performed of aerobic bacterial species found in the vagina of 203 bitches with genital disorders, e.g. infertility, vaginitis, pyometra and puppy death. Escherichia coli, beta-hemolytic streptococci, Staphylococcus intermedius and Pasteurella multocida were the species most often isolated. From bitches with pyometra E. coli in pure culture was the most frequent isolate. In contrast, the majority of infertile bitches gave rise to mixed cultures, and no specific bacterial species was consistently associated with infertility. Thus, bacterial sampling from infertile bitches was concluded to be of low diagnostic value. Bacterial species isolated from the bitches having vaginitis were present in pure culture in 26.9% of the samples while nonspecific mixed cultures were obtained from 34.6% of the samples from these bitches. E. coli was the most frequently isolated bacterial species from bitches with dead puppies. However, in such cases it is important to relate the vaginal bacterial findings to autopsy findings and the results of bacteriological cultures of the pups.

Causes of Pneumonia Epizootics among Bighorn Sheep, Western United States, 2008–2010

Science.gov (United States)

Highland, Margaret A.; Baker, Katherine; Cassirer, E. Frances; Anderson, Neil J.; Ramsey, Jennifer M.; Mansfield, Kristin; Bruning, Darren L.; Wolff, Peregrine; Smith, Joshua B.; Jenks, Jonathan A.

2012-01-01

Epizootic pneumonia of bighorn sheep is a devastating disease of uncertain etiology. To help clarify the etiology, we used culture and culture-independent methods to compare the prevalence of the bacterial respiratory pathogens Mannheimia haemolytica, Bibersteinia trehalosi, Pasteurella multocida, and Mycoplasma ovipneumoniae in lung tissue from 44 bighorn sheep from herds affected by 8 outbreaks in the western United States. M. ovipneumoniae, the only agent detected at significantly higher prevalence in animals from outbreaks (95%) than in animals from unaffected healthy populations (0%), was the most consistently detected agent and the only agent that exhibited single strain types within each outbreak. The other respiratory pathogens were frequently but inconsistently detected, as were several obligate anaerobic bacterial species, all of which might represent secondary or opportunistic infections that could contribute to disease severity. These data provide evidence that M. ovipneumoniae plays a primary role in the etiology of epizootic pneumonia of bighorn sheep. PMID:22377321

Causes of pneumonia epizootics among bighorn sheep, Western United States, 2008-2010.

Science.gov (United States)

Besser, Thomas E; Highland, Margaret A; Baker, Katherine; Cassirer, E Frances; Anderson, Neil J; Ramsey, Jennifer M; Mansfield, Kristin; Bruning, Darren L; Wolff, Peregrine; Smith, Joshua B; Jenks, Jonathan A

2012-03-01

Epizootic pneumonia of bighorn sheep is a devastating disease of uncertain etiology. To help clarify the etiology, we used culture and culture-independent methods to compare the prevalence of the bacterial respiratory pathogens Mannheimia haemolytica, Bibersteinia trehalosi, Pasteurella multocida, and Mycoplasma ovipneumoniae in lung tissue from 44 bighorn sheep from herds affected by 8 outbreaks in the western United States. M. ovipneumoniae, the only agent detected at significantly higher prevalence in animals from outbreaks (95%) than in animals from unaffected healthy populations (0%), was the most consistently detected agent and the only agent that exhibited single strain types within each outbreak. The other respiratory pathogens were frequently but inconsistently detected, as were several obligate anaerobic bacterial species, all of which might represent secondary or opportunistic infections that could contribute to disease severity. These data provide evidence that M. ovipneumoniae plays a primary role in the etiology of epizootic pneumonia of bighorn sheep.

Pneumonia in slaughtered sheep in south-western Iran: pathological characteristics and aerobic bacterial aetiology

Directory of Open Access Journals (Sweden)

Shahrzad Azizi

2013-03-01

Full Text Available In this study, the lungs of 1,000 sheep carcasses were subjected to gross examination and those suspected to be infected with pneumonia were studied at histopathological level as well as examined for presence of bacteria. Pneumonia was detected in 42 (4.2% carcasses. Based on histopathological lesions, 45.24% were affected with suppurative bronchopneumonia, 20.93% with interstitial pneumonia, 11.9% bronchointerstitial pneumonia, 7.14% with fibrinous bronchopneumonia and 2.38% with embolic pneumonia. In addition, 11.9% of the lungs showed lung abscesses and 2.33% were affected with pleuritis without involving pulmonary parenchyma. Bacteriological examination revealed presence of ovine pathogens, such as Pasteurella multocida (24.53%, Staphylococcus aureus (20.75%, Klebsiella pneumoniae (15.09%, Corynebacterium pseudotuberculosis (7.55% and Actinomyces pyogenes (1.89%. The most common form of pneumonia was suppurative bronchopneumonia with moderate amounts of fibrin deposits on the pleural surface and inside the bronchioles and alveoli.

Bovine mastitis caused by gram negative bacteria in Mosul

Directory of Open Access Journals (Sweden)

S. Y. A. Al-Dabbagh

2012-01-01

Full Text Available A total of 90 milk samples were collected from cows with clinical and subclinical mastitis from different areas in Mosul city, in a period from October 2009 to June 2010, for the detection of gram negative bacteriological causative agents. The bacteria were identified using morphological, cultural and biochemical characteristics. thirty tow (35.3% gram negative bacterial isolates were obtained from the total count which included 14 isolates (15.5% for Escherichia coli, 7 isolates (7.7% for Klebsiella spp, 4 isolates (4.4% for Pseudomonas aeruginosa, 3 isolates (3.3% for Enterobacter aerogenes ,2 isolates for Serratia marcescens and one isolates (1.1% for each of Aeromonas hydrophila and Pasteurella multocida. Results of antibiotic sensitivity test indicated that most of these isolates were sensitive to Ciprofloxacin following by Gentamycin and Cotrimoxazole, while most of these organisms were resistant to Ampicillin, the isolates showed different percentages of sensitivity to Doxycycline, Tetracycline, Neomycin and Chloramphenicol.

Mutant prevention concentration, pharmacokinetic-pharmacodynamic integration, and modeling of enrofloxacin data established in diseased buffalo calves.

Science.gov (United States)

Ramalingam, B; Sidhu, P K; Kaur, G; Venkatachalam, D; Rampal, S

2015-12-01

The pharmacokinetic-pharmacodynamic (PK/PD) modeling of enrofloxacin data using mutant prevention concentration (MPC) of enrofloxacin was conducted in febrile buffalo calves to optimize dosage regimen and to prevent the emergence of antimicrobial resistance. The serum peak concentration (Cmax ), terminal half-life (t1/2 K10) , apparent volume of distribution (Vd(area) /F), and mean residence time (MRT) of enrofloxacin were 1.40 ± 0.27 μg/mL, 7.96 ± 0.86 h, 7.74 ± 1.26 L/kg, and 11.57 ± 1.01 h, respectively, following drug administration at dosage 12 mg/kg by intramuscular route. The minimum inhibitory concentration (MIC), minimum bactericidal concentration, and MPC of enrofloxacin against Pasteurella multocida were 0.055, 0.060, and 1.45 μg/mL, respectively. Modeling of ex vivo growth inhibition data to the sigmoid Emax equation provided AUC24 h /MIC values to produce effects of bacteriostatic (33 h), bactericidal (39 h), and bacterial eradication (41 h). The estimated daily dosage of enrofloxacin in febrile buffalo calves was 3.5 and 8.4 mg/kg against P. multocida/pathogens having MIC90 ≤0.125 and 0.30 μg/mL, respectively, based on the determined AUC24 h /MIC values by modeling PK/PD data. The lipopolysaccharide-induced fever had no direct effect on the antibacterial activity of the enrofloxacin and alterations in PK of the drug, and its metabolite will be beneficial for its use to treat infectious diseases caused by sensitive pathogens in buffalo species. In addition, in vitro MPC data in conjunction with in vivo PK data indicated that clinically it would be easier to eradicate less susceptible strains of P. multocida in diseased calves. © 2015 John Wiley & Sons Ltd.

Mortalidad por meningitis por Pasteurella canis. Oportunidades de aprendizaje

Directory of Open Access Journals (Sweden)

Ana Rosa Ropero Vera

2016-01-01

Full Text Available La meningitis bacteriana es una enfermedad importante de distribución mundial, causa mayor y sustancial de mortalidad y morbilidad en países en desarrollo. La Organización Mundial de la Salud (OMS sostiene que la meningitis es una de las diez afecciones principales del ser humano y debe ser considerada como una emergencia infectológica; por eso es fundamental reconocer que esta enfermedad es causa de muerte en niños de todo el mundo, sin distinción de raza, nivel económico o sociocultural. Se realizó una investigación de caso en menor de 53 días de nacido, que cumplía con los criterios clínicos y de laboratorio compatible con meningitis bacteriana, con el propósito de analizar y fortalecer la toma de decisiones en salud pública por parte de la secretaría local de salud del municipio de Valledupar (Colombia. Entre los hallazgos se encontró antecedentes infecciosos en el menor, coloración de Gram y cultivo de LCR, en el que se identificó cocobacilos Gram negativos, que fueron aislados como agente causal Pasteurella canis. Este estudio pretende sensibilizar a los prestadores de salud para que cuenten con personal altamente capacitado para brindar tratamientos adecuados y prevenir complicaciones en la meningitis bacteriana en niños, y así disminuir la posibilidad de secuelas o muerte, tanto en pacientes con compromiso inmunológico o sin este.

Evaluación ambiental y aplicaciones de áridos procedentes de RCD ligados con cemento en Ingeniería Civil

OpenAIRE

Rey Tirado, Isaac del

2018-01-01

La presente tesis doctoral se centra en la generación un conocimiento científico original y de calidad, sobre el uso de los áridos reciclados (AR) procedentes de Residuos de la Construcción y Demolición (RCD) para su uso en ingeniería civil, así como realizar una evaluación de la sostenibilidad de estos materiales reciclados. El potencial de los AR supone un acercamiento de la construcción, principal sector en consumo de materias primas y contaminación ambiental, hacia la...

Substratos de bronce en objetos férreos procedentes de la Necrópolis de La Hoya (Laguardia, Alava.

Directory of Open Access Journals (Sweden)

J. Alonso

1996-01-01

Full Text Available Se describe a continuación, brevemente y a modo de avance, un interesante detalle de procedimiento y tecnología aplicada en la elaboración de objetos férreos procedentes de la necrópolis de La Hoya (Laguardia, Alava, puesto en evidencia durante los trabajos de conservación y restauración, y que, por su novedad, sin duda debe abrir nuevas vías tanto en la investigación de las culturas del hierro prerromano, en particular, como en los estudios de arqueometalúrgica, en general.

Anti-BACE1 and Antimicrobial Activities of Steroidal Compounds Isolated from Marine Urechis unicinctus

Directory of Open Access Journals (Sweden)

Yong-Zhe Zhu

2018-03-01

Full Text Available The human β-site amyloid cleaving enzyme (BACE1 has been considered as an effective drug target for treatment of Alzheimer’s disease (AD. In this study, Urechis unicinctus (U. unicinctus, which is a Far East specialty food known as innkeeper worm, ethanol extract was studied by bioassay-directed fractionation and isolation to examine its potential β-site amyloid cleaving enzyme inhibitory and antimicrobial activity. The following compounds were characterized: hecogenin, cholest-4-en-3-one, cholesta-4,6-dien-3-ol, and hurgadacin. These compounds were identified by their mass spectrometry, 1H, and 13C NMR spectral data, comparing those data with NIST/EPA/NIH Mass spectral database (NIST11 and published values. Hecogenin and cholest-4-en-3-one showed significant inhibitory activity against BACE1 with EC50 values of 116.3 and 390.6 µM, respectively. Cholesta-4,6-dien-3-ol and hurgadacin showed broad spectrum antimicrobial activity, particularly strongly against Escherichia coli (E. coli, Salmonella enterica (S. enterica, Pasteurella multocida (P. multocida, and Physalospora piricola (P. piricola, with minimal inhibitory concentration (MIC ranging from 0.46 to 0.94 mg/mL. This is the first report regarding those four known compounds that were isolated from U. unicinctus and their anti-BACE1 and antimicrobial activity, highlighting the fact that known natural compounds may be a critical source of new medicine leads. These findings provide scientific evidence for potential application of those bioactive compounds for the development of AD drugs and antimicrobial agents.

Anti-BACE1 and Antimicrobial Activities of Steroidal Compounds Isolated from Marine Urechis unicinctus.

Science.gov (United States)

Zhu, Yong-Zhe; Liu, Jing-Wen; Wang, Xue; Jeong, In-Hong; Ahn, Young-Joon; Zhang, Chuan-Jie

2018-03-14

The human β-site amyloid cleaving enzyme (BACE1) has been considered as an effective drug target for treatment of Alzheimer's disease (AD). In this study, Urechis unicinctus (U. unicinctus) , which is a Far East specialty food known as innkeeper worm, ethanol extract was studied by bioassay-directed fractionation and isolation to examine its potential β-site amyloid cleaving enzyme inhibitory and antimicrobial activity. The following compounds were characterized: hecogenin, cholest-4- en -3-one, cholesta-4,6- dien -3-ol, and hurgadacin. These compounds were identified by their mass spectrometry, ¹H, and 13 C NMR spectral data, comparing those data with NIST/EPA/NIH Mass spectral database (NIST11) and published values. Hecogenin and cholest-4- en -3-one showed significant inhibitory activity against BACE1 with EC 50 values of 116.3 and 390.6 µM, respectively. Cholesta-4,6- dien -3-ol and hurgadacin showed broad spectrum antimicrobial activity, particularly strongly against Escherichia coli (E. coli) , Salmonella enterica (S. enterica) , Pasteurella multocida (P. multocida) , and Physalospora piricola (P. piricola) , with minimal inhibitory concentration (MIC) ranging from 0.46 to 0.94 mg/mL. This is the first report regarding those four known compounds that were isolated from U. unicinctus and their anti-BACE1 and antimicrobial activity, highlighting the fact that known natural compounds may be a critical source of new medicine leads. These findings provide scientific evidence for potential application of those bioactive compounds for the development of AD drugs and antimicrobial agents.

Aerobic bacteria from mucous membranes, ear canals, and skin wounds of feral cats in Grenada, and the antimicrobial drug susceptibility of major isolates.

Science.gov (United States)

Hariharan, Harry; Matthew, Vanessa; Fountain, Jacqueline; Snell, Alicia; Doherty, Devin; King, Brittany; Shemer, Eran; Oliveira, Simone; Sharma, Ravindra N

2011-03-01

In a 2-year period 54 feral cats were captured in Grenada, West Indies, and a total of 383 samples consisting of swabs from rectum, vagina, ears, eyes, mouth, nose and wounds/abscesses, were cultured for aerobic bacteria and campylobacters. A total of 251 bacterial isolates were obtained, of which 205 were identified to species level and 46 to genus level. A commercial bacterial identification system (API/Biomerieux), was used for this purpose. The most common species was Escherichia coli (N=60), followed by Staphylococcus felis/simulans (40), S. hominis (16), S. haemolyticus (12), Streptococcus canis (9), Proteus mirabilis (8), Pasteurella multocida (7), Streptococcus mitis (7), Staphylococcus xylosus (7), S. capitis (6), S. chromogenes (4), S. sciuri (3), S. auricularis (2), S. lentus (2), S. hyicus (2), Streptococcus suis (2) and Pseudomonas argentinensis (2). Sixteen other isolates were identified to species level. A molecular method using 16S rRNA sequencing was used to confirm/identify 22 isolates. Salmonella or campylobacters were not isolated from rectal swabs. E. coli and S. felis/simulans together constituted 50% of isolates from vagina. S. felis/simulans was the most common species from culture positive ear and eye samples. P. multocida was isolated from 15% of mouth samples. Coagulase-negative staphylococci were the most common isolates from nose and wound swabs. Staphylococcus aureus, or S. intemedius/S. pseudintermedius were not isolated from any sample. Antimicrobial drug resistance was minimal, most isolates being susceptible to all drugs tested against, including tetracycline. Copyright © 2010 Elsevier Ltd. All rights reserved.

Aerobic salivary bacteria in wild and captive Komodo dragons.

Science.gov (United States)

Montgomery, Joel M; Gillespie, Don; Sastrawan, Putra; Fredeking, Terry M; Stewart, George L

2002-07-01

During the months of November 1996, August 1997, and March 1998, saliva and plasma samples were collected for isolation of aerobic bacteria from 26 wild and 13 captive Komodo dragons (Varanus komodoensis). Twenty-eight Gram-negative and 29 Gram-positive species of bacteria were isolated from the saliva of the 39 Komodo dragons. A greater number of wild than captive dragons were positive for both Gram-negative and Gram-positive bacteria. The average number of bacterial species within the saliva of wild dragons was 46% greater than for captive dragons. While Escherichia coli was the most common bacterium isolated from the saliva of wild dragons, this species was not present in captive dragons. The most common bacteria isolated from the saliva of captive dragons were Staphylococcus capitis and Staphylococcus capitis and Staphylococcus caseolyticus, neither of which were found in wild dragons. High mortality was seen among mice injected with saliva from wild dragons and the only bacterium isolated from the blood of dying mice was Pasteurella multocida. A competitive inhibition enzyme-linked immunosorbent assay revealed the presence of anti-Pasteurella antibody in the plasma of Komodo dragons. Four species of bacteria isolated from dragon saliva showed resistance to one or more of 16 antimicrobics tested. The wide variety of bacteria demonstrated in the saliva of the Komodo dragon in this study, at least one species of which was highly lethal in mice and 54 species of which are known pathogens, support the observation that wounds inflicted by this animal are often associated with sepsis and subsequent bacteremia in prey animals.

CARACTERIZACIÓN BROMATOLÓGICA Y MICROBIOLÓGICA DE CARNES PROCEDENTES DE ESPECIES DE ANIMALES REGIONALES DE LA AMAZONIA PERUANA PARA CONSUMO HUMANO

OpenAIRE

Lozano, Ronald; Pinedo, Weninger; Inga, Lylyams

2012-01-01

La investigación consistió en la caracterización bromatológica y determinación microbiológica de muestras de carnes procedentes de ocho especies de animales silvestres: huangana (Tayassu pecari), majaz o picuro (Agouti paca), sajino (Tayassu tajacu), venado colorado (Mazama americana), tapir (Tapirus terrestris), añuje (Dasyprota fuliginosa), ronsoco (Hydrochaeris hydrochaeris) y armadillo (Dasypus novemcinctus); en las localidades de Puerto Belén-Roya-Utucuro, Santa Rosa de Aguaytía, Santa L...

Tipos y producciones en las cerámicas de paredes finas procedentes del "municipium Augusta Bilbilis" (Huérmeda-Calatayud, Zaragoza)

OpenAIRE

Mínguez Morales, José Antonio

2002-01-01

El presente trabajo supone una aproximación a las cerámicas de "paredes finas" procedentes del municipium Auguata Bilbilis encontradas durante las excavaciones desarrolladas por el equipo de la Universidad de Zaragoza, dirigido por el Dr. Martín-Bueno, entre los años 1972 y 1996. Dicho conjunto aporta un arco cronológico que va desde el periodo tardorrepublicano, o comienzos del principado de Augusto, al siglo 1 d.C. Sus áreas de procedencia pueden agruparse en dos grandes bloques: la penínsu...

Virulencia de cepas de Listeria monocytogenes procedentes de cabras y sus derivados

Directory of Open Access Journals (Sweden)

Guicela Ramírez Bernal

2014-01-01

Full Text Available Se evaluó la virulencia de cepas de Listeria monocytogenes todas de serotipo 4b procedentes de cabras y sus derivados. Se observaron niveles de virulencia variables cuando se comparó la virulencia relativa (porcentaje de letalidad en ratones BALB/c inoculados vía intravenosa o intragástrica y su capacidad para infectar macrófagos J774A.1, y células epiteliales Caco-2. Dos cepas obtenidas de alimento de cabras produjeron 100 % de letalidad por ambas vías de inoculación y no mostraron diferencia significativa con la cepa testigo (P>0.05 respecto al porcentaje de invasión y a los parámetros de la cinética de crecimiento cuadrática observada en ambas líneas celulares. Si bien todas las cepas lograron invadir las células Caco-2, solamente algunas consiguieron invadir el bazo después de la inoculación por vía intragástrica. Las dos cepas provenientes de alimento de cabras fueron las más virulentas, representando un riesgo para la salud humana y animal, ya que pueden ser diseminadas en el hato y de este a otras explotaciones o a las instalaciones donde se elaboran alimentos.

Preliminary clinical pharmacological investigations of tylosin and tiamulin in chickens.

Science.gov (United States)

Ziv, G

1980-10-15

The minimal inhibitory concentrations (MIC) of tiamulin and tylosin for mycoplasma, Gram-positive, and Gram-negative micro-organisms isolated from chickens were determinated by the agar dilution method. Median MIC values for tiamulin against Mycoplasma gallisepticum (0.05 microgram/ml) and Mycoplasma synoviae (0.10 microgram/ml) were 2 to 4 times lower than the corresponding values for tylosin. Tiamulin was also slightly more effective in vitro in inhibiting Escherichia coli, Pasteurella multocida, and beta-haemolytic streptococci than was tylosin. Groups of chicken were offered tiamulin medicated drinking water at rates of 125 and 250 mg/litre for 48 hours. Average serum tiamulin concentrations were 0.38 and 0.78 microgram/ml, respectively. When tylosin tartrate was added to the drinking water at 500 and 700 mg/litre, average serum drug levels were 0.12 and 0.17 microgram/ml, respectively. Tiamulin was 45% bound in chicken serum, as against 30% serum protein binding for tylosin. Correlations were made between free (non protein bound) serum drug levels and the MIC values of the two drugs. Such comparisons suggest that when tiamulin is given in the drinking water at rates of 125 to 250 mg/litre, better antimycoplasmal activity is to be expected in vivo than by giving tylosin tartrate in the drinking water at 500 to 700 mg/litre. Based on these data, no clinical efficacy of these dose rates can be expected in flocks infected by gram-negative micro-organisms such as E. coli or P. multocida. The tylosin tartrate rate of 500 to 700 mg/litre, may be clinical ineffective the treatment of Staphylococcus aureus infections.

Dose dependency of outcomes of intrapleural fibrinolytic therapy in new rabbit empyema models

Science.gov (United States)

Florova, Galina; Azghani, Ali O.; Buchanan, Ann; Boren, Jake; Allen, Timothy; Rahman, Najib M.; Koenig, Kathleen; Chamiso, Mignote; Karandashova, Sophia; Henry, James; Idell, Steven

2016-01-01

The incidence of empyema (EMP) is increasing worldwide; EMP generally occurs with pleural loculation and impaired drainage is often treated with intrapleural fibrinolytic therapy (IPFT) or surgery. A number of IPFT options are used clinically with empiric dosing and variable outcomes in adults. To evaluate mechanisms governing intrapleural fibrinolysis and disease outcomes, models of Pasteurella multocida and Streptococcus pneumoniae were generated in rabbits and the animals were treated with either human tissue (tPA) plasminogen activator or prourokinase (scuPA). Rabbit EMP was characterized by the development of pleural adhesions detectable by chest ultrasonography and fibrinous coating of the pleura. Similar to human EMP, rabbits with EMP accumulated sizable, 20- to 40-ml fibrinopurulent pleural effusions associated with extensive intrapleural organization, significantly increased pleural thickness, suppression of fibrinolytic and plasminogen-activating activities, and accumulation of high levels of plasminogen activator inhibitor 1, plasminogen, and extracellular DNA. IPFT with tPA (0.145 mg/kg) or scuPA (0.5 mg/kg) was ineffective in rabbit EMP (n = 9 and 3 for P. multocida and S. pneumoniae, respectively); 2 mg/kg tPA or scuPA IPFT (n = 5) effectively cleared S. pneumoniae-induced EMP collections in 24 h with no bleeding observed. Although intrapleural fibrinolytic activity for up to 40 min after IPFT was similar for effective and ineffective doses of fibrinolysin, it was lower for tPA than for scuPA treatments. These results demonstrate similarities between rabbit and human EMP, the importance of pleural fluid PAI-1 activity, and levels of plasminogen in the regulation of intrapleural fibrinolysis and illustrate the dose dependency of IPFT outcomes in EMP. PMID:27343192

Ceftiofur sodium, a broad-spectrum cephalosporin: evaluation in vitro and in vivo in mice.

Science.gov (United States)

Yancey, R J; Kinney, M L; Roberts, B J; Goodenough, K R; Hamel, J C; Ford, C W

1987-07-01

Ceftiofur sodium, a broad-spectrum beta-lactamase-resistant cephalosporin, was evaluated in vitro and in vivo in mice. Ceftiofur is the sodium salt of (6R, 7R)-7[( 2-amino-4-thiazolyl)-Z- (methoxyimino)acetyl]amino)-3-[( (2-furanylcarbonyl)thio]methyl)-8-oxo-5- thia-1-azabicyclo-[4.2.0]oct-2-ene-2-carboxylate. Minimal inhibitory concentration values were obtained with 264 strains representing 9 genera and 17 species of bacterial pathogens from cattle, swine, sheep, horses, poultry, dogs, cats, and human beings. Ceftiofur was more active than was ampicillin against all strains tested including beta-lactamase-producing organisms. In mice with systemic infections, ceftiofur was more active than or equivalent to ampicillin, cephalothin, cefamandole, cloxacillin, cefoperazone, or pirlimycin. These protection tests included infections with Escherichia coli, Haemophilus pleuropneumoniae, H somnus, Pasteurella haemolytica, P multocida, Salmonella typhimurium, or Staphylococcus aureus. In infant mice with E coli-induced lethal diarrhea and in mice with S aureus and E coli-induced mastitis, ceftiofur was comparable or more active than was ampicillin.

Granzyme A Produces Bioactive IL-1β through a Nonapoptotic Inflammasome-Independent Pathway

Directory of Open Access Journals (Sweden)

Dagmar Hildebrand

2014-11-01

Full Text Available Bacterial components are recognized by the immune system through activation of the inflammasome, eventually causing processing of the proinflammatory cytokine interleukin-1β (IL-1β, a pleiotropic cytokine and one of the most important mediators of inflammation, through the protease caspase-1. Synthesis of the precursor protein and processing into its bioactive form are tightly regulated, given that disturbed control of IL-1β release can cause severe autoinflammatory diseases or contribute to cancer development. We show that the bacterial Pasteurella multocida toxin (PMT triggers Il1b gene transcription in macrophages independently of Toll-like receptor signaling through RhoA/Rho-kinase-mediated NF-κΒ activation. Furthermore, PMT mediates signal transducer and activator of transcription (STAT protein-controlled granzyme A (a serine protease expression in macrophages. The exocytosed granzyme A enters target cells and mediates IL-1β maturation independently of caspase-1 and without inducing cytotoxicity. These findings show that macrophages can induce an IL-1β-initiated immune response independently of inflammasome activity.

Un vaso de alabastro procedente de Adra conservado en el Museo de Almería

Directory of Open Access Journals (Sweden)

García Alfonso, Eduardo

1998-12-01

Full Text Available A previously unpublished alabaster jar from Adra, a coastal site some 50 km to the west of Almería is yet another example of a numerous class of Egyptian containers of the 8th-7th centuries BC discovered on the southern coast of the Iberian Peninsula. A casual find, the funerary character of this piece suggests that there may have been a cemetery of the Early Phoenician Period in the immediate neighbourhood of the colonial settlement of Abdera.Se estudia un vaso de alabastro inédito procedente de la localidad almeriense de Adra, pieza que se añade a la ya numerosa serie de recipientes de origen egipcio conocida en las costas meridionales de la Península durante los siglos VIII-VII a.C. El principal interés de este hallazgo casual radica en su carácter funerario, siendo indicio de una posible necrópolis de época fenicia arcaica en las inmediaciones del asentamiento colonial de Abdera.

Procedimiento de obtención de materailes multifuncionales y renovables a partir del rechazo de pipa procedente de la producción de aceite de girasol

OpenAIRE

Martín-Luengo, María Ángeles; Yates Buxcey, Malcolm; Ramos, M.; Sáez Rojo, Eduardo; González Gil, Lorena; Martínez Serrano, Ana María; Martín-Aranda, Rosa María; Sanz Lázaro, Jesús

2011-01-01

Procedimiento de obtención de materiales multifuncionales y renovables a partir del rechazo de pipa procedente de la producción de aceite de girasol. La presente invención se refiere al procedimiento de obtención de materiales renovables, a partir de residuos precedentes de la fabricación de aceite de girasol, para su uso como matrices biocompatibles en ingeniería de tejidos, administración controlada de sustancias de interés biológico (drogas, proteínas, genes, etc...

Aplicación de nuevas tecnologías para el diseño y desarrollo de productos de dorada (Sparus aurata) procedente de acuicultura

OpenAIRE

Andrés Bello, María Desamparados

2012-01-01

La acuicultura en su conjunto produce hoy en día más de la mitad del pescado consumido en el mundo. El objetivo de la presente tesis doctoral es estudiar la aplicación de diferentes tecnologías para incrementar y diversificar productos procedentes de acuicultura. Concretamente se han analizado las tecnologías de cocción y fritura a vacío, biopreservación y elaboración de texturizados a partir de dorada (Sparus aurata). Para ello en tres capítulos se aborda el estudio de estas tecnologías par...

Características mecánicas de hormigones con áridos reciclados procedentes de los rechazos en prefabricación

Directory of Open Access Journals (Sweden)

Pérez-Benedicto, J. A.

2012-03-01

Full Text Available The need to diminish the final amount of waste produced in construction and demolition processes in plants of concrete prefabricated products, has made us analyze the mechanical behaviour of concrete made with recycled aggregate coming from discarded concrete prefabricated units. The aim was to find a possible use for this recycled aggregate in different proportions in reinforced concrete and prestressed concrete, for prefabricated elements. Two situations using recycled aggregate have been studied: one of them, in natural state and subject to pre-saturation with selfcompacting H40 and H50 concrete, using as the only variable the substitution of the 4/12mm coarse aggregate in the following percentages: 0%, 20%, 50% and 100%. The results of the tests performed indicate that concretes with recycled aggregate coming from discarded prefabricated units can offer an excellent quality as structural concrete for future uses.

La necesidad de disminuir la cantidad final de residuos de construcción y demolición que se producen en las plantas de prefabricados de hormigón, nos ha llevado a analizar el comportamiento mecánico de un hormigón elaborado con áridos reciclados procedentes de piezas prefabricadas de hormigón, con la finalidad de un posible futuro uso como árido en dosificaciones de hormigón armado y pretensado para piezas prefabricadas. Se ha trabajado con áridos reciclados en dos situaciones: estado natural y sometidos a presaturación, con hormigones H40 y H50 autocompactantes, tomando como única variable la sustitución de fracción gruesa del árido 4/12mm. con los siguientes porcentajes, 0%, 20%, 50% y 100%. Los resultados de los ensayos realizados indican que hormigones elaborados con áridos reciclados procedentes de elementos prefabricados pueden presentar una excelente calidad como hormigón estructural para su futuro uso como autoconsumo.

Un lote de armamento ibérico procedente de la necrópolis del Mas de Barberán (Nogueruelas, Teruel

Directory of Open Access Journals (Sweden)

Izquierdo Peraile, Isabel

1999-12-01

Full Text Available In this paper we publish an Ibenan set of weapons -swords, lances and dagger essentially-, coming from the cemetery of the settlement so-called Mas de Barberán (Nogueruelas, Teruel. An anthropomorphic stele with an inscription recently studied is associated to the same site. This stele represents an armed with disk-cuirass masculine personage.

En este trabajo presentamos un lote inédito de armamento ibérico espadas, lanzas y puñal esencialmente procedente de la necrópolis correspondiente al poblado del Mas de Barberán (Nogueruelas, Teruel. Al mismo yacimiento se asocia la estela antropomorfa con inscripción que representa un personaje masculino armado con disco-coraza, recientemente estudiada.

Comparative investigation on the efficacy of tulathromycin and florfenicol in the treatment of bronchopneumonia in feedlot calves

Directory of Open Access Journals (Sweden)

Jezdimirović Milanka

2011-01-01

Full Text Available The clinical efficacy of tulathromycin (TU and florfenicol (FL in the treatment of bronchopneumonia (BP caused by Pasteurella multocida which was isolated from nose swabs of diseased calves has been examined. The symptoms of bronchopneumonia (BP were quantified by means of the clinical score (CS with a maximum of 47 points. In the current investigation the average CS in diseased calves was 23.5± 0.15. The clinical efficacy of TU and FL was assessed every day in the first week after the administration of the drugs and was based on the decrease in CS and on microbiological findings on days 7, 28 and 35 after the completion of therapy. Tulathromycin was administered s.c., in the prescribed therapeutic dose (2.5 mg/kg BW, and florfenicol s.c., twice at a 48 h interval, in its respective therapeutic dose (40 mg/kg BW. In spite of the repeated administration of FL, TU was significantly more rapid to decrease the major clinical symptoms in the first four days following the application, in comparison with FL (P<0.05. On the fourth day after the administration, the clinical efficacy of TU in the therapy of BP in calves was 43.4±1.5 %, and of florfenicol 27.2±1.6 %. However, five days after the application of TU and two days after the repeated application of FL the assessed clinical efficacy of the two antibiotics was roughly the same. The average efficacy of TU was 57.1±0.0%, and of florfenicol 58.5±0.0%, both the individual and mean CS in the treated calves was 10 points, due to hyperthermia, which remained the only symptom. Six days after the administration of TU and three days after the repeated application of FL both antibiotics had equal maximum efficacy (100% in the treatment of BP. The clinical efficacy remained unchanged on day seven. The recovery was confirmed by the absence of P. multocida in nose swabs sampled on the seventh day after the initial treatment. However, in 4 calves (21.05 % of the 19 treated Streptococcus alpha haemolyticus

Sepsis procedente de la comunidad en cuidados intensivos: Factores de riesgo

Directory of Open Access Journals (Sweden)

Pilar Legón Blasco

2000-03-01

Full Text Available Se realizó un estudio prospectivo y transversal en pacientes sépticos ingresados en la Unidad de Cuidados Intensivos del hospital "Dr. Ángel Arturo Aballí" con los criterios de sepsis procedente de la comunidad en un período de 18 meses, comprendido desde septiembre de 1996 hasta marzo de 1998, con el objetivo de analizar la frecuencia de factores de riesgo asociados con la infección. Se evaluaron 70 pacientes que cumplían los criterios antes mencionados. Se tomó en la comunidad un grupo control de niños sanos. En los resultados se encontró que los factores asociados con la sepsis fueron: el sexo masculino (p=0,002, RR=2,7, la no lactancia materna (p=0,01, RR=3,3, la malnutrición por defecto (p=0,04, RR=2,1, el hacinamiento (p=0,0008, RR=2,4, el hábito de fumar (p=0,02, RR=2,4 y la mala higiene (p=0,01, RR=1,5.A prospective and crossover study was carried out in patients admitted in Intensive Care Unit (ICU of "Dr. Angel Arturo Aballí" Hospital where criteria of sepsis came from community for a period of 18 months, September 1996 to March 1998, to analyze frequency of risk factors associated with infection. We assessed 70 patients who fulfiled criteria above mentioned. Healthy children were control group. By findings, we found that factors associated with sepsis included: male sex (p=0.002, RR=2.7, non-breast feeding (p=0.01, RR=3.3, malnutrition by defect (p=0.04, RR=2.1, crowding (p=0.0008, RR= 2.4, smoking (p=0.02, RR=2.4, and a poor hygiene (p=0.01, RR=1.5.

Immunomodulatory activity of methanolic extract of Morus alba Linn. (mulberry) leaves.

Science.gov (United States)

Bharani, Shendige Eswara Rao; Asad, Mohammed; Dhamanigi, Sunil Samson; Chandrakala, Gowda Kallenahalli

2010-01-01

The leaves of Morus alba Linn. (Family: Moraceae) commonly known as mulberry are mainly used as food for the silkworms and they are sometimes eaten as vegetable or used as cattle fodder in different parts of the world. The effect of Morus alba on the immune system was evaluated by using different experimental models such as carbon clearance test, cyclophosphamide induced neutropenia, neutrophil adhesion test, effect on serum immunoglobulins, mice lethality test and indirect haemagglutination test. Methanolic extract of Morus alba was administered orally at low dose and high dose of 100 mg/kg and 1 g/kg respectively and Ocimum sanctum (100 mg/kg, po) was used as standard drug. Morus alba extract in both doses increased the levels of serum immunoglobulins and prevented the mortality induced by bovine Pasteurella multocida in mice. It also increased the circulating antibody titre in indirect haemagglutination test. On the other hand, it showed significant increase in the phagocytic index in carbon clearance assay, a significant protection against cyclophosphamide induced neutropenia and increased the adhesion of neutrophils in the neutrophil adhesion test. Hence, it was concluded that Morus alba increases both humoral immunity and cell mediated immunity.

How Respiratory Pathogens Contribute to Lamb Mortality in a Poorly Performing Bighorn Sheep ( Ovis canadensis ) Herd.

Science.gov (United States)

Wood, Mary E; Fox, Karen A; Jennings-Gaines, Jessica; Killion, Halcyon J; Amundson, Sierra; Miller, Michael W; Edwards, William H

2017-01-01

We evaluated bighorn sheep ( Ovis canadensis ) ewes and their lambs in captivity to examine the sources and roles of respiratory pathogens causing lamb mortality in a poorly performing herd. After seven consecutive years of observed December recruitments of sheep from the remnant Gribbles Park herd in Colorado, US were captured and transported to the Thorne-Williams Wildlife Research Center in Wyoming in March 2013. Ewes were sampled repeatedly over 16 mo. In April 2014, ewes were separated into individual pens prior to lambing. Upon death, lambs were necropsied and tested for respiratory pathogens. Six lambs developed clinical respiratory disease and one lamb was abandoned. Pathology from an additional six lambs born in 2013 was also evaluated. Mycoplasma ovipneumoniae , leukotoxigenic Mannheimia spp., leukotoxigenic Bibersteinia trehalosi , and Pasteurella multocida all contributed to lamb pneumonia. Histopathology suggested a continuum of disease, with lesions typical of pasteurellosis predominating in younger lambs and lesions typical of mycoplasmosis predominating in older lambs. Mixed pathology was observed in lambs dying between these timeframes. We suspected that all the ewes in our study were persistently infected and chronically shedding the bacteria that contributed to summer lamb mortality.

Detecção do vírus Epstein-Barr (EBV) em adenocarcinomas gástricos procedentes dos estados do Ceará e de São Paulo

OpenAIRE

Lima,Marcos Antonio Pereira de; Ferreira,Márcia Valéria Pitombeira; Barros,Marcos Aurélio Pessoa; Pardini,Maria Inês de Moura Campos; Ferrasi,Adriana Camargo; Rabenhorst,Silvia Helena Barem

2011-01-01

INTRODUÇÃO: O vírus Epstein-Barr (EBV) está associado a cerca de 10% dos adenocarcinomas gástricos, representando mais de 50 mil casos por ano no mundo. Apesar dos estudos realizados em várias partes do mundo, alguns aspectos clinicopatológicos permanecem controversos. OBJETIVOS: O presente estudo teve como objetivo analisar as características clinicopatológicas de casos de adenocarcinomas gástricos procedentes dos estados de São Paulo e Ceará, correlacionando-os com a detecção de EBV. MATERI...

Modulation of pulmonary defense mechanisms by acute exposures to nitrogen dioxide. [Staphylococcus aureus; Proteus mirabilis; Pasteurella pneumotropica

Energy Technology Data Exchange (ETDEWEB)

Jakab, G.J.

1987-02-01

The effect of acute exposures to NO/sub 2/ on the antibacterial defenses of the murine lung was assessed following inhalation challenges with Staphylococcus aureus, Proteus mirabilis, and Pasteurella pneumotropica. With S. aureus pulmonary antibacterial defenses were suppressed at NO/sub 2/ levels of 4.0 ppm and greater. Exposure to 10.0 ppm enhanced the intrapulmonary killing of P. mirabilis which correlated with an increase in the phagocytic cell populations lavaged from the lungs; at 20.0 ppm bactericidal activity against P. mirabilis was impaired. Pulmonary antibacterial defenses against P. pneumotropica were impaired at 10.0 ppm which correlated with a decrease in the retrieved phagocytic lung cell population. Reversing the order of treatment (ie., NO/sub 2/ exposure prior to bacterial challenge) raised the threshold concentration for NO/sub 2/-induced impairment of intrapulmonary bacterial killing. With S. aureus the effect was not observed at 5.0 ppm but at 10.0 ppm and with P. mirabilis not at 20.0 ppm but at 30.0 ppm intrapulmonary killing was enhanced. Exposures up to 20.0 ppm of NO/sub 2/ did not effect the physical translocation mechanisms of the lung as quantitated by declines in pulmonary radiotracer activity following aerogenic challenge with /sup 32/P-labeled staphylococci.

Comportamiento de la sepsis procedente de la comunidad en la edad pediátrica

Directory of Open Access Journals (Sweden)

Beatriz Santos Lorenzo

2015-11-01

Full Text Available Se realizó un estudio descriptivo de corte transversal en el Hospital Pediátrico "Mártires de Las Tunas", que incluyó pacientes con diagnóstico de sepsis de la comunidad ingresados en la Unidad de Cuidados Intensivos, durante el período comprendido entre enero de 2009 y diciembre de 2011. Los objetivos del estudio fueron: caracterizar según la edad, lactancia materna, estado nutricional, foco infeccioso y forma clínica de presentación. El universo lo constituyeron los 259 pacientes ingresados con sepsis y la muestra los 109 procedentes de la comunidad. Los datos fueron obtenidos de historias clínicas, almacenados en base de datos Excel, procesados con cálculos totales - porcientos. El resultado fue que el 61% eran menores de un año, seguidos por el grupo de uno a cuatro años (22%; el 65% tenían la lactancia mixta; el 44% eran normopesos y el 37% estaban desnutridos; referido al foco de infección, en el 66% fueron los pulmones; 52% presentaron forma clínica de sepsis en fase inicial. Se concluyó que la sepsis predominó en las primeras edades (menores de cuatro años, en el sexo masculino, en menores que tenían lactancia mixta, normopesos y desnutridos. El foco pulmonar fue el más frecuente y el mayor porciento ingresó en fases iniciales de sepsis.

The role of lipooligosaccharide phosphorylcholine in colonization and pathogenesis of Histophilus somni in cattle

Directory of Open Access Journals (Sweden)

Elswaifi Shaadi F

2012-06-01

Full Text Available Abstract Histophilus somni is a Gram-negative bacterium and member of the Pasteurellaceae that is responsible for respiratory disease and other systemic infections in cattle. One of the bacterium’s virulence factors is antigenic phase variation of its lipooligosaccharide (LOS. LOS antigenic variation may occur through variation in composition or structure of glycoses or their substitutions, such as phosphorylcholine (ChoP. However, the role of ChoP in the pathogenesis of H. somni disease has not been established. In Haemophilus influenzae ChoP on the LOS binds to platelet activating factor on epithelial cells, promoting bacterial colonization of the host upper respiratory tract. However, ChoP is not expressed in the blood as it also binds C-reactive protein, resulting in complement activation and killing of the bacteria. In order to simulate the susceptibility of calves with suppressed immunity due to stress or previous infection, calves were challenged with bovine herpes virus-1 or dexamethazone 3 days prior to challenge with H. somni. Following challenge, expression of ChoP on the LOS of 2 different H. somni strains was associated with colonization of the upper respiratory tract. In contrast, lack of ChoP expression was associated with bacteria recovered from systemic sites. Histopathology of cardiac tissue from myocarditis revealed lesions containing bacterial clusters that appeared similar to a biofilm. Furthermore, some respiratory cultures contained substantial numbers of Pasteurella multocida, which were not present on preculture screens. Subsequent biofilm experiments have shown that H. somni and P. multocida grow equally well together in a biofilm, suggesting a commensal relationship may exist between the two species. Our results also showed that ChoP contributed to, but was not required for, adhesion to respiratory epithelial cells. In conclusion, expression of ChoP on H. somni LOS contributed to colonization of the bacteria to the

Potential probiotic attributes of a new strain of Bacillus coagulans CGMCC 9951 isolated from healthy piglet feces.

Science.gov (United States)

Gu, Shao-Bin; Zhao, Li-Na; Wu, Ying; Li, Shi-Chang; Sun, Jian-Rui; Huang, Jing-Fang; Li, Dan-Dan

2015-06-01

A new strain of Bacillus coagulans CGMCC 9551, which has a broad range of antibacterial activities against six main pathogenic bacteria including Escherichia coli O8, Staphylococcus aureus, Salmonella enterica subsp. enterica serovar enteritidis, Streptococcus suis, Listeria monocytogenes and Pasteurella multocida, was isolated from healthy piglet feces. In adhesion assay, the isolate exhibited a stronger adhesion to pig intestinal mucus than that of B. subtilis JT143 and L. acidophilus LY24 respectively isolated from BioPlus(®)2B and FloraFIT(®) Probiotics (P coagulans CGMCC 9551 was reduced by only 20% at 4 h exposure under 0.9% w/v bile salt. The strain was fully resistant to pH 2 for 2 h with 90.1 ± 3.5% survival and susceptible to 15 antibiotics commonly used in veterinary medicine. Additionally, the bacteria showed amylase, protease and cellulase activities. The safety assessment demonstrated the lack of toxicity potential in B. coagulans CGMCC 9551 by ligated rabbit ileal loop assay, acute and subchronic toxicity test. These results implied that that the new strain of B. coagulans CGMCC 9951 isolated from healthy piglet feces has promising probiotic characteristics and offers desirable opportunities for its successful commercialization as one excellent candidate probiotic.

Whole Genome Sequence Analysis of Pig Respiratory Bacterial Pathogens with Elevated Minimum Inhibitory Concentrations for Macrolides.

Science.gov (United States)

Dayao, Denise Ann Estarez; Seddon, Jennifer M; Gibson, Justine S; Blackall, Patrick J; Turni, Conny

2016-10-01

Macrolides are often used to treat and control bacterial pathogens causing respiratory disease in pigs. This study analyzed the whole genome sequences of one clinical isolate of Actinobacillus pleuropneumoniae, Haemophilus parasuis, Pasteurella multocida, and Bordetella bronchiseptica, all isolated from Australian pigs to identify the mechanism underlying the elevated minimum inhibitory concentrations (MICs) for erythromycin, tilmicosin, or tulathromycin. The H. parasuis assembled genome had a nucleotide transition at position 2059 (A to G) in the six copies of the 23S rRNA gene. This mutation has previously been associated with macrolide resistance but this is the first reported mechanism associated with elevated macrolide MICs in H. parasuis. There was no known macrolide resistance mechanism identified in the other three bacterial genomes. However, strA and sul2, aminoglycoside and sulfonamide resistance genes, respectively, were detected in one contiguous sequence (contig 1) of A. pleuropneumoniae assembled genome. This contig was identical to plasmids previously identified in Pasteurellaceae. This study has provided one possible explanation of elevated MICs to macrolides in H. parasuis. Further studies are necessary to clarify the mechanism causing the unexplained macrolide resistance in other Australian pig respiratory pathogens including the role of efflux systems, which were detected in all analyzed genomes.

Occurrence and severity of lung lesions in slaughter pigs vaccinated against Mycoplasma hyopneumoniae with different strategies.

Science.gov (United States)

Hillen, Sonja; von Berg, Stephan; Köhler, Kernt; Reinacher, Manfred; Willems, Hermann; Reiner, Gerald

2014-03-01

Different vaccination strategies against Mycoplasma hyopneumoniae have been adopted worldwide. Reports from the field indicate varying levels of protection among currently available vaccines. The goal of the present study was to compare the efficacies of three widespread commercial vaccination strategies against M. hyopneumoniae under field conditions. 20 farms were included. 14 farms used different single dose vaccines (vaccine 1 [V1], 8 herds; vaccine 2 [V2], 6 herds); another 6 farms (V3) used a two dose vaccination strategy. Gross lesions of 854 lungs and histopathology from 140 lungs were quantified, and a quantitative PCR was applied to detect M. hyopneumoniae and porcine circovirus 2 (PCV2) DNA in lung tissue (n=140). In addition, porcine reproductive and respiratory disease virus (PRRSV), swine influenza virus (SIV), Actinobacillus pleuropneumoniae, Haemophilus parasuis and Pasteurella multocida were tested by qualitative PCR. 53% of lungs were positive for M. hyopneumoniae. 55.9% of lungs showed macroscopic enzootic pneumonia (EP)-like lesions. Lung lesion scores (Phyopneumoniae-loads (Phyopneumoniae indicating that the applied diagnostic tools are valuable in confirming the prevalence and severity of M. hyopneumoniae infections. Comparing different vaccination strategies against M. hyopneumoniae indicates varying levels of protection. M. hyopneumoniae is still a major problem despite the widely applied vaccination. Copyright © 2014 Elsevier B.V. All rights reserved.

Creación de material didáctico para nivel A2 de ELE, a partir de conversaciones procedentes del Corpus Corinéi (Corpus oral de interlengua español/italiano)

OpenAIRE

Martín Sánchez, M. Teresa; Pascual Escagedo, Consuelo; Rodríguez, María Paz

2017-01-01

En el presente trabajo proponemos la utilización de material auténtico procedente de las conversaciones del corpus CORINÉI, que parte de un trabajo colaborativo cuyo objetivo es la interacción entre un hablante nativo y un hablante no nativo dentro del ámbito universitario. El objetivo se enfocará hacia la creación de materiales que ayuden al discente a reflexionar y consolidar la propia competencia interactiva, de manera que afiance la capacidad conversacional, tanto fuera como dentro del au...

Pasteurella pneumotropica evades the human complement system by acquisition of the complement regulators factor H and C4BP.

Directory of Open Access Journals (Sweden)

Alfredo Sahagún-Ruiz

Full Text Available Pasteurella pneumotropica is an opportunist Gram negative bacterium responsible for rodent pasteurellosis that affects upper respiratory, reproductive and digestive tracts of mammals. In animal care facilities the presence of P. pneumotropica causes severe to lethal infection in immunodeficient mice, being also a potential source for human contamination. Indeed, occupational exposure is one of the main causes of human infection by P. pneumotropica. The clinical presentation of the disease includes subcutaneous abscesses, respiratory tract colonization and systemic infections. Given the ability of P. pneumotropica to fully disseminate in the organism, it is quite relevant to study the role of the complement system to control the infection as well as the possible evasion mechanisms involved in bacterial survival. Here, we show for the first time that P. pneumotropica is able to survive the bactericidal activity of the human complement system. We observed that host regulatory complement C4BP and Factor H bind to the surface of P. pneumotropica, controlling the activation pathways regulating the formation and maintenance of C3-convertases. These results show that P. pneumotropica has evolved mechanisms to evade the human complement system that may increase the efficiency by which this pathogen is able to gain access to and colonize inner tissues where it may cause severe infections.

A Pasteurella multocida sialyltransferase displaying dual trans-sialidase activities for production of 3′-sialyl and 6′-sialyl glycans

DEFF Research Database (Denmark)

Guo, Yao; Jers, Carsten; Meyer, Anne S.

2014-01-01

/Kmvalue for the enzyme using 3-sialyllactose as the donor for 6-sialyllactose synthesis at pH 5.4 and 40◦Cwas determined to be 23.22 ± 0.7 M−1s−1. Moreover, the enzyme was capable of catalyzing the synthesisof both 3- and 6-sialylated galactooligosaccharides, when galactooligosaccharides served as acceptors....

Susceptibility of Rocky Mountain bighorn sheep and domestic sheep to pneumonia induced by bighorn and domestic livestock strains of Pasteurella haemolytica.

Science.gov (United States)

Onderka, D K; Rawluk, S A; Wishart, W D

1988-10-01

Bighorn sheep were inoculated intratracheally with suspensions of nonhemolytic Pasteurella haemolytica biotype T (10(12) organisms) unique to wild bighorns, with beta-hemolytic P. haemolytica biotype T (10(12) organisms) isolated from clinically normal domestic sheep or intradermally with half a dose of a cattle vaccine containing P. haemolytica biotype A (10(5) organisms). The bighorn strain caused lobar necrotizing bronchopneumonia whereas both domestic livestock strains precipitated fatal septicemia and fibrinous bronchopneumonia. The serotypes given were T3, T4, T15 and A1 and these were recovered from lung lesions and other organs. In three trials, domestic sheep were inoculated intratracheally with suspensions of bighorn sheep pneumonic lungs, and two concentrations of the P. haemolytica bighorn strain (10(4) and 10(12) organisms). One of these sheep was inoculated intrabronchially. The domestic sheep experienced a transient fever and elevated white blood cell counts. After six days, none of the sheep had lung lesions and inoculated organisms could not be recovered. It is suggested that bighorn sheep are very susceptible to P. haemolytica from domestic livestock and should not be allowed in contact with sheep or cattle.

Conjunto metálico con puntas de jabalina procedentes del yacimiento de La Pestaña (Badajoz

Directory of Open Access Journals (Sweden)

Enríquez Navascués, Juan Javier

2013-12-01

Full Text Available This paper presents an unpublished photograph whith metal pieces from La Pestaña (Badajoz, where two Pastora-type javelins stand out. The photo comes from the archive of Aurelio Cabrera (1870-1936, sculptor and archaeologist. Six of the pieces have been located in the Badajoz Provincial Archaeological Museum, three of which have elemental anaylises. The other six pieces are missing, including the Pastora-type javelins among them. The photograph attests to their existence and origin strengthens the southwestern distribution of this type of javelin point.Se amplía la corta serie de puntas tipo Pastora hasta ahora conocidas en la Península Ibérica, gracias a la localización de una fotografía inédita del archivo del escultor y arqueólogo Aurelio Cabrera Gallardo (1870-1936. La fotografía muestra 12 piezas metálicas procedentes de la Dehesa de la Pestaña, en la finca Los Fresnos (Badajoz. Seis de ellas han sido localizadas en el Museo Arqueológico Provincial de Badajoz y tres cuentan con análisis elemental. Otras seis, entre las que están las puntas, están desaparecidas. La fotografía testimonia su existencia y una procedencia que refuerza la distribución suroccidental de este tipo de puntas de jabalina.

Susceptibility of Dall sheep (Ovis dalli dalli) to pneumonia caused by Pasteurella haemolytica.

Science.gov (United States)

Foreyt, W J; Silflow, R M; Lagerquist, J E

1996-10-01

We evaluated susceptibility of Dall sheep (Ovis dalli dalli) to bacterial pneumonia induced by two strains of Pasteurella haemolytica of domestic sheep origin by evaluating the sensitivity of blood neutrophils of eight Dall sheep to lysis by cytotoxins of P. haemolytica, and by intratracheal inoculation of three Dall sheep, two bighorn sheep (Ovis canadensis), and two domestic sheep with 3.7 x 10(6) or 2.5 x 10(7) colony forming units of P. haemolytica. Neutrophils from the Dall sheep were more sensitive to lysis by cytotoxins from supernatants of a P. haemolytica, biotype A, serotype 2 (A2), of domestic sheep origin, than were neutrophils from six bighorn sheep. This cytotoxic bacterium was the same isolate that was used for intratracheal inoculation of two Dall sheep and two domestic sheep. Inoculation of this cytotoxic P. haemolytica A2 resulted in fatal fibrinopurulent pleuropneumonia in the first Dall sheep within 24 hr of inoculation, and pneumonic lesions in the second Dall sheep before it was euthanized 52 hr after inoculation. This strain of P. haemolytica A2 did not cause respiratory disease when inoculated into two domestic sheep. A noncytotoxic strain of P. haemolytica; biotype T, serotype 3,4,10 of domestic sheep origin did not result in pneumonia in the third Dall sheep or two bighorn sheep. Prior to inoculation, P. haemolytica, biotype T isolates were obtained from all three Dall sheep, but none of these isolates was cytotoxic. At necropsy, cytotoxic P. haemolytica A2 was isolated from lungs and other tissues of the two pneumonic Dall sheep. Based on these results, we conclude that Dall sheep appear to be at least as sensitive as bighorn sheep to pneumonia caused by P. haemolytica A2 of domestic sheep origin. Because in vitro and in vivo results appear closely correlated in this and other studies, we believe with additional evaluation and standardization, neutrophil cytotoxicity tests may serve as a substitute for live animal challenges in future

The importance of subcutaneous abscess infection by Pasteurella spp. and Staphylococcus aureus as a cause of meat condemnation in slaughtered commercial rabbits

Directory of Open Access Journals (Sweden)

A. Ferreira

2014-12-01

Full Text Available Subcutaneous abscesses are lesions frequently reported in commercial rabbits. Both at farm and slaughterhouse level, these lesions are responsible for economic losses and a potential decrease in meat quality. The present study was devised to identify the main causes of meat condemnation in slaughtered commercial rabbits and assess the importance of abscess lesions in this domain. For these purposes, 281423 rabbits were evaluated during meat inspection at the slaughterhouse. The results achieved showed that subcutaneous abscesses were the major cause of condemnation, being responsible for the rejection of 1355 (0.48% rabbit carcasses. The main affected area was the hind limbs (31.37%, followed by the cervical area (23.10%. Microbiological analyses of 27 abscess samples indicated Pasteurella spp. as the bacteria mostly isolated (59.3%, followed by Staphylococcus aureus (25.9%. These results enable us to advise the industry on the significance of abscesses as an important cause of economic losses, due to meat condemnation during post mortem inspection, and highlight the importance of implementing monitoring plans as a way to control this pathological problem.

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available multocida ... subsp. multocida str. Pm70] ... Length = 108 ... Query: 2 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAH...WEVIYFVRAFYQEYKTSP 61 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAH...WEVIYFVRAFYQEYKTSP Sbjct: 1 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAHWEVIYFVRAFYQEYKTSP 60 ...

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available multocida ... subsp. multocida str. Pm70] ... Length = 159 ... Query: 2 ... TTNRQEVLQNRLGPEIQELKAQ...CKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 61 ... TTNRQEVLQNRLGPEIQELKAQCKTVML...ATVGEDGNPNVSYAPFAINNGEYQVFISTIAR Sbjct: 1 ... TTNRQEVLQNRLGPEIQELKAQCKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 60

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available eurella multocida subsp. multocida str. Pm70] ... Length = 97 ... Query: 3 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDS...ENPGEAGFTGSTV 62 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDS...ENPGEAGFTGSTV Sbjct: 1 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDSENPGEAGFTGSTV 60 ...

Chronic intestinal pseudo-obstruction associated with enteric ganglionitis in a Persian cat

Directory of Open Access Journals (Sweden)

Jeremy Mortier

2016-06-01

Full Text Available Case summary A 7-year-old neutered male Persian cat was presented for acute vomiting and inappetence. Physical examination revealed severe abdominal distension. Radiographs demonstrated pneumoperitoneum, megaoesophagus and generalised gaseous distension of the digestive tract. Exploratory coeliotomy was performed, revealing markedly distended and thickened small and large intestines with no observable peristalsis. No intestinal perforation was present. Bacteriological and cytological analysis of abdominal fluid revealed a septic peritonitis involving Pasteurella multocida . Full-thickness intestinal biopsies demonstrated lymphocytic ganglioneuritis localised to the enteric nervous system, in association with glandular atrophy and muscular layer hypertrophy. Amoxicillin-clavulanate and analgesics were given. The cat’s general condition gradually improved after the addition of pyridostigmine bromide (0.5 mg/kg q12h PO, initiated 3 days postsurgery. Vomiting resolved and did not recur. Follow-up radiographs at 15 days, and 1 and 6 months showed persistent intestinal ileus, milder than on the pretreatment radiographs. Thirty months after presentation the cat is still alive, without clinical signs, and receives 1 mg/kg q12h pyridostigmine. Relevance and novel information To our knowledge, this is the first case of ganglioneuritis of the myenteric plexus described in cats, as well as the first one successfully treated with pyridostigmine. Chronic intestinal pseudo-obstruction is a very rare condition in cats but should be included in the differential diagnosis of generalised gastrointestinal ileus.

Isolation and Antibiogram of Aerobic Nasal Bacterial Flora of Apparently Healthy West African Dwarf Goats

Directory of Open Access Journals (Sweden)

B. O. Emikpe

2009-01-01

Full Text Available Goats are important in the livestock economy by their adaptability to adverse environmental conditions as they are good sources of protein and income for the rural poor. Studies conducted on the bacterial flora of the respiratory tract in goats focused on the pneumonic lungs, with fewer studies on the apparently normal nasal passage and antibiogram of isolated organisms. This study was carried out on 60 apparently healthy West African Dwarf goats. The nasal swab from each goat was analyzed using standard methods. The disc diffusion technique was used for the antibiotic sensitivity test. Three hundred and twenty-eight isolates were obtained. The most frequently isolated species was Streptococcus spp., while Escherichia coli and Staphylococcus aureus were the second dominant bacteria. Other species were isolated at relatively lower rates. The isolation of Mannheimia haemolytica and Pasteurella multocida from the nasal cavity of apparently healthy goats in this study reflects their possible role in most common respiratory diseases encountered in small ruminants. Most of the bacteria were found to be susceptible to streptomycin, quinolones (perfloxacin, ciprofloxacin and ofloxacin and gentamicin, while they were resistant to tetracycline, augmentin and erythromycin. This study shows the relationship between misuse or unrestricted use of antibiotics and drug resistance. Therefore, there is a need for practitioners and researchers to be informed of the appropriate antibiotics to be used in respiratory infections and during control programs.

Chronic intestinal pseudo-obstruction associated with enteric ganglionitis in a Persian cat.

Science.gov (United States)

Mortier, Jeremy; Elissalt, Estelle; Palierne, Sophie; Semin, Marie Odile; Delverdier, Maxence; Diquélou, Armelle

2016-01-01

Case summary A 7-year-old neutered male Persian cat was presented for acute vomiting and inappetence. Physical examination revealed severe abdominal distension. Radiographs demonstrated pneumoperitoneum, megaoesophagus and generalised gaseous distension of the digestive tract. Exploratory coeliotomy was performed, revealing markedly distended and thickened small and large intestines with no observable peristalsis. No intestinal perforation was present. Bacteriological and cytological analysis of abdominal fluid revealed a septic peritonitis involving Pasteurella multocida . Full-thickness intestinal biopsies demonstrated lymphocytic ganglioneuritis localised to the enteric nervous system, in association with glandular atrophy and muscular layer hypertrophy. Amoxicillin-clavulanate and analgesics were given. The cat's general condition gradually improved after the addition of pyridostigmine bromide (0.5 mg/kg q12h PO), initiated 3 days postsurgery. Vomiting resolved and did not recur. Follow-up radiographs at 15 days, and 1 and 6 months showed persistent intestinal ileus, milder than on the pretreatment radiographs. Thirty months after presentation the cat is still alive, without clinical signs, and receives 1 mg/kg q12h pyridostigmine. Relevance and novel information To our knowledge, this is the first case of ganglioneuritis of the myenteric plexus described in cats, as well as the first one successfully treated with pyridostigmine. Chronic intestinal pseudo-obstruction is a very rare condition in cats but should be included in the differential diagnosis of generalised gastrointestinal ileus.

Quantification and characterization of enzymatically produced hyaluronan with fluorophore-assisted carbohydrate electrophoresis.

Science.gov (United States)

Kooy, Floor K; Ma, Muyuan; Beeftink, Hendrik H; Eggink, Gerrit; Tramper, Johannes; Boeriu, Carmen G

2009-01-15

Hyaluronan (HA) is a polysaccharide with high-potential medical applications, depending on the chain length and the chain length distribution. Special interest goes to homogeneous HA oligosaccharides, which can be enzymatically produced using Pasteurella multocida hyaluronan synthase (PmHAS). We have developed a sensitive, simple, and fast method, based on fluorophore-assisted carbohydrate electrophoresis (FACE), for characterization and quantification of polymerization products. A chromatographic pure fluorescent template was synthesized from HA tetrasaccharide (HA4) and 2-aminobenzoic acid. HA4-fluor and HA4 were used as template for PmHAS-mediated polymerization of nucleotide sugars. All products, fluorescent and nonfluorescent, were analyzed with gel electrophoresis and quantified using lane densitometry. Comparison of HA4- and HA4-fluor-derived polymers showed that the fluorophore did not negatively influence the PmHAS-mediated polymerization. Only even-numbered oligosaccharide products were observed using HA4-fluor or HA4 as template. The fluorophore intensity was linearly related to its concentration, and the limit of detection was determined to be 7.4pmol per product band. With this assay, we can now differentiate oligosaccharides of size range DP2 (degree of polymerization 2) to approximately DP400, monitor the progress of polymerization reactions, and measure subtle differences in polymerization rate. Quantifying polymerization products enables us to study the influence of experimental conditions on HA synthesis.

Serologic survey for selected arboviruses and other potential pathogens in wildlife from Mexico.

Science.gov (United States)

Aguirre, A A; McLean, R G; Cook, R S; Quan, T J

1992-07-01

During 1988 and 1989, a serologic survey of wildlife was conducted in northeastern Mexico to determine the presence, prevalence, and distribution of arboviruses and other selected disease agents. Eighty mammal specimens were tested. Antibodies to vesicular stomatitis-Indiana, Venezuelan equine encephalitis-Mena II, Rio Grande virus, and vesicular stomatitis-New Jersey were detected predominantly in small mammals. Deer and mouflon (Ovis musimon) had antibodies to bluetongue and epizootic hemorrhagic disease. Two species had serologic evidence of recent exposure to Francisella tularensis. A white-tailed deer (Odocoileus virginianus) had antibodies to Anaplasma marginale. All specimens tested for antibodies against Yersinia pestis and Brucella abortus were negative. Sera from 315 birds were tested for antibody against five equine encephalitis viruses and six avian pathogens. During 1988, antibodies to Venezuelan equine encephalitis-Mena II, Venezuelan equine encephalitis-TC83, St. Louis encephalitis, eastern equine encephalitis, and western equine encephalitis were detected in birds of several species. Antibodies to Pasteurella multocida and Newcastle disease virus were also detected. Birds from five species presented antibodies to Mycoplasma meleagridis. Specimens tested for M. gallisepticum, M. synoviae, and Chlamydia psittaci were negative. To the best of our knowledge, this survey represents the first serologic evidence of bluetongue, Cache Valley virus, epizootic hemorrhagic disease, Jamestown Canyon virus, vesicular stomatitis-Indiana, vesicular stomatitis-New Jersey, Rio Grande virus, and tularemia reported among wildlife in Mexico.

Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

OpenAIRE

Ramos Zapana, Rubén; Arias Arroyo, Gladys

2014-01-01

Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

Estudio de la resistencia a compresión simple del adobe elaborado con suelos procedentes de Crescencio Valdés, Villa Clara, Cuba

Directory of Open Access Journals (Sweden)

Barroso, I. J.

2008-09-01

Full Text Available In this article we study the resistance to simple compression of the adobe bricks with building purposes. The study was carried out with various clay soils from Crescencio Valdés village, municipality of Camajuaní, Villa Clara, Cuba. In order to select the best soils to construction we have considered 1 MPa (10 kg/cm2 as minimum resistance to simple compression. So the soils that do not verify that requirement have been improved only by adding sand.En este artículo se estudia la resistencia a compresión simple que presenta el adobe elaborado con diferentes suelos procedentes del pueblo de Crescencio Valdés, situado en el municipio de Camajuaní, Villa Clara, Cuba. Se valora la idoneidad de la utilización de cada suelo estudiado bajo la premisa de alcanzar con el adobe elaborado una resistencia a compresión simple de 1 MPa (10 kg/cm2, ya que dicho adobe será utilizado posteriormente para edificación en dicho pueblo

Relato de caso de Lagochilascariose humana procedente do Estado do Pará, Brasil Report a case of human lagochilascariasis coming from the Pará State, Brazil

Directory of Open Access Journals (Sweden)

Miguel Alípio Vieira

2000-02-01

Full Text Available Mais um caso de lagochilascariose em criança procedente do Município de Xinguara PA. No Hospital das Clínicas da UFG, foi feita drenagem do abscesso localizado na região cervical direita, constatando-se a presença de ovos e vermes adultos de Lagochilascaris minor. Instituída terapia com albendazol 400mg/dia (durante 30 dias e antibioticoterapia, houve regressão do quadro clinico.A new case of lagochilascariasis is reported in a child from Xinguara PA, Brazil. The patient had an abscess in the right cervical region, which was drained at the Clinical Hospital of UFG. Eggs and adult stages of Lagochilascaris minor were found in the secretion of the abscess. Treatment with albendazol, at a dosage of 400mg/day for 30 days, associated with antibiotics promoted regression of the lesion.

Pericardite em suínos ao abate no Rio Grande Sul: avaliação de agentes bacterianos e lesões associadas

Directory of Open Access Journals (Sweden)

Carolini F. Coelho

2014-07-01

Full Text Available O objetivo do presente estudo foi identificar a frequência de lesões macroscópicas e microscópicas e dos agentes bacterianos envolvidos em pericardites em suínos no abate no Estado do Rio Grande do Sul. As amostras foram coletadas em frigoríficos de suínos com Serviço de Inspeção Federal (SIF entre fevereiro a outubro de 2010 e a condenação por pericardite dos animais acompanhados foi de 3,9% (299/7.571. No total foram investigados 91 casos de pericardites, 89% deles foram classificados como crônicos por histopatologia e pleurite crônica foi observada em 47% dos pulmões correspondentes, todavia não houve associação significativa entre as duas lesões. Os agentes bacterianos isolados a partir dos corações foram Streptococcus spp., Pasteurella multocida, Haemophilus parasuis e Streptococcus suis. DNA bacterianos mais detectados pela PCR foram de Mycoplasma hyopneumoniae e Actinobacillus pleuropneumoniae. Houve associação significativa entre isolamento de P. multocida e Streptococcus sp. nos corações e pulmões correspondentes. Esses resultados sugerem que a infecção no pulmão possa ter servido de porta de entrada para a colonização do pericárdio adjacente. Apesar de M. hyopneumoniae ter sido o agente detectado com maior frequência pela PCR em corações e pulmões correspondentes, não houve associação significativa da detecção dos agentes nos órgãos. Isto sugere que as infecções foram eventos independentes. Os demais agentes investigados não apresentaram associação significativa entre isolamento ou detecção de DNA em coração e pulmão correspondente. Outro achado importante foi a presença de coinfecções bacterianas em 2% dos corações e por PCR foi detectado DNA bacteriano de dois ou mais agentes em 16,5% dos corações. Esses resultados sugerem que as coinfecções em pericardites precisam ser melhor estudadas.

Degradación microbiana de cianuro procedente de plantas de beneficio de oro mediante una cepa nativa de P. fluorecens

Directory of Open Access Journals (Sweden)

OSCAR JAIME RESTREPO

2006-01-01

Full Text Available El cianuro es el compuesto lixiviante más utilizado en la industria metalúrgica de metales preciosos. El cianuro presenta efectos nocivos, entre los que se destacan su alta toxicidad y su efecto inhibitorio en la respiración celular. En este trabajo se probó la alternativa biotecnológica de degradar cianuro empleando una cepa nativa de P. fluorescens, aislada a partir de muestras de arenas procedentes de plantas de beneficio de oro que utilizan la cianuración ubicadas en municipio de Segovia, Colombia. En la mayor parte de las plantas de tratamiento no se controlan técnicamente los procesos, lo cual lleva a la utilización de cantidades de NaCN por encima de las necesarias, generando altas descargas del exceso tanto en solución como en las arenas descartadas. Las pruebas de toxicidad realizadas con D. pulex indican que una concentración de cianuro mayor o igual a 54 ppm es suficiente para intoxicar e inhibir su sobrevivencia. Los tratamientos convencionales para degradación de cianuro, suelen ser muy comunes y eficientes, sin embargo presentan desventajas por el alto costo que conlleva la compra de los reactivos necesarios. El tratamiento microbiano por su parte, demuestra eliminar grandes cantidades de cianuro de una manera eficiente y económica.

Tiamulin activity against fastidious and nonfastidious veterinary and human bacterial isolates: initial development of in vitro susceptibility test methods.

Science.gov (United States)

Jones, Ronald N; Pfaller, Michael A; Rhomberg, Paul R; Walter, Donald H

2002-02-01

Tiamulin is a pleuromutilin derivative used in veterinary practice for the control and specific therapy of infections in swine. This report summarizes studies to establish standardized susceptibility testing methods, interpretive criteria, and reagent details for use in veterinary methods recently developed by the National Committee for Clinical Laboratory Standards (NCCLS) (standards M31-A and M37-A, NCCLS, Wayne, Pa., 1999). A total of 636 fastidious and nonfastidious animal and human pathogens were processed by using media and procedures described by the NCCLS. Tiamulin disk diffusion tests used a 30-microg disk concentration, and the proposed MIC breakpoints corresponding to levels achievable in animal target tissues (lung) were or =32 microg/ml for resistance. Correlate zone diameters for specific nonfastidious species were as follows: for Pasteurella multocida and staphylococci tested on Mueller-Hinton agar, susceptibility at > or =19 mm and resistance at or =16 mm and resistance at or =9 mm) was suggested for veterinary fastidious medium broth and enriched chocolate Mueller-Hinton agar. Absolute categorical agreement between NCCLS dilution and disk diffusion test results with these criteria ranged from 90.5 to 96.2%. Tiamulin susceptibility testing methods appear to be accurate in their categorical classification for indicated species, and their availability will allow immediate testing of animal isolates to guide therapy via appropriate levels of dosing and to monitor the development of resistance for agents in this unique class.

Survey of susceptibility to marbofloxacin in bacteria isolated from diseased pigs in Europe.

Science.gov (United States)

El Garch, F; Kroemer, S; Galland, D; Morrissey, I; Woehrle, F

2017-06-17

A monitoring programme of marbofloxacin susceptibility of bacteria from Europe causing respiratory tract infection and meningitis in pigs has been active since 1994 and 2002, respectively. Monitoring digestive, metritis and urinary tract infection (UTI) in pigs has been active since 2005 and susceptibility results until 2013 are presented. Minimum inhibitory concentration (MIC) was determined by broth microdilution. For MIC interpretation, Vétoquinol-evaluated breakpoints were applied. For digestive pathogens, Escherichia coli and Salmonella species (1717 and 300 isolates, respectively) exhibited 7.5 per cent resistance in E coli and no resistance in Salmonella species. Similarly, E coli from metritis (369 isolates) had 7.0 per cent resistance to marbofloxacin. However, E coli from UTI (633 isolates) had higher resistance (10.4 per cent). For Streptococcus suis causing meningitis (585 isolates), marbofloxacin susceptibility was very high with only 0.5 per cent resistance and 0.4 per cent resistance was observed with S suis causing respiratory disease (729 isolates). Other respiratory pathogens were also highly susceptible to marbofloxacin with no resistance in Actinobacillus pleuropneumoniae (647 isolates) or Bordetella bronchiseptica (504 isolates), 0.1 per cent resistance in Pasteurella multocida (1373 isolates) and 1.4 per cent resistance in Haemophilus parasuis (145 isolates). There was no apparent change in marbofloxacin MIC over time for any bacterial pathogen based on MIC 50/90 These data confirm previously published MIC results from porcine and other animal infections. British Veterinary Association.

Isolation and polymerase chain reaction-based identification of Riemerella anatipestifer from ducks in Kerala, India

Directory of Open Access Journals (Sweden)

Manju Soman

2014-10-01

Full Text Available Aim: The aim was to isolate and characterize Riemerella anatipestifer organisms from disease outbreaks in ducks in Kerala. Materials and Methods: Ducklings, suspected of Riemerella infection, were sacrificed and subjected to post-mortem examination. Heart blood smears and impression smears from liver and spleen were examined for the presence of pathogenic organisms. Heart blood, lung, liver, and spleen collected aseptically from the birds were subjected to isolation trials in brain heart infusion agar and 10% bovine blood agar. The isolates were characterized based on morphology, cultural characteristics and biochemical tests, and their identity were confirmed by polymerase chain reaction (PCR and the PCR amplified DNA was sequenced. The antibiotic sensitivity testing of the isolates were carried out using six antibiotics viz ciprofloxacin, chloramphenicol, enrofloxacin, amoxycillin, cotrimoxazole, and gentamicin. Results: Colonies suggestive of Riemerella organisms could be isolated on blood agar. Biochemical characterization and PCR confirmed the identity of isolates as R. anatipestifer. The nucleotide sequence of the PCR product showed 99% homology to the R. anatipestifer sequences in the NCBI. The antibiogram revealed that the organisms were sensitive to ciprofloxacin, enrofloxacin, and gentamicin. Conclusion: The present study suggests that the PCR assay can facilitate fast and proper identification of R. anatipestifer infection in ducks. The assay can also differentiate between R. anatipestifer and Pasteurella multocida and can replace the traditional methods of differentiation which are cumbersome and time-consuming.

Pharmacokinetic/pharmacodynamic evaluation of marbofloxacin as a single injection for Pasteurellaceae respiratory infections in cattle using population pharmacokinetics and Monte Carlo simulations.

Science.gov (United States)

Paulin, A; Schneider, M; Dron, F; Woehrle, F

2018-02-01

Population pharmacokinetic of marbofloxacin was investigated with 52 plasma concentration-time profiles obtained after intramuscular administration of Forcyl® in cattle. Animal's status, pre-ruminant, ruminant, or dairy cow, was retained as a relevant covariate for clearance. Monte Carlo simulations were performed using a stratification by status, and 1000 virtual disposition curves were generated in each bovine subpopulation for the recommended dosage regimen of 10 mg/kg as a single injection. The probability of target attainment (PTA) of pharmacokinetic/pharmacodynamic (PK/PD) ratios associated with clinical efficacy and prevention of resistance was determined in each simulated subpopulation. The cumulative fraction of response (CFR) of animals achieving a PK/PD ratio predictive of positive clinical outcome was then calculated for the simulated dosage regimen, taking into account the minimum inhibitory concentration (MIC) distribution of Pasteurella multocida, Mannheimia haemolytica, and Histophilus somni. When considering a ratio of AUC 0-24 hr /MIC (area under the curve/minimum inhibitory concentration) greater than 125 hr, CFRs ranging from 85% to 100% against the three Pasteurellaceae in each bovine subpopulation were achieved. The PTA of the PK/PD threshold reflecting the prevention of resistances was greater than 90% up to MPC (mutant prevention concentration) values of 1 μg/ml in pre-ruminants and ruminants and 0.5 μg/ml in dairy cows. © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

A bibliography of references to avian cholera

Science.gov (United States)

Wilson, Sonoma S.

1979-01-01

Mrs. Wilson has made a genuine effort to include in this bibliography every significant reference to avian cholera since Louis Pasteur's articles appeared in 1880, although she recognizes the likelihood that a few have been overlooked. New listings have been added throughout 1978, but comprehensive coverage of the literature cannot be claimed beyond June of that year.Textbook accounts, because they are generally summaries of work published elsewhere, are excluded. Papers dealing primarily with the biology of Pasteurella multocida, as opposed to the disease it induces in birds, are also excluded, unless they report information of diagnostic usefulness. Short abstracts are not included unless the journals in which they are published are more widely available than those in which the complete articles appear or they are English summaries of foreign language articles.In compiling this bibliography, Mrs. Wilson has made extensive use of Biological Abstracts, the Pesticide Documentation Bulletin, and printouts generated by Bibliographic Retrieval Services, Inc. The "Literature Cited" sections of textbooks and journal articles pertinent to the subject were sources of many additional references. Regardless of the origin of the citation, its accuracy was confirmed by comparison with the original publication, except in those few instances (marked with an asterisk) when the journal was not on the shelves of the libraries accessible to us.The author will be grateful to users of the bibliography who point out errors or omissions.Wayne I. JensenMicrobiologist In Charge

Disclosing respiratory co-infections: a broad-range panel assay for avian respiratory pathogens on a nanofluidic PCR platform.

Science.gov (United States)

Croville, Guillaume; Foret, Charlotte; Heuillard, Pauline; Senet, Alexis; Delpont, Mattias; Mouahid, Mohammed; Ducatez, Mariette F; Kichou, Faouzi; Guerin, Jean-Luc

2018-06-01

Respiratory syndromes (RS) are among the most significant pathological conditions in edible birds and are caused by complex coactions of pathogens and environmental factors. In poultry, low pathogenic avian influenza A viruses, metapneumoviruses, infectious bronchitis virus, infectious laryngotracheitis virus, Mycoplasma spp. Escherichia coli and/or Ornithobacterium rhinotracheale in turkeys are considered as key co-infectious agents of RS. Aspergillus sp., Pasteurella multocida, Avibacterium paragallinarum or Chlamydia psittaci may also be involved in respiratory outbreaks. An innovative quantitative PCR method, based on a nanofluidic technology, has the ability to screen up to 96 samples with 96 pathogen-specific PCR primers, at the same time, in one run of real-time quantitative PCR. This platform was used for the screening of avian respiratory pathogens: 15 respiratory agents, including viruses, bacteria and fungi potentially associated with respiratory infections of poultry, were targeted. Primers were designed and validated for SYBR green real-time quantitative PCR and subsequently validated on the Biomark high throughput PCR nanofluidic platform (Fluidigm©, San Francisco, CA, USA). As a clinical assessment, tracheal swabs were sampled from turkeys showing RS and submitted to this panel assay. Beside systematic detection of E. coli, avian metapneumovirus, Mycoplasma gallisepticum and Mycoplasma synoviae were frequently detected, with distinctive co-infection patterns between French and Moroccan flocks. This proof-of-concept study illustrates the potential of such panel assays for unveiling respiratory co-infection profiles in poultry.

A bighorn sheep die-off in southern Colorado involving a Pasteurellaceae strain that may have originated from syntopic cattle.

Science.gov (United States)

Wolfe, Lisa L; Diamond, Brandon; Spraker, Terry R; Sirochman, Michael A; Walsh, Daniel P; Machin, Chandra M; Bade, Donald J; Miller, Michael W

2010-10-01

We investigated a pasteurellosis epizootic in free-ranging bighorn sheep (Ovis canadensis) wherein a Pasteurellaceae strain carried by syntopic cattle (Bos taurus) under severe winter conditions appeared to contribute to pneumonia in affected bighorns. Twenty-one moribund or dead bighorn sheep were found on the "Fossil Ridge" herd's winter range, Colorado, USA, between 13 December 2007 and 29 February 2008. Eight carcasses examined showed gross or microscopic evidence of acute to subacute fibrinous bronchopneumonia. All eight carcasses yielded at least one β-hemolytic Mannheimia haemolytica biogroup 1(±(G)) strain, and seven also yielded a β-hemolytic Bibersteinia trehalosi biogroup 4 (CDS) strain; evidence of Pasteurella multocida, Mycoplasma ovipneumoniae, and parainfluenza 3 and bovine respiratory syncytial viruses was also detected. Isolates of β-hemolytic Manneimia haemolytica biogroup 1(G) from a bighorn carcass and a syntopic cow showed 99.5% similarity in genetic fingerprints; B. trehalosi biogroup 4(CDS) isolates were ≥94.9% similar to an isolate from a nearby bighorn herd. Field and laboratory observations suggested that pneumonia in affected bighorns may have been caused by a combination of pathogens including two pathogenic Pasteurellaceae strains--one likely of cattle origin and one likely of bighorn origin--with infections in some cases perhaps exacerbated by other respiratory pathogens and severe weather conditions. Our and others' findings suggest that intimate interactions between wild sheep and cattle should be discouraged as part of a comprehensive approach to health management and conservation of North American wild sheep species.

Fusobacterium necrophorum in North American Bighorn Sheep ( Ovis canadensis ) Pneumonia.

Science.gov (United States)

Shanthalingam, Sudarvili; Narayanan, Sanjeevkumar; Batra, Sai Arun; Jegarubee, Bavananthasivam; Srikumaran, Subramaniam

2016-07-01

Fusobacterium necrophorum has been detected in pneumonic bighorn sheep (BHS; Ovis canadensis ) lungs, in addition to the aerobic respiratory pathogens Mannheimia haemolytica , Bibersteinia trehalosi , Pasteurella multocida , and Mycoplasma ovipneumoniae . Similar to M. haemolytica , F. necrophorum produces a leukotoxin. Leukotoxin-induced lysis and degranulation of polymorphonuclear leukocytes (PMNs) and macrophages are responsible for acute inflammation and lung tissue damage characteristic of M. haemolytica -caused pneumonia. As one approach in elucidating the role of F. necrophorum in BHS pneumonia, we determined the frequency of the presence of F. necrophorum in archived pneumonic BHS lung tissues, and susceptibility of BHS leukocytes to F. necrophorum leukotoxin. A species-specific PCR assay detected F. necrophorum in 37% of pneumonic BHS lung tissues (total tested n=70). Sequences of PCR amplicons were similar to the less virulent F. necrophorum subsp. funduliforme. Fusobacterium necrophorum leukotoxin exhibited cytotoxicity to BHS PMNs and peripheral blood mononuclear cells. As with the M. haemolytica leukotoxin, F. necrophorum leukotoxin was more toxic to BHS PMNs than domestic sheep PMNs. It is likely that F. necrophorum enters the lungs after M. haemolytica and other aerobic respiratory pathogens enter the lungs and initiate tissue damage, thereby creating a microenvironment that is conducive for anaerobic bacterial growth. In summary, Fusobacterium leukotoxin is highly toxic for BHS leukocytes; however, based on the PCR findings, it is unlikely to play a direct role in the development of BHS pneumonia.

Evaluation of Phenolic Compounds and Antioxidant and Antimicrobial Activities of Some Common Herbs

Directory of Open Access Journals (Sweden)

Muhammad Abdul Qadir

2017-01-01

Full Text Available The study was designed to evaluate the phenolic, flavonoid contents and antioxidant and antimicrobial activities of onion (Allium cepa, garlic (Allium sativum, mint (Mentha spicata, thyme (Thymus vulgaris, oak (Quercus, aloe vera (Aloe barbadensis Miller, and ginger (Zingiber officinale. All extracts showed a wide range of total phenolic contents, that is, 4.96 to 98.37 mg/100 g gallic acid equivalents, and total flavonoid contents, that is, 0.41 to 17.64 mg/100 g catechin equivalents. Antioxidant activity (AA was determined by measuring reducing power, inhibition of peroxidation using linoleic acid system, and 2,2-diphenyl-1-picrylhydrazyl radical (DPPH scavenging activity. Different extracts inhibited oxidation of linoleic acid by 16.6–84.2% while DPPH radical scavenging activity (IC50 values ranged from 17.8% to 79.1 μg/mL. Reducing power at 10 mg/mL extract concentration ranged from 0.11 to 0.84 nm. Furthermore the extracts of these medicinal herbs in 80% methanol, 80% ethanol, 80% acetone, and 100% water were screened for antimicrobial activity by disc diffusion method against selected bacterial strains, Staphylococcus aureus, Escherichia coli, Bacillus subtilis, and Pasteurella multocida, and fungal strains, Aspergillus niger, Aspergillus flavus, Rhizopus solani, and Alternaria alternata. The extracts show better antimicrobial activity against bacterial strains as compared to fungal strains. Results of various assays were analyzed statistically by applying appropriate statistical methods.

Estudios sobre leishmaniasis tegumentaria en el Perú. I. Infección experimental de perros con cepas de leishmanias procedentes de casos de Uta

Directory of Open Access Journals (Sweden)

Arístides Herrer

1951-01-01

Full Text Available Se han inoculado varias series de perros con cepas de leishmanias procedentes de la forma clínica de la leishmaniasis tegumentaria conocida en el Perú con el nombre de uta, usando con tal objeto material tomado directamente de las lesiones utosas así como también cultivos del parásito. Los principales resultados obtenidos en tales inoculaciones son los siguientes: 1. Ha sido imposible infectar al perro con cultivos mantenidos solamente in vitro por espacio de cinco a ocho años, no obstante de haberse ensayado en tres series distintas de inoculaciones. 2. Se ha conseguido infecciones experimentales en el 87 por ciento de los perros que fueron inoculados con cultivos de reciente aislamiento. Aunque las inoculaciones fueran hechas bajo las mismas circunstancias en el dorso del hocico y la cara interna de una de las orejas, la infección se ha obtenido principalmente en el hocico. 3. También se ha logrado infectar perros inoculándoles material tomado directamente de las lesiones leishmaniásicas, ya sea de casos de uta o de lesiones producidas experimentalmente en otros perros.

21 CFR 522.2630 - Tulathromycin.

Science.gov (United States)

2010-04-01

.... multocida, Bordetella bronchiseptica, Haemophilus parasuis, and Mycoplasma hyopneumoniae; and for the control of SRD associated with A. pleuropneumoniae, P. multocida, and M. hyopneumoniae in groups of pigs..., Histophilus somni, and Mycoplasma bovis. For the control of respiratory disease in cattle at high risk of...

Efecto de la temperatura y tiempo de tostado en los caracteres sensoriales y en las propiedades químicas de granos de cacao (Theobroma cacao L.) procedente de Uchiza, San Martín – Perú para la obtención de NIBS

OpenAIRE

Aldave Palacios, Gladis Josefina

2016-01-01

Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...

Exhaust Air Dust Monitoring is Superior to Soiled Bedding Sentinels for the Detection of Pasteurella pneumotropica in Individually Ventilated Cage Systems.

Science.gov (United States)

Miller, Manuel; Ritter, Brbel; Zorn, Julia; Brielmeier, Markus

2016-11-01

Reliable detection of unwanted organisms is essential for meaningful health monitoring in experimental animal facilities. Currently, most rodents are housed in IVC systems, which prevent the aerogenic transmission of pathogens between cages. Typically soiled-bedding sentinels (SBS) exposed to soiled bedding collected from a population of animals within an IVC rack are tested as representatives, but infectious agents often go undetected due to inefficient transmission. Pasteurellaceae are among the most prevalent bacterial pathogens isolated from experimental mice, and the failure of SBS to detect these bacteria is well established. In this study, we investigated whether analysis of exhaust air dust (EAD) samples by using a sensitive and specific real-time PCR assay is superior to conventional SBS monitoring for the detection of Pasteurella pneumotropica (Pp) infections. In a rack with a known prevalence of Pp-positive mice, weekly EAD sampling was compared with the classic SBS method over 3 mo. In 6 rounds of testing, with a prevalence of 5 infected mice in each of 7 cages in a rack of 63 cages, EAD PCR detected Pp at every weekly time point; SBS failed to detect Pp in all cases. The minimal prevalence of Pp-infected mice required to obtain a reliable positive result by EAD PCR testing was determined to be 1 in 63 cages. Reliable detection of Pp was achieved after only 1 wk of exposure. Analysis of EAD samples by real-time PCR assay provides a sensitive, simple, and reliable approach for Pp identification in laboratory mice.

Resistencia antimicrobiana de cepas de Bartonella bacilliformis procedentes de regiones endémicas de la Enfermedad de Carrión en EL Perú

Directory of Open Access Journals (Sweden)

Giovanna Mendoza-Mujica

Full Text Available Objetivos. Evaluar la susceptibilidad antimicrobiana in vitro a cloranfenicol (CHL y ciprofloxacino (CIP de cepas de Bartonella bacilliformis procedentes de áreas endémicas de la enfermedad de Carrión (EC en el Perú, mediante tres métodos de laboratorio. Materiales y métodos. Se evaluó la susceptibilidad antimicrobiana a CHL y CIP de 100 cepas de Bartonella bacilliformis, los aislamientos procedieron de pacientes de los departamentos de Ancash, Cusco, Cajamarca, Lima y La Libertad; las cepas se evaluaron mediante: disco difusión, E-Test y dilución en agar. Resultados. El 26% de las cepas de Bartonella bacilliformis evaluadas, presentaron resistencia a CIP y 1% a CHL. Se obtuvieron patrones similares de sensibilidad/resistencia antimicrobiana en los tres métodos utilizados. Conclusiones. Las cepas de Bartonella bacilliformis circulantes en el Perú, presentan elevados niveles de resistencia in vitro a CIP, por lo que se recomienda ampliar la investigación sobre la utilización del fármaco en los esquemas de tratamiento de la EC. Los métodos de E-test y disco difusión resultaron más convenientes para la evaluación de la susceptibilidad antimicrobiana in vitro del microorganismo

Swamp Buffalo in South Kalimantan : Problem, Disease and Control

Directory of Open Access Journals (Sweden)

Lily Natalia

2006-12-01

Full Text Available In recent years, several studies have been carried out to evaluate and investigate the important diseases of swamp buffaloes (Bubalus carabanensis in Kalimantan . More attention has been focused on the case of acute infectious diseases and sudden death in the buffaloes . Fasciolosis black disease, acute enteritis, especially fatal enterotoxaemia haemorrhagic septicaemia . and trypanosomiasis (Surra, are some of the important diseases found in these animals . Black disease caused by toxigenic Clostridium novyi occurs in the presence of the organism in the liver and the degree of liver fluke Fasciola gigantica infestation . In regions where black disease is enzootic, Cl. novvi can be isolated from livers of normal healthy animals . In Hulu Sungai Utara district, South Kalimantan, the prevalence of fasciolosis caused by Fasciola gigantica in swamp buffalo was 77% in 1991 . A gross sudden change in diet due to seasonal changes could induce rumen and intestinal stasis, which provide a favourable environment for the rapid proliferation of commensal toxigenic Clostridium perfringens in the small intestine . Subsequent absorption of the toxin produced through the gut wall and its generalized dissemination culminated in a fatal enterotoxaemia . Haemorrhagic septicaemia (HS is an acute, fatal disease affecting swamp buffalo, and caused by Pasteurella multocida B : 2 . The swamp buffalo is particularly susceptible for HS, and the reported greatest losses of swamp buffalo in Kalimantan due to HS is recorded in 1980s. The clinical signs of Surra in swamp buffalo were also found in certain areas in Danau Panggang area . Hulu Sungai Utara district . Vaccination is the accepted method for controlling Black disease, enterotoxaemia and HS. Multi component vaccine, alum adjuvant containing at least 5 types of clostridial toxoids and P. multocida B2 bacterin have been used and provide good protection to the animals . Control and treatment of liver fluke infestation

Antioxidant, antimicrobial, antitumor, and cytotoxic activities of an important medicinal plant (Euphorbia royleana from Pakistan

Directory of Open Access Journals (Sweden)

Aisha Ashraf

2015-03-01

Full Text Available The aim of present study was to evaluate antioxidant, antimicrobial, and antitumor activities of methanol, hexane, and aqueous extracts of fresh Euphorbia royleana. Total phenolic and flavonoid contents were estimated as gallic acid and querectin equivalents, respectively. Antioxidant activity was assessed by scavenging of free 2,2′- diphenyl-1-picrylhydrazyl radicals and reduction of ferric ions, and it was observed that inhibition values increase linearly with increase in concentration of extract. The results of ferric reducing antioxidant power assay showed that hexane extract has maximum ferric reducing power (12.70 ± 0.49 mg gallic acid equivalents/g of plant extract. Maximum phenolic (47.47 ± 0.71 μg gallic acid equivalents/mg of plant extract and flavonoid (63.68 ± 0.43 μg querectin equivalents/mg of plant extract contents were also found in the hexane extract. Furthermore, we examined antimicrobial activity of the three extracts (methanol, hexane, aqueous against a panel of microorganisms (Escherichia coli, Bacillus subtillis, Pasteurella multocida, Aspergillus niger, and Fusarium solani by disc-diffusion assay, and found the hexane extract to be the best antimicrobial agent. Hexane extract was also observed as to be most effective in a potato disc assay. As hexane extract showed potent activity in all the investigated assays, it was targeted for cytotoxic assessment. Maximum cytotoxicity (61.66% by hexane extract was found at 800 μg/mL. It is concluded that investigated extracts have potential for isolation of antioxidant and antimicrobial compounds for the pharmaceutical industry.

Avaliação de bacterina e Lactobacillus plantarum frente à infecção experimental por Vibrio harveyi em pós-larvas de Litopenaeus vannamei

Directory of Open Access Journals (Sweden)

Celso Carlos Buglione

2008-12-01

Full Text Available This study aimed to verify the effect of probiotics and inactivated cells of bacterias such as Vibrio alginolyticus, Aeromonas salmonicida and Pasteurella multocida in larvae survival of Litopenaeus vannamei, in stress test and experimental infection with Vibrio harveyi. Conic tanks of 30 L, were stocked with 400 post-larvae stage five. Four experimental treatments with triplicates consisted of: 1: commercial feed (control, 2: commercial feed plus bacterin by oral administration in artemia, 3: commercial feed plus bacterin by immersion administration, 4: commercial feed with Lactobacillus plantarum inoculation. Bacterin application was conducted 6h before the infection and stress test, while probiotic administration was for 15 days before challenges. In stress test, post-larvae of treatment 4 (commercial feed supplemented with Lactobacillus plantarum with reached the highest survival rate (87,86 ± 2,35% followed by the ones of treatment 3 and 2 (bacterim by immersion and bacterim by oral administration in artemia with 81,54±1,50% and 80,16 ± 2,15%, respectively, which were superior to the control treatment (72,63 ± 3,34%. Next to V. harveyi challenge, animals from treatment 3 presented the highest survival rate (79,60 ± 7,12% followed by treatments 4 (69,60 ± 10,43%, 2 (65,60 ± 5,18% and control (56,4 ± 5,58%. All treatments were different from control. The present results demonstrate the possible use of L. plantarum and bacterin as promoters in survival rates of L. vannamei post-larvae in the stress tests and challenges with Vibrio harveyi.

Plasma concentrations resulting from florfenicol preparations given to pigs in their drinking water.

Science.gov (United States)

Gutiérrez, L; Vargas, D; Ocampo, L; Sumano, H; Martinez, R; Tapia, G

2011-09-01

Florfenicol administered through the drinking water has been recommended as a metaphylactic antibacterial drug to control outbreaks of respiratory diseases in pigs caused by strains of Actinobacillus pleuropneumoniae and Pasteurella multocida, yet it is difficult to pinpoint in practice when the drug is given metaphylactically or therapeutically. Further, pigs are likely to reject florfenicol-medicated water, and plasma concentrations of the drug are likely to be marginal for diseases caused by Escherichia coli, Klebsiella pneumoniae, and Staphylococcus aureus. The reported minimal inhibitory concentration (MIC) values for these organisms show a breakpoint of 2 to 3 μg/mL. An experiment was conducted during September and October 2009. One hundred twenty healthy crossbred pigs (Landrace-Yorkshire), weighing 23 ± 6.2 kg, were used in this trial. They were randomly assigned to 5 groups, with 3 replicates of 8 animals/group. Two commercial preparations of florfenicol were administered through the drinking water at 2 concentrations (0.01 and 0.015%). Water intake was measured before and after medication, and plasma concentrations of florfenicol were determined by HPLC. Considerable rejection of florfenicol-medicated water was observed. However, plasma florfenicol concentrations were of a range sufficient for a methaphylaxis approach to preventing disease by bacteria, with MIC breakpoints of ≤ 0.25 μg/mL. Decreased efficacy as a metaphylactic medication should be expected for bacteria with MIC >0.25 μg/mL, considering the reported existence of bacteria resistant to florfenicol and the natural resistance of Streptococcus suis or E. coli to this drug.

Manifestaciones hidrológicas e hidroquímicas de flujos subterráneos procedentes de formaciones poco permeables del terciario en el Somontano de Huesca

Directory of Open Access Journals (Sweden)

de Miguel Cabeza, J. L.

1988-12-01

Full Text Available Presence of groundwater flow in the «somontano Oscense» area, proceeding from low permeability detritic tertiary rocks, is considered. It's given a grounwater flow model for these tertiary rocks. This model explains both water flow through them and water chemical characteristics. Groundwater flow has clear surface manifestations: it causes wet-areas (which are called «paules» in the area with sodic waters; it makes appear saline, sodic or alkaline soils; and it modifies, too, water chemical composition of rivers in Somontano.Se considera la presencia en el Somontano Oscense de flujos de agua subterránea procedentes de materiales detríticos terciarios de baja permeabilidad. Se da un modelo de flujo de las aguas subterráneas en estos materiales que permite explicar tanto su fluencia hacia la superficie como sus características físico-químicas. Estos flujos se manifiestan en superficie, dando lugar a zonas húmedas naturales, paules, con aguas de composición sódica que provocan la formación de suelos salinos, sódicos o alcalinos; también se manifiestan modificando la composición química de las aguas de los ríos que atraviesan el Somontano.

Determinación de la resistencia a insecticidas en Aedes aegypti, Anopheles albimanus y Lutzomyia peruensis procedentes del Norte Peruano

Directory of Open Access Journals (Sweden)

Franklin Vargas V

2006-10-01

Full Text Available Objetivo: Determinar los niveles de resistencia a temephos y deltametrina en cinco poblaciones naturales de Aedes aegypti del norte de Perú (La Libertad y Piura, dos cepas de Anopheles albimanus (Sullana y Tambogrande y una cepa de Lutzomyía spp (Santiago de Chuco, La Libertad. Materiales y métodos: Se realizaron bioensayos en larvas y adultos siguiendo la metodología de la Organización Mundial de la Salud. La visualización de bandas de B-esterasas se hizo por electroforesis en gel de poliacrilamida en larvas de cuarto estadio. Resultados: Las poblaciones de Ae. aegypti de Sullana y Tambogrande (Piura presentaron factores de resistencia (FR a temephos de 6,84 con un KDT50 = 160,42 minutos y 70% de mortalidad a las 24 horas; en tanto en la población de Tambogrande se observó un FR de 5,60, KDT50 = 107,20 y 80% de mortalidad, a diferencia de las cepas de La Esperanza, El Porvenir y Florencia de Mora (La Libertad que fueron susceptibles. Se identificó resistencia en las poblaciones de Ae. aegypti y A. albimanus procedentes de Piura (Tambogrande y Sullana para deltametrina, a diferencia de las poblaciones de Ae.aegypti y Lutzomyia spp de La Libertad que fueron susceptibles. Se identificó la esterasa B2 con un Rf de 0,23 en la población de Ae. aegypti de Sullana. Conclusiones: Dada la susceptibilidad de la población de La Libertad al insecticida temephos, puede seguir siendo usado en el control vectorial de Aedes aegypti; por lo contrario, dada la resistencia observada en poblaciones de Anopheles en Sullana y Tambogrande se debe evaluar el uso de la deltametrina en estas poblaciones. Finalmente, la población de Lutzomyia spp. no presentó resistencia a deltametrina.

In vitro activity of five tetracyclines and some other antimicrobial agents against four porcine respiratory tract pathogens.

Science.gov (United States)

Pijpers, A; Van Klingeren, B; Schoevers, E J; Verheijden, J H; Van Miert, A S

1989-09-01

The minimal inhibitory concentrations (MIC) of five tetracyclines and ten other antimicrobial agents were determined for four porcine bacterial respiratory tract pathogens by the agar dilution method. For the following oxytetracycline-susceptible strains, the MIC50 ranges of the tetracyclines were: P. multocida (n = 17) 0.25-0.5 micrograms/ml; B. bronchiseptica (n = 20) 0.25-1.0 micrograms/ml; H. pleuropneumoniae (n = 20) 0.25-0.5 micrograms/ml; S. suis Type 2 (n = 20) 0.06-0.25 micrograms/ml. For 19 oxytetracycline-resistant P. multocida strains the MIC50 of the tetracyclines varied from 64 micrograms/ml for oxytetracycline to 0.5 micrograms/ml for minocycline. Strikingly, minocycline showed no cross-resistance with oxytetracycline, tetracycline, chlortetracycline and doxycycline in P. multocida and in H. pleuropneumoniae. Moreover, in susceptible strains minocycline showed the highest in vitro activity followed by doxycycline. Low MIC50 values were observed for chloramphenicol, ampicillin, flumequine, ofloxacin and ciprofloxacin against P. multocida and H. pleuropneumoniae. B. bronchiseptica was moderately susceptible or resistant to these compounds. As expected tiamulin, lincomycin, tylosin and spiramycin were not active against H. pleuropneumoniae. Except for flumequine, the MIC50 values of nine antimicrobial agents were low for S. suis Type 2. Six strains of this species showed resistance to the macrolides and lincomycin.

CARACTERIZACIÓN BROMATOLÓGICA Y MICROBIOLÓGICA DE CARNES PROCEDENTES DE ESPECIES DE ANIMALES REGIONALES DE LA AMAZONIA PERUANA PARA CONSUMO HUMANO

Directory of Open Access Journals (Sweden)

Ronald Lozano

2012-12-01

Full Text Available La investigación consistió en la caracterización bromatológica y determinación microbiológica de muestras de carnes procedentes de ocho especies de animales silvestres: huangana (Tayassu pecari, majaz o picuro (Agouti paca, sajino (Tayassu tajacu, venado colorado (Mazama americana, tapir (Tapirus terrestris, añuje (Dasyprota fuliginosa, ronsoco (Hydrochaeris hydrochaeris y armadillo (Dasypus novemcinctus; en las localidades de Puerto Belén-Roya-Utucuro, Santa Rosa de Aguaytía, Santa Luz de Abujao, Tacshitea–Sector Parinari en dos ocasiones, ubicadas en las márgenes del río Ucayali y sus afluentes, que fueron analizarlas por la empresa Servicios de Asesoramiento Técnico S.A.C. en Lima.  La caracterización bromatológica indicó que el añuje (Dasyprota fuliginosa mostró el mayor contenido en Proteína cruda seguido de la huangana (Tayassu pecari; en el contenido de grasa destacaron las especies  armadillo (Dasypus novemcinctus y la sachavaca (Tapirus terrestris así también en su contenido calórico.  La especie venado colorado (Mazama americana mostró un mayor valor en cenizas y en carbohidratos la especie huangana (Tayassu pecari.  La determinación microbiológica indicó que todas las muestras presentaron niveles de contaminación dentro de los límites permitidos para aerobios mesófilos viables y niveles de contaminación por coliformes totales, coliformes fecales, algunos muy elevados y también de mohos y levaduras.  Todos presentaron ausencia de Salmonella.

Aislamiento e identificación de Vibrio parahaemolyticus O3: K6 en pescados y moluscos bivalvos procedentes de un mercado pesquero de Lima, Perú

Directory of Open Access Journals (Sweden)

Rocío Aliaga

2010-07-01

Full Text Available Objetivo: Determinar la presencia de Vibrio parahaemolyticus serotipo O3:K6 en pescados y moluscos bivalvos procedentes de un mercado pesquero de Lima. Material y Métodos: Se analizaron 254 muestras entre pescados y moluscos bivalvos siguiendo la técnica descrita por Yukiko Harakudo et al, que consta de un paso de enriquecimiento, siembra en medio cromogénico, evaluación de fermentación de glucosa y la prueba de tolerancia a sales. Las cepas identificadas como Vibrio parahaemolyticus fueron serotipificadas usando anticuerpos monoclonales y evaluadas en su potencial patogénico en medio de Wagatsuma. Resultados: Se aislaron 15 cepas de V. parahaemolyticus, 9(7,5% en pescados y 6(4,5% en moluscos bivalvos. Tres (20% presentaron fenómeno de Kanagawa positivo indicando la producción de la hemolisina termoestable directa (TDH. Una cepa TDH-positiva aislada en una muestra pescado fue serotipo O3:K6. Conclusiones: Vibrio parahaemolyticus se encuentra distribuido en los recursos hidrobiológicos estudiados con mayor frecuencia en pescados, a partir de los cuales se encontró el serovar O3:K6. Este es el primer reporte de la cepa pandémica O3:K6 de Vibrio parahaemolyticus aislada de fuente no humana en el Perú. (Rev Med Hered 2010;21:139-145.

Occurrence of antimicrobial resistance in bacteria from diagnostic samples from dogs.

Science.gov (United States)

Pedersen, Karl; Pedersen, Kristina; Jensen, Helene; Finster, Kai; Jensen, Vibeke F; Heuer, Ole E

2007-10-01

To study the occurrence of antimicrobial resistance among common bacterial pathogens from dogs and relate resistance patterns to data on consumption of antimicrobials. The antimicrobial susceptibility patterns of 201 Staphylococcus intermedius, 37 Streptococcus canis, 39 Pseudomonas aeruginosa, 25 Pasteurella multocida, 29 Proteus spp. and 449 Escherichia coli isolates from clinical submissions from dogs were determined by a broth-dilution method for determination of minimal inhibitory concentration. Data for consumption of antimicrobials were retrieved from VetStat, a national database for reporting antimicrobial prescriptions. The majority of the antimicrobials prescribed for dogs were broad-spectrum compounds, and extended-spectrum penicillins, cephalosporins and sulphonamides + trimethoprim together accounted for 81% of the total amount used for companion animals. Resistance to cephalosporins and amoxicillin with clavulanic acid was very low for all bacterial species examined, except for P. aeruginosa, and resistance to sulphonamides and trimethoprim was low for most species. Among the S. intermedius isolates, 60.2% were resistant to penicillin, 30.2% to fusidic acid and 27.9% to macrolides. Among E. coli isolates, the highest level of resistance was recorded for ampicillin, sulphonamides, trimethoprim, tetracyclines and streptomycin. Certain differences in resistance patterns between isolates from different sites or organs were noticed for E. coli, S. intermedius and Proteus isolates. This investigation provided data on occurrence of antimicrobial resistance in important pathogenic bacteria from dogs, which may be useful for the small animal practitioner. Resistance was low to the compounds that were most often used, but unfortunately, these compounds were broad-spectrum. Data on resistance and usage may form a background for the establishment of a set of recommendations for prudent use of antimicrobials for companion animals.

Aquatic bird disease and mortality as an indicator of changing ecosystem health

Science.gov (United States)

Newman, Scott H.; Chmura, Aleksei; Converse, Kathy; Kilpatrick, A. Marm; Patel, Nikkita; Lammers, Emily; Daszak, Peter

2007-01-01

We analyzed data from pathologic investigations in the United States, collected by the USGS National Wildlife Health Center between 1971 and 2005, into aquatic bird mortality events. A total of 3619 mortality events was documented for aquatic birds, involving at least 633 708 dead birds from 158 species belonging to 23 families. Environmental causes accounted for the largest proportion of mortality events (1737 or 48%) and dead birds (437 258 or 69%); these numbers increased between 1971 and 2000, with biotoxin mortalities due to botulinum intoxication (Types C and E) being the leading cause of death. Infectious diseases were the second leading cause of mortality events (20%) and dead birds (20%), with both viral diseases, including duck plague (Herpes virus), paramyxovirus of cormorants (Paramyxovirus PMV1) and West Nile virus (Flavivirus), and bacterial diseases, including avian cholera (Pasteurella multocida), chlamydiosis (Chalmydia psittici), and salmonellosis (Salmonella sp.), contributing. Pelagic, coastal marine birds and species that use marine and freshwater habitats were impacted most frequently by environmental causes of death, with biotoxin exposure, primarily botulinum toxin, resulting in mortalities of both coastal and freshwater species. Pelagic birds were impacted most severely by emaciation and starvation, which may reflect increased anthropogenic pressure on the marine habitat from over-fishing, pollution, and other factors. Our study provides important information on broad trends in aquatic bird mortality and highlights how long-term wildlife disease studies can be used to identify anthropogenic threats to wildlife conservation and ecosystem health. In particular, mortality data for the past 30 yr suggest that biotoxins, viral, and bacterial diseases could have impacted >5 million aquatic birds.

Morbidade da doença de Chagas: I - Estudo de casos procedentes de vários estados do Brasil, observados no Rio de Janeiro Morbidity of Chagas' disease: I - Study of cases originating from various states of Brazil, observed in Rio de Janeiro

Directory of Open Access Journals (Sweden)

J. Rodrigues Coura

1983-09-01

Full Text Available Um estudo da morbidade através de exames clínicos, eletrocardiográficos, radiológicos, sorológicos, xenodiagnósticos e outros exames laboratoriais seriados, foi feito em 510 pacientes com sorologia positiva para doença de Chagas, procedentes de vários Estados do Brasil e observados no Rio de Janeiro a partir de 1960. Os pacientes foram classificados, de acordo com a forma clínica, em assintomáticos (forma indeterminada, cardíacos, portadores de "megas" ou com formas clínicas associadas. Foi observada uma prevalência de cardiopatia em 52,1% dos pacientes, de "megas" em 14,3% e de associação entre cardiopatia e "megas" em 10,7% e entre megaesôfago e megacolon em 10,9% dos casos. A forma indeterminada (assintomática foi observada em 39% dos pacientes. A proporção de casos de cardiopatia aumentou progressivamente da 1ª a 5ª décadas de vida, enquanto a dos "megas" continuou aumentando até a 7ª década. Entretanto, em número de casos o pico de ambas as formas ocorreu na 4ª década. Não houve diferenças significativas de formas clínicas com relação ao sexo, apesar de uma discreta predominância de cardiopatia no sexo masculino e de "megas" no sexo feminino. Com relação à raça, entre os pacientes classificados como brancos, pretos e mestiços, não foi possível determinar a significância entre as diversas formas clínicas, por desconhecimento da constituição do universo da procedência de cada paciente. Embora o reduzido número de casos não possa ser considerado como representativo da prevalência das fomas clínicas nas regiões de origem dos pacientes, tomando-se os quatro Estados representados com maior número de casos, verificou-se que as proporções de cardiopatia e "megas" foram respectivamente de 65,7 e 20,1% nos casos procedentes da Bahia, de 55,7 e 14,7% nos de Minas Gerais, de 50,9 e 15% nos de Pernambuco e de 23,3 e 0% nos procedentes da Paraíba. O reduzido número de casos procedentes dos demais

Avian Cholera emergence in Arctic-nesting northern Common Eiders: using community-based, participatory surveillance to delineate disease outbreak patterns and predict transmission risk

Directory of Open Access Journals (Sweden)

Samuel A. Iverson

2016-12-01

Full Text Available Emerging infectious diseases are a growing concern in wildlife conservation. Documenting outbreak patterns and determining the ecological drivers of transmission risk are fundamental to predicting disease spread and assessing potential impacts on population viability. However, evaluating disease in wildlife populations requires expansive surveillance networks that often do not exist in remote and developing areas. Here, we describe the results of a community-based research initiative conducted in collaboration with indigenous harvesters, the Inuit, in response to a new series of Avian Cholera outbreaks affecting Common Eiders (Somateria mollissima and other comingling species in the Canadian Arctic. Avian Cholera is a virulent disease of birds caused by the bacterium Pasteurella multocida. Common Eiders are a valuable subsistence resource for Inuit, who hunt the birds for meat and visit breeding colonies during the summer to collect eggs and feather down for use in clothing and blankets. We compiled the observations of harvesters about the growing epidemic and with their assistance undertook field investigation of 131 colonies distributed over >1200 km of coastline in the affected region. Thirteen locations were identified where Avian Cholera outbreaks have occurred since 2004. Mortality rates ranged from 1% to 43% of the local breeding population at these locations. Using a species-habitat model (Maxent, we determined that the distribution of outbreak events has not been random within the study area and that colony size, vegetation cover, and a measure of host crowding in shared wetlands were significantly correlated to outbreak risk. In addition, outbreak locations have been spatially structured with respect to hypothesized introduction foci and clustered along the migration corridor linking Arctic breeding areas with wintering areas in Atlantic Canada. At present, Avian Cholera remains a localized threat to Common Eider populations in the

Antimicrobial Susceptibility of Bordetella bronchiseptica Isolates from Swine and Companion Animals and Detection of Resistance Genes.

Directory of Open Access Journals (Sweden)

Sandra Prüller

Full Text Available Bordetella bronchiseptica causes infections of the respiratory tract in swine and other mammals and is a precursor for secondary infections with Pasteurella multocida. Treatment of B. bronchiseptica infections is conducted primarily with antimicrobial agents. Therefore it is essential to get an overview of the susceptibility status of these bacteria. The aim of this study was to comparatively analyse broth microdilution susceptibility testing according to CLSI recommendations with an incubation time of 16 to 20 hours and a longer incubation time of 24 hours, as recently proposed to obtain more homogenous MICs. Susceptibility testing against a panel of 22 antimicrobial agents and two fixed combinations was performed with 107 porcine isolates from different farms and regions in Germany and 43 isolates obtained from companion animals in Germany and other European countries. Isolates with increased MICs were investigated by PCR assays for the presence of resistance genes. For ampicillin, all 107 porcine isolates were classified as resistant, whereas only a single isolate was resistant to florfenicol. All isolates obtained from companion animals showed elevated MICs for β-lactam antibiotics and demonstrated an overall low susceptibility to cephalosporines. Extension of the incubation time resulted in 1-2 dilution steps higher MIC50 values of porcine isolates for seven antimicrobial agents tested, while isolates from companion animals exhibited twofold higher MIC50/90 values only for tetracycline and cefotaxime. For three antimicrobial agents, lower MIC50 and MIC90 values were detected for both, porcine and companion animal isolates. Among the 150 isolates tested, the resistance genes blaBOR-1 (n = 147, blaOXA-2, (n = 4, strA and strB (n = 17, sul1 (n = 10, sul2 (n = 73, dfrA7 (n = 3 and tet(A (n = 8 were detected and a plasmid localisation was identified for several of the resistance genes.

Retrospective Analysis of Bacterial and Viral Co-Infections in Pneumocystis spp. Positive Lung Samples of Austrian Pigs with Pneumonia.

Directory of Open Access Journals (Sweden)

Christiane Weissenbacher-Lang

Full Text Available Aim of this study was the retrospective investigation of viral (porcine circovirus type 2 (PCV2, porcine reproductive and respiratory syndrome virus (PRRSV, torque teno sus virus type 1 and 2 (TTSuV1, TTSuV2 and bacterial (Bordetella bronchiseptica (B. b., Mycoplasma hyopneumoniae (M. h., and Pasteurella multocida (P. m. co-infections in 110 Pneumocystis spp. positive lung samples of Austrian pigs with pneumonia. Fifty-one % were positive for PCV2, 7% for PRRSV, 22% for TTSuV1, 48% for TTSuV2, 6% for B. b., 29% for M. h., and 21% for P. m. In 38.2% only viral, in 3.6% only bacterial and in 40.0% both, viral and bacterial pathogens were detected. In 29.1% of the cases a co-infection with 1 pathogen, in 28.2% with 2, in 17.3% with 3, and in 7.3% with 4 different infectious agents were observed. The exposure to Pneumocystis significantly decreased the risk of a co-infection with PRRSV in weaning piglets; all other odds ratios were not significant. Four categories of results were compared: I = P. spp. + only viral co-infectants, II = P. spp. + both viral and bacterial co-infectants, III = P. spp. + only bacterial co-infectants, and IV = P. spp. single infection. The evaluation of all samples and the age class of the weaning piglets resulted in a predomination of the categories I and II. In contrast, the suckling piglets showed more samples of category I and IV. In the group of fattening pigs, category II predominated. Suckling piglets can be infected with P. spp. early in life. With increasing age this single infections can be complicated by co-infections with other respiratory diseases.

Cryostored autologous skull bone for cranioplasty? A study on cranial bone flaps' viability and microbial contamination after deep-frozen storage at -80°C.

Science.gov (United States)

Chan, David Yuen Chung; Mok, Yi Tan; Lam, Ping Kuen; Tong, Cindy See Wai; Ng, Stephanie Chi Ping; Sun, Tin Fung David; Poon, Wai Sang

2017-08-01

Craniectomy is a life-saving procedure. Subsequent cranioplasty with autologous skull bone has a bone resorption rate from 4% to 22.8% and an infection rate from 3.3% to 26%. There are concerns with their viability and the potential microbial contamination as they were explanted for a long period of time. Eighteen cranial bone flaps stored at Prince of Wales Hospital Skull Bone Bank during the period from June 2011 to March 2016 were identified. Ethics approval was obtained. Bone chips and deep bone swabs were collected for osteoblast culture and microbial culture. Skull Bone Bank was kept at -80°C under strict aseptic technique during the study period. The storage period ranged from 4months to 55months. For the osteoblast culture, all eighteen bone flaps had no viable osteoblast growth. For the bacterial culture, five had positive bacteria growth (27.8%). Three were Pasteurella multocida and two were Methicillin-resistant Staphylococcus aureus. The mean duration of storage of the infected bone flap was 32.9months (±15.1months) versus 19.9months (±17.9months) of those bone flaps with no bacterial growth (p=0.1716). The mean size of the infected versus non-infected bone flaps was 117.7cm 2 (±44.96cm 2 ) versus 76.8cm 2 (±50.24cm 2 ) respectively (p=0.1318). Although in this study statistical significance was not reached, it was postulated that infected bone flaps tended to be larger in size and had a longer duration of storage. In conclusion, cryostored skull bone flaps beyond four months showed no viable osteoblasts. Bacterial contamination rate of bone flaps was 27.8% in this study. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Aproximación al estudio del vidrio prerromano: los materiales procedentes de la necrópolis ibérica de El Cigarralejo (Mula, Murcia. Composición química de varias cuentas de collar

Directory of Open Access Journals (Sweden)

Ruano Ruiz, Encarnación

1995-06-01

Full Text Available For the first time, all the glass materials found in the excavations of the Iberian cemetery of El Cigarralejo (Mula, Murcia are studied together including those from the published and the unpublished tombs. The small number of glass items in the grave goods found in this Murcian cemetery let us consider them as prestigious adornments, sometimes with prophylactic purposes. As an hypothesis, we can consider that there was a glass workshop near the studied area. The chemical composition of some necklace beads is presented.

El texto agrupa por primera vez todos los materiales de vidrio procedentes de las excavaciones de la necrópolis ibérica de El Cigarralejo (Mula, Murcia, tanto de las tumbas publicadas, como inéditas. El escaso número de objetos de vidrio en los ajuares de la necrópolis murciana permite considerarlos como adornos de prestigio y en algún caso con fines profilácticos. Sólo como hipótesis debemos considerar la existencia de un taller cercano al área estudiada. Se presenta la composición química de algunas cuentas de collar.

Antimicrobial effect of probiotics on bacterial species from dental plaque.

Science.gov (United States)

Zambori, Csilla; Morvay, Attila Alexandru; Sala, Claudia; Licker, Monica; Gurban, Camelia; Tanasie, Gabriela; Tirziu, Emil

2016-03-31

The antimicrobial role of probiotic Lactobacillus casei subspecies casei DG (L. casei DG) and of the mix culture of probiotic Lactobacillus acidophilus LA-5 and Bifidobacterium BB-12 was tested on species of Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera from supragingival sites from dogs with dental disease of different breed, age, sex, weight, and diet. The research was conducted on these four genera because of their importance in zoonotic infections after dog bites. Species from Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera were isolated and identified. To test the antimicrobial efficacy of L. casei DG and the mixed culture of probiotic L. acidophilus LA-5 and Bifidobacterium bifidum BB-12 on the pathogenic species, the agar overlay method was used. L. casei DG had a bactericidal effect on all analyzed species isolated from Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera after 24 hours of incubation. The mixed probiotic culture made up of L. acidophilus LA-5 and Bifidobacterium BB-12 species had no bactericidal effect on the species of Staphylococcus and Streptococcus genera, which were resistant. However, it had a bacteriostatic effect on several species of Pasteurella and Neisseria genera. This work highlights the antimicrobial potential of probiotics in vitro, demonstrating that the probiotic L. casei DG has a bactericidal effect on all analyzed species isolated from dental plaque and that the mix culture of probiotic L. acidophilus LA-5 and Bifidobacterium BB-12 has only a bacteriostatic effect.

Development of a PCR test for identification of Haemophilus somnus in pure and mixed cultures

DEFF Research Database (Denmark)

Angen, Øystein; Ahrens, Peter; Tegtmeier, Conny

1998-01-01

a single colony of H. somnus in the presence of 10(9) CFU of P. multocida even after 2 days of incubation. In conclusion, the present PCR test has been shown to represent a specific test for identification of H. somnus both in pure and mixed cultures. It represents a quick, sensitive and reliable method...... rise to an amplicon in the PCR test. The performance of the test on mixed cultures was evaluated by adding P. multocida to serial dilutions of H. somnus and incubating the agarplates for 1 and 2 days. This showed that the PCR test applied to the harvest from an agarplate can be expected to detect...

Caracterización de escorias metalúrgicas procedentes de yacimientos arqueológicos de Navarra (Siglos II a.C.- IV d.C.

Directory of Open Access Journals (Sweden)

Ros-Latienda, L.

2013-12-01

Full Text Available The Archaeology Section of the Government of Navarre put forward a proposal to undertake research in the characterization of a set of pieces from 2nd century B.C. to 4th century A.D. retrieved from excavations in different archaeological sites in this province, to obtain data related to the manufacturing process of the investigated artefacts and to compare the level of technical skills in different times and places, so as to achieve a better understanding of technological abilities and material culture. The finds discussed in this paper are of interest from an archaeometallurgical point of view, and they consist mainly of metallurgical slags, remains of manufactured pieces, and minerals residues used to obtain various metals. In addition to carrying out their chemical analyses by inductively coupled plasma (ICP, the study of six samples was performed by optical and scanning electron microscopy and energy-dispersive X-ray microanalysis (EDX which revealed the composition of large areas of the slags, and the study was finally completed by the determination of the phases present by X rays diffraction.Desde la Sección de Arqueología del Gobierno de Navarra llegó la propuesta de caracterizar una serie de piezas comprendidas entre el siglo II a.C. y el siglo IV d.C. procedentes de yacimientos arqueológicos de esta provincia con objeto de obtener datos relacionados con la tecnología que las produjo y poder comparar el grado de desarrollo técnico de diferentes épocas y lugares. Interesaba el estudio de estas piezas desde el punto de vista metalúrgico, habiendo entre ellas mayoritariamente escorias metalúrgicas, restos de piezas fabricadas y restos minerales utilizados en la obtención de diversos metales. Además de proceder a su análisis químico mediante técnica de plasma acoplado inductivamente (ICP, se estudiaron seis muestras mediante microscopía óptica, electrónica de barrido y microanálisis por energía dispersiva de rayos X (EDAX

Primer registro de cráneos asignados a Palaeospheniscus (Aves, Spheniscidae procedentes de la Formación Bahía Inglesa (Mioceno Medio-tardío, Chile First record of skulls assigned to Palaeospheniscus (Aves, Spheniscidae from the Bahía Inglesa formation (middle-late Miocene, Chile

Directory of Open Access Journals (Sweden)

CAROLINA ACOSTA HOSPITALECHE

2005-09-01

Full Text Available Los cráneos de los Spheniscidae (como los de todas las aves, aunque escasos en el registro paleontológico, muestran importantes caracteres a nivel taxonómico. Hasta el momento se conocían solo seis cráneos en todo el mundo: Paraptenodytes antarctica y una nueva especie de Spheniscidae procedentes de las formaciones Gaiman (Mioceno temprano y Puerto Madryn (Mioceno tardío de Argentina, respectivamente; Spheniscus megaramphus y 3S. urbinai de la formación Pisco (Mioceno tardío de Perú, Marplesornis novaezealandiae del Plioceno de Nueva Zelanda y un resto de Sphenicidae cf Spheniscus procedente de la formación Bahía Inglesa (Mioceno medio-tardío. De esta última unidad provienen cinco restos craneanos recientemente descubiertos en la localidad de Caldera (Región de Atacama, Chile, los cuales fueron descritos y asignados preliminarmente a Palaeospheniscus. Estos materiales constituyen el primer registro de cráneos para la especie y significan un importante aporte al conocimiento de la avifauna fósil de Chile y en particular de la formación Bahía InglesaAlthough the skulls of the Spheniscidae are unusual in the paleontologic record, they show important features useful in the systematics of the group, as well as in the rest of the birds. Until now, fossil occurrences were restricted to six skulls: Paraptenodytes antarctica and one new species from the Gaiman formation (Early Miocene and Puerto Madryn formation (late Miocene of Argentina, respectively; Spheniscus megaramphus and S. urbinai from the Pisco Formation (Late Miocene, Perú; Marplesornis novaezealandiae from New Zealand (Pliocene; and Spheniscidae cf. Spheniscus from the Bahía Inglesa Formation (Middle-Late Miocene, Chile. Five new materials have been exhumed from this last unit. These skulls, which come from the Caldera locality (Region of Atacama, Chile, have been preliminarily assigned to Palaeospheniscus (Aves, Spheniscidae, constituting the first skulls described for

Cobre para los muertos. Estudio arqueométrico del material metálico procedente del monumento megalítico prehistórico de Castillejo del Bonete (Terrinches, Ciudad Real

Directory of Open Access Journals (Sweden)

Ignacio MONTERO RUIZ

2014-06-01

Full Text Available Castillejo del Bonete es una cueva que fue utilizada y adaptada como monumento funerario durante la Prehistoria reciente. Abundantes piezas metálicas en óptimo estado de conservación se han recuperado de los túmulos construidos encima de la cueva, tanto en el interior de tumbas como fuera de ellas. El objetivo de este trabajo es presentar la colección metálica del yacimiento recuperada hasta finales de 2012. También el estudio arqueometalúrgico de varias de las piezas y una interpretación del conjunto en relación a su ámbito cultural y territorial. La investigación además incorpora datos inéditos de El Acequión, Albacete, para proporcionar una perspectiva comparativa sobre la procedencia del metal en la Edad del Bronce con los datos disponibles del área argárica. Las piezas metálicas son explicadas en sus respectivos contextos arqueológicos antes de ser analizadas por diferentes métodos y técnicas: isótopos de plomo, espectrometría por fluorescencia de rayos X, microscopía electrónica de barrido con microanálisis por espectrometría de dispersión de energías de rayos X, metalografía y análisis de microdureza. Los resultados revelan tipos y procesos metalúrgicos característicos del Calcolítico y fases antiguas de la Edad del Bronce. En general son piezas sin estaño pero con alto contenido en arsénico, procedentes en buena parte del área de Linares.

Masked rat: an x-ray-induced mutant with chronic blepharitis, alopecia, and pasteurellosis

International Nuclear Information System (INIS)

Kent, R.L.; Lutzner, M.A.; Hansen, C.T.

1976-01-01

An autosomal recessive mutation had been previously x-ray-induced in the rat and named the masked rat (genotype mk/mk). This study describes the mutant's appearance, histology, and microflora. The rat's eyelids were swollen, often to the point of closure, and its face was partially covered by a brownish crust, giving the mutant a mask-like appearance. The chronic blepharitis was also accompanied by alopecia that appeared as bare patches across the mutant's back. Pasteurella pneumotropica was found in eyelids and on skin from all masked rats. The normal rat demonstrated a resistance to Pasteurella pneumotropica infection, or, conversely, the masked rat appeared to be genetically predisposed to pasteurellosis

Pets and Pasteurella Infections

Science.gov (United States)

... present in some children, including an infection of the joints ( arthritis ), bones (osteomyelitis), and tendons (tenosynovitis). Less frequently, youngsters may have pneumonia , urinary tract ...

21 CFR 520.2261b - Sulfamethazine powder.

Science.gov (United States)

2010-04-01

... and bovine respiratory disease complex (shipping fever complex) (Pasteurella spp.), colibacillosis... (F. necrophorum), acute mastitis (Streptococcus spp.), and acute metritis (Streptococcus spp.) (iii...

Microbial flora of odontogenic abscesses in pet guinea pigs.

Science.gov (United States)

Minarikova, A; Hauptman, K; Knotek, Z; Jekl, V

2016-10-01

Abscesses of odontogenic origin in guinea pigs pose a serious health problem and need to be treated with a combination of surgical and medical therapy. The aim of this prospective study was to describe the microbial flora of odontogenic abscesses associated with osteomyelitis in 24 pet guinea pigs, to perform antibiotic sensitivity testing, and to make recommendations for practitioners on the antibiotics of first choice. Inclusion criteria for the study included the animal being diagnosed with an odontogenic abscess which underwent surgery and was not pre-treated with an antibiotic. Inclusion criteria matched for 24 guinea pigs. Samples (pus, capsule and affected tooth/bone) for bacteriological examination were collected under sterile conditions during the surgical procedure. The most commonly isolated bacteria from abscesses of odontogenic origin were Bacteroides fragilis in 12.8 per cent (6/47) of cases, Pasteurella multocida in 10.6 per cent (5/47) and Peptostreptococcus anaerobius in 8.5 per cent (4/47). Aerobic bacterial species only were isolated in 29.2 per cent (7/24) of cases, anaerobic bacteria only were isolated in 33.3 per cent (8/24), and mixed infection with anaerobic and aerobic bacterial species was seen in 37.5 per cent (9/24). Aerobes (n=20) were sensitive to enrofloxacin and marbofloxacin in 100 per cent of samples, benzylpenicillin potassium (penicillin G, PNCG) in 90 per cent, cephalotin in 85 per cent, amoxicillin-clavulanate in 75 per cent, doxycycline in 70 per cent, gentamicin in 65 per cent and trimethoprim-sulfamethoxazole in 55 per cent. Anaerobes (n=27) were sensitive to amoxicillin-clavulanate in 100 per cent of cases, clindamycin in 96.3 per cent, metronidazole in 92.6 per cent, PNCG in 92.6 per cent and cephalotin in 74.1 per cent. As guinea pigs are strictly herbivorous animals, based on the results of this study the recommended antibiotic treatment for odontogenic abscesses is a combination of fluoroquinolones and metronidazole

Untitled

African Journals Online (AJOL)

cholera result in significant economic losses to susceptibility to ... standardized single disk method and minimal multocida .... using a panel of 16 reference antibodies against rhamnose .... horizontal transmission within the bacterial on our in ...

Caracterización y estado de conservación de vidrios tardorromanos del Museo Arqueológico Regional de Madrid procedentes de las necrópolis de Cubas de la Sagra

Directory of Open Access Journals (Sweden)

Fernando Agua

2015-03-01

Full Text Available Se ha caracterizado un conjunto de vidrios tardorromanos hallado en las necrópolis de Cubas de la Sagra y depositado actualmente en el Museo Arqueológico Regional de Alcalá de Henares (Madrid. Dicho conjunto procede del yacimiento de Camino de Santa Juana, localizado en el Sur de la Comunidad de Madrid. Los objetivos consistieron en determinar, por un lado, la composición química y los cromóforos responsables de la tonalidad de los vidrios; y por otro lado, evaluar su estado de conservación para seleccionar la estrategia de conservación preventiva más adecuada para su depósito o exposición en el museo. En el primer caso se analizaron un total de 14 muestras procedentes de ambas necrópolis; y para evaluar su estado de conservación se analizaron muestras de restos del sedimento que circundaba los vidrios para determinar su pH, sus fases mineralógicas y su influencia en el grado de deterioro de los vidrios. El estudio se ha llevado a cabo mediante técnicas convencionales: lupa binocular, espectrometría de fluorescencia de rayos X, difracción de rayos X, microscopía electrónica de barrido de emisión de campo con microanálisis de dispersión de energía de rayos X y espectrofotometría visible. Los resultados han servido para contextualizar arqueométricamente los vidrios en el conjunto de vidrios tardorromanos de la Península Ibérica analizados hasta el momento.

21 CFR 520.2170 - Sulfabromomethazine sodium boluses.

Science.gov (United States)

2010-04-01

... pneumonia and bovine respiratory disease complex (shipping fever complex) associated with Pasteurella spp.; acute metritis and acute mastitis caused by Streptococcus spp. (3) Limitations. Administer orally...

A Comparative Study of the Oral Microbiome Compositions of ...

African Journals Online (AJOL)

2017-12-05

Dec 5, 2017 ... external factors such as oral hygiene practices,[6] types. Original Article ..... exclusive bacterial species; Porphyromonas gingivalis,. Pasteurella pneumotropica, Tannerella .... oral health and disease. Virulence 2014;5:424-32.

Usage of antimicrobials and occurrence of antimicrobial resistance among bacteria from mink

DEFF Research Database (Denmark)

Pedersen, Karl; Hammer, Anne Sofie; Sørensen, Charlotte Mark

2009-01-01

, whereas resistance to other antimicrobials was rare. All P aeruginosa were sensitive to gentamicin and colistin and sensitive or intermediate to enrofloxacin. whereas most isolates were resistant to all other antimicrobials. All P. multocida and haemolytic streptococci were sensitive to penicillin...

Análisis iconográfico preliminar de fragmentos de las vasijas estilo códice procedentes de Calakmul A preliminary iconographic analysis of codex style vessels from Calakmul

Directory of Open Access Journals (Sweden)

Ana García Barrios

2011-01-01

Full Text Available Las cerámicas estilo códice fueron elaboradas durante la segunda mitad del siglo VII y principios del VIII d.C. en un área de la Cuenca del Mirador que abarca ciudades como Nakbé, Tintal, Pacaya y otras como Calakmul. En este último lugar se han recuperado en los últimos años más de 700 fragmentos cerámicos que tienen un gran parecido estilístico con muchas de las temáticas de las vasijas que se encuentran en colecciones privadas y museos, todas ellas procedentes del saqueo masivo de la década de los setenta. Entre los temas reconocidos en los fragmentos de Calakmul se encuentran diferentes episodios del mito del Dios del Maíz, así como el lanzamiento del Bebé Jaguar y otros episodios donde participa el Dios Viejo, así como el título ampliamente empleado en estas cerámicas que designa a un grupo de poder conocido como chatan winik.The codex style vessels were elaborated during second half of 7th century and the beginning of 8th century A.C., in the area of "Cuenca del Mirador" that includes cities like Nakbé, Tintal, Pacaya and Calakmul. In this city, in the past last years, there has been a recovery of more than 700 ceramic fragments, which have a great stylistic similarity with many of the thematic ceramics which are in private collections and museums, all of them coming from the massive sacking during 70's years. Between the subjects recognized in the fragments of Calakmul, it can be found different episodes from the myth of God of maíz, as well as the launching of "baby jaguar" or Unen B'ahlam, along with other subjects where the Old God participates, and the title widely used in these vessels designates a group of power known as chatan winik.

VILLA ROMANA DE EL SAUCEDO (TALAVERA LA NUEVA, TOLEDO. ANÁLISIS ARQUEOMÉTRICO DE LAS TESELAS PROCEDENTES DE LOS PAVIMENTOS MUSIVARIOS DEL ESPACIO CONVIVIAL (The Roman Villa of El Saucedo, Talavera la Nueva, Toledo: Archaeometric Analysis of the Tessellae from the Mosaic Pavements of a Convivial Space

Directory of Open Access Journals (Sweden)

Raquel Castelo

2016-09-01

Full Text Available Presentamos un estudio arqueométrico de un conjunto de teselas procedentes de los mosaicos que solaron algunas de las salas del espacio convivial, en el que pudieron llegar a reunirse hasta un total de 27 comensales. Los datos aportados por la difracción de rayos X y el estudio con microscopio han permitido determinar la composición mineralógica de las teselas y plantear hipótesis sobre su identificación petrográfica; sugiriéndose el empleo de diferentes tipos de rocas (cuarzoarenitas, cuarcitas y mármoles calcáreos que ofrecían una paleta de colores amplia. ENGLISH: We present an archaeometric study of a group of tessellae from the floor mosaics of the Villa de Saucedo’s convivial space (a room with place for 27 guests. Data provided by X-ray diffraction and microscopic examination revealed the mineralogical composition of the tessellae and therefore allowed some hypotheses regarding their petrographic identification. The data suggest the use of different kinds of rocks (quartzarenites, quartzites and calcareous marbles, which allowed for a broad color palette.

The diagnostic activity on wild animals through the description of a ...

African Journals Online (AJOL)

The diagnostic activity on wild animals through the description of a model case report (caseous lymphadenitis by Corynebacterium pseudotuberculosis associated with Pasteurella spp and parasites infection in an alpine ibex – Capra ibex )

Potencial productivo de esquejes de boniato (Ipomoea batatas (L. Lam. procedentes de una nueva tecnología de producción de semilla agámica.

Directory of Open Access Journals (Sweden)

Roberto Díaz Hernández

2012-01-01

Full Text Available RESUMEN El trabajo se realizó en el Instituto de Investigaciones en Viandas Tropicales durante el periodo de septiembre del 2008 a abril 2009, con los objetivos de determinar la cantidad de esquejes que proporciona el vivero y la frecuencia de corte, así como comparar el potencial productivo de cada corte. El Experimento consistió en el montaje de cámaras de aproximadamente 1m de ancho y 15m de largo, se utilizaron raíces tuberosas del clon comercial INIVIT B2-2005 como material de plantación. Se comprobó que durante la fase del vivero este proporcionó un total de nueve cortes tanto en la época frío como en primavera con un total de 764 y 1390 esquejes respectivamente. Después de cortados los esquejes fueron llevados al campo donde se realizó un estudio para determinar los rendimientos correspondientes a cada tratamiento (número de cortes. Se utilizó un diseño de bloques al azar con cuatros réplicas. Los resultados mostraron que en pequeñas áreas de viveros se puede obtener un número significativo de esquejes y de muy buena calidad productiva además de que los esquejes procedentes de diferentes momentos de cortes presentan igual comportamiento en cuanto al rendimiento. Productive potential of sweetpotato (Ipomoea batatas (L. Lam cuttings from a new technology for agamic seed production. ABSTRACT The work was conducted at the Research Institute of Tropical Root and Tuber Crops from September 2008 to April 2009 with the objectives of determining the amount of cuts provided by the nursery and cut frequency, as well as, to compare the productive potential of each cut. The experiment consisted of mounting chambers about 1m wide and 15m long. Tuberous roots from the commercial clone INIVIT B2-2005 were used as planting seeds. During the nursery stage, nine cuts were provided in the winter and rainy seasons with a total of 764 and 1390 cuttings respectively. Cuttings were transferred to field conditions to determine corresponding

21 CFR 520.90b - Ampicillin trihydrate tablets.

Science.gov (United States)

2010-04-01

..., tonsillitis, and bronchitis due to Streptococcus spp., Staphylococcus spp., Escherichia coli, Proteus mirabilis, and Pasteurella spp., urinary tract infections (cystitis) due to Streptococcus spp., Staphylococcus spp., E., coli, P. mirabilis, and Enterococcus spp.; gastrointestinal infections due to...

Extracción y reología de Betaglucanos de cebada y elaboración de masas de pan sin gluten enriquecidas con los extractos

OpenAIRE

Rivero Hernández, Miguel

2012-01-01

La materia prima utilizada ha sido la cebada H13 tipo waxy, una cebada desnuda, es decir sin cáscara, con un contenido de beta-glucanos del 4,51%, de la que se obtuvieron tres extractos distintos: el primero procedente de la harina integral de la cebada (18,8 % de -glucanos), el segundo de esa misma harina integral tratada con etanol para inactivar las betaglucanasas (21,5 % de -glucanos), y el tercero procedente de la fracción gruesa de la molienda pretratada igualmente con ...

A rapid minor groove binder PCR method for distinguishing the vaccine strain Brucella abortus 104M.

Science.gov (United States)

Nan, Wenlong; Qin, Lide; Wang, Yong; Zhang, Yueyong; Tan, Pengfei; Chen, Yuqi; Mao, Kairong; Chen, Yiping

2018-01-24

Brucellosis is a widespread zoonotic disease caused by Gram-negative Brucella bacteria. Immunisation with attenuated vaccine is an effective method of prevention, but it can interfere with diagnosis. Live, attenuated Brucella abortus strain 104M has been used for the prevention of human brucellosis in China since 1965. However, at present, no fast and reliable method exists that can distinguish this strain from field strains. Single nucleotide polymorphism (SNP)-based assays offer a new approach for such discrimination. SNP-based minor groove binder (MGB) and Cycleave assays have been used for rapid identification of four Brucella vaccine strains (B. abortus strains S19, A19 and RB51, and B. melitensis Rev1). The main objective of this study was to develop a PCR assay for rapid and specific detection of strain 104M. We developed a SNP-based MGB PCR assay that could successfully distinguish strain 104M from 18 representative strains of Brucella (B. abortus biovars 1, 2, 3, 4, 5, 6, 7 and 9, B. melitensis biovars 1, 2 and 3, B. suis biovars 1, 2, 3 and 4, B. canis, B. neotomae, and B. ovis), four Brucella vaccine strains (A19, S19, S2, M5), and 55 Brucella clinical field strains. The assay gave a negative reaction with four non-Brucella species (Escherichia coli, Pasteurella multocida, Streptococcus suis and Pseudomonas aeruginosa). The minimum sensitivity of the assay, evaluated using 10-fold dilutions of chromosomal DNA, was 220 fg for the 104M strain and 76 fg for the single non-104M Brucella strain tested (B. abortus A19). The assay was also reproducible (intra- and inter-assay coefficients of variation = 0.006-0.022 and 0.012-0.044, respectively). A SNP-based MGB PCR assay was developed that could straightforwardly and unambiguously distinguish B. abortus vaccine strain 104M from non-104M Brucella strains. Compared to the classical isolation and identification approaches of bacteriology, this real-time PCR assay has substantial advantages in terms of

Antioxidant, antibacterial activity, and phytochemical characterization of Melaleuca cajuputi extract.

Science.gov (United States)

Al-Abd, Nazeh M; Mohamed Nor, Zurainee; Mansor, Marzida; Azhar, Fadzly; Hasan, M S; Kassim, Mustafa

2015-10-24

The threat posed by drug-resistant pathogens has resulted in the increasing momentum in research and development for effective alternative medications. The antioxidant and antibacterial properties of phytochemical extracts makes them attractive alternative complementary medicines. Therefore, this study evaluated the phytochemical constituents of Melaleuca cajuputi flower and leaf (GF and GL, respectively) extracts and their antioxidant and antibacterial activities. Radical scavenging capacity of the extracts was estimated using 2,2-diphenyl-2-picrylhydrazyl and Fe(2+)-chelating activity. Total antioxidant activity was determined using ferric reducing antioxidant power assay. Well diffusion, minimum inhibitory concentration, and minimum bactericidal concentration assays were used to determine antibacterial activity against eight pathogens, namely Staphylococcus aureus, Escherichia coli, Bacillus cereus, Staphylococcus epidermidis, Salmonella typhimurium, Klebsiella pneumonia, Streptococcus pneumoniae, and Pasteurella multocida. We identified and quantified the phytochemical constituents in methanol extracts using liquid chromatography/mass spectrometry (LC/MS) and gas chromatography (GC)/MS. This study reports the antioxidant and radical scavenging activity of M. cajuputi methanolic extracts. The GF extract showed better efficacy than that of the GL extract. The total phenolic contents were higher in the flower extract than they were in the leaf extract (0.55 ± 0.05 and 0.37 ± 0.05 gallic acid equivalent per mg extract dry weight, respectively). As expected, the percentage radical inhibition by GF was higher than that by the GL extract (81 and 75 %, respectively). A similar trend was observed in Fe(2+)-chelating activity and β-carotene bleaching tests. The antibacterial assay of the extracts revealed no inhibition zones with the Gram-negative bacteria tested. However, the extracts demonstrated activity against B. cereus, S. aureus, and S. epidermidis. In

Pharmacokinetics (PK), pharmacodynamics (PD), and PK-PD integration of ceftiofur after a single intravenous, subcutaneous and subcutaneous-LA administration in lactating goats.

Science.gov (United States)

Fernández-Varón, Emilio; Cárceles-García, Carlos; Serrano-Rodríguez, Juan Manuel; Cárceles-Rodríguez, Carlos M

2016-10-13

Bacterial pneumonia in goats is usually caused by Mannheimia haemolytica and Pasteurella multocida. Another important infection disease in lactating goats is intramammary infection producing mastitis, usually associated with coagulase-negative Staphylococcus spp. However, treatment of bacterial pneumonia in goats not affected by mastitis problems should be restricted to antimicrobials with scant penetration to milk in order to avoid long withdrawal times. Ceftiofur is a third-generation cephalosporin antimicrobial with activity against various gram-positive and gram-negative, aerobic and anaerobic bacteria encountered by domestic animals. The objectives of the present study were to establish the serum concentration-time profile for ceftiofur in lactating goats after intravenous, subcutaneous and a SC-long-acting ceftiofur formulation; to determine ceftiofur penetration into milk; to determine in vitro and ex vivo activity of ceftiofur establishing MIC, MBC, MPC and time-kill profiles against field strains of M. haemolytica and finally to calculate the main surrogate markers of efficacy. The pharmacokinetics studies revealed an optimal PK properties for the SC-LA formulation tested. Ceftiofur was well absorbed following SC and SC-LA administration, with absolute bioavailabilities (F) of 85.16 and 84.43 %, respectively. After ceftiofur analysis from milk samples, no concentrations were found at any sampling time. The MIC, MBC and MPC data of ceftiofur against five M. haemolytica strains isolated from goats affected by pneumonia were tested showing excelent sensitivity of ceftiofur against this pathogen. For PK-PD analysis, ratios were calculated suggesting a high level of bacterial kill against the five strains of M. haemolytica tested. The systemic ceftiofur exposure achieved in lactating goats following IV, SC and especially with the SC-LA administration is consistent with the predicted PK-PD ratios needed for a positive therapeutic outcome for M. haemolytica

Viabilidad de la aplicación de materiales reciclados y cenizas de biomasa en la fabricación de materiales tratados con cemento

OpenAIRE

Cabrera Montenegro, Manuel

2016-01-01

La presente Tesis Doctoral es una contribución al conocimiento y la investigación sobre el uso de áridos reciclados y cenizas de fondo procedentes de la combustión de biomasa para su uso en ingeniería civil. El interés en el uso de áridos reciclados procedentes de residuos de construcción y demolición (RCD) están en continuo crecimiento debido a su potencial frente a diversos usos, entre ellos como material tratado con cemento para capas estructurales de carretera. Por ot...

Cultivo de microalgas para la fabricación de biopetroleo por licuefacción

OpenAIRE

Reguera Álvarez, Ricardo

2013-01-01

El objetivo obtener un barril de petróleo procedente del tratamiento hidrotermico de 20g de biomasa en 150ml de agua; procedente de la Chlorella vulgaris, mediante un crecimiento de alta densidad en fotobiorreactores tubulares. La capacidad productiva en volumen del cultivo es de 0.90 g/ld-1 y una productividad por área de 66.47 g/m2d-1. El consumo energético total de 309.44 Kwh, y una potencia por superficie en la fase exponencial de 2.58 w/m2

Características neuropsicológicas y dificultades de aprendizaje en una muestra de niños adoptados

OpenAIRE

González, Beatriz

2012-01-01

Los niños procedentes de Adopción Internacional representan un grupo significativo en la población escolar española. Existe una importante prevalencia de dificultades de aprendizaje en esta población. Se presenta un estudio descriptivo transversal, realizado en Madrid en mayo y junio de 2012 en el que se han estudiado distintos factores neuropsicológicos en relación con dificultades de aprendizaje de 31 niños procedentes de Adopción Internacional. El tiempo de institucionalización se en...

Guía de materiales reciclados en la construcción “+live”

OpenAIRE

Herrera Martín, José Adolfo

2013-01-01

El objeto de este trabajo es la presentación de guía para la utilización y difusión de materiales procedentes de labores de reciclado y su aplicación en procesos constructivos. La guía persigue los siguientes aspectos: - El conocimiento de materiales procedentes del reciclado, que tienen un uso eficaz en procesos constructivos, en una base de datos. - La generación de una base de datos actualizada que permita la fácil incorporación de nuevos productos y técnicas constructiva...

El origen y evolución temprana de las serpientes : Análisis anatómico y filogenético de los ofidios cretácicos y paleógenos de la Patagonia y Bolivia

OpenAIRE

Scanferla, Carlos Agustín

2010-01-01

Este trabajo de tesis doctoral tiene como objetivo principal el análisis de dos relevantes escamados procedentes del Cretácico Superior de la Patagonia Argentina, Najash rionegrina y Dinilysia patagonica, como así también dos nuevas serpientes avanzadas del grupo de los Macrostomata, (denominados Taxón A y B) procedentes de la localidad del Terciario Inferior (Paleoceno) de Tiupampa, Bolivia. Se realizó un análisis anatómico detallado de estos taxones fósiles en conjunto con un gran número de...

La estela de El Carpio (Córdoba); avance a una nueva manifestación simbólica del bronce final en la vega media del Guadalquivir

OpenAIRE

Martínez Sánchez, Rafael M.ª

2008-01-01

Se presenta un avance al reciente descubrimiento de una nueva estela del Bronce Final procedente de la localidad cordobesa de El Carpio, hallada reutilizada en la torre medieval de dicha población. La inclusión de dos figuras humanas en el monumento dentro de una aparente jerarquía compositiva y la dinámica escénica de la representación conservada nos obliga a relacionarla con ejemplos coetáneos procedentes del Valle del Guadalquivir, uno de cuyos exponentes más espectacu...

Sobre el armamento defensivo de los soldados romanos en el siglo IV d.C: a propósito de un relieve de Córdoba

OpenAIRE

Menéndez Argüín, Adolfo Raúl; Beltrán Fortes, José

2001-01-01

En este artículo se presenta una pieza procedente de un sarcófago romano de Madinat al-Zahra (Córdoba) fechado en el s. IV d.C. en la que puede observarse claramente un individuo equipado con cota de malla. Este es uno de los pocos documentos gráficos de soldados equipados con armadura procedentes del s. IV, de ahí la trascendencia de la pieza y su inclusión como una evidencia más de la continuidad de las protecciones corporales durante el Imperio Tardío.

Characterisation of a novel Mannheimia sp from Australian feedlot cattle

DEFF Research Database (Denmark)

Blackall, P.J.; Angen, Øystein; Fegan, N.

2001-01-01

glucosida, M granulomatis, M ruminalis and M varigena - using a range of phenotypic and genotypic methods. Results Phenotypic characterisation indicated that the isolates belonged to the trehalose-negative [Pasteurella] haemolytica complex. This complex has recently been reorganised into five species within...

Caracterización físico - química de las fibras obtenidas del pseudotallo de la planta de banano (Musa paradisiaca, procedente del cantón El Guabo de la provincia de El Oro

Directory of Open Access Journals (Sweden)

Linda Maldonado

2016-06-01

Full Text Available Los residuos de plantaciones bananeras a nivel mundial, representan en la actualidad una alternativa más viable en la elaboración de materia prima para la industria textil, construcción y la elaboración de artesanías en general. En este trabajo, se presentan los resultados preliminares de la Caracterización fisico - químicas de las fibras obtenidas del pseudotallo de banano (Musa paradisiaca. Se trabajó con pseudotallos de la variedad Filipino, procedente de la Bananera "Yesi", ubicada en la parroquia El Retiro, del cantón El Guabo, provincia de El Oro - Ecuador. Se empleó métodos electrométricos para la determinación del pR, y 10 descrito por la AOAC para el porcentaje de fibras, celulosa y densidad aparente. Los resultados se obtuvieron por triplicado para su posterior análisis estadístico con el programa InfoStat 2010, en la determinación de la medias y los índices de confianza de los datos obtenidos. El pseudotallo presentó un 16.28 % de fibras; 9.53% de densidad aparente; y un 30.1 % de celulosa, resultados que le confieren a este residuo, una aceptable condición de porosidad y muy buen porcentaje de celulosa, que favorece la compactación del material en el proceso de fabricación de aglomerados. Considerando que el 67% del volumen total de producción bananera 10 constituyen sus desechos (pseudotallo, hojas y raquis, este estudio promete ser un plus en los ingresos de los campesinos del sector, con la finalidad de otorgar valor agregado y ecológico a estos residuos.

¿La Apoteosis de Heracles o una escena de Apobates? A propósito de una cratera de campana procedente de La Loma del Escorial de Los Nietos (Cartagena, Murcia

Directory of Open Access Journals (Sweden)

Rodríguez Pérez, Diana

2014-12-01

Full Text Available The aim of this article is to assess the traditional iconographic identification of the obverse of a 4th century Greek bell crater from the Iberian site of La Loma del Escorial de Los Nietos (Cartagena, Murcia. The scene has been identified as an apotheosis of Heracles. Nevertheless, a detailed analysis of its iconography and of a feature neglected in the previous study of the vase by its excavators —the remains of a shield— make it possible to argue in favor of an apobates race instead —the only scene of this type attested in the Iberian Peninsula. I present here an analysis of both iconographic motifs —the apotheosis of Heracles and the apobates race— that will reveal interesting findings on the ways in which images and iconographic types acquire meaning. It also sheds light on the kind of images favored by the receptors of these vases in the Peninsula — the Iberians. An up-to-date catalogue of Attic vases depicting each theme is included.En el presente artículo se revisa la identificación iconográ- fica de la cara A de una cratera griega fragmentaria del siglo IV a.C. procedente del yacimiento ibérico de La Loma del Escorial de Los Nietos (Cartagena, Murcia. La escena se ha identificado tradicionalmente como la apoteosis de Heracles, no obstante, tras un análisis detallado de la misma, en particular del resto de un escudo previamente inadvertido que porta el personaje principal, creemos que la iconografía se corresponde con la del apobates victorioso, un unicum en la Península Ibérica. Presentamos un análisis de ambos motivos iconográficos que revelará interesantes conclusiones sobre el funcionamiento de los tipos iconográficos y mecanismos de creación de significado en la pintura de vasos de la época, así como sobre el tipo de imágenes estimadas por los receptores de esas piezas en la Península Ibérica, los íberos. Se incluye también un catálogo actualizado de los vasos áticos que portan ambos temas.

Nueva estela procedente de Libia (La Rioja

Directory of Open Access Journals (Sweden)

Beltrán Lloris, Francisco

2005-12-01

Full Text Available Note on a decorated stela from the so called 'Herramélluri workshop' (La Rioja in Libia bearing a Latin inscription with a Celtic name (Gustuna not attested until now.Nota sobre una nueva inscripción latina realizada sobre una estela decorada del llamado "taller de Herramélluri" (La Rioja, la antigua Libia, con un nombre céltico no atestiguado hasta ahora: Gustuna.

Ulcera cutanea provocada por hongos del genero Fusarium

Directory of Open Access Journals (Sweden)

Negroni Ricardo

1997-01-01

Full Text Available Se presenta el caso de un paciente oriundo y procedente del Paraguay, de 40 años de edad, portador de una ulceración crónica en cara externa del pie izquierdo, de 2 meses de evolución, debida a una hialohifomicosis por Fusarium oxysporum. Se destacan las características clínicas, métodos de diagnóstico y terapeútica de esta micosis, además de las diferentes etiologías a considerar en el diagnóstico diferencial de una úlcera en personas procedentes del área tropical o subtropical.

Estudio del material óseo humano de los yacimientos de Larrarte y Trikuaizti I (Gipuzkoa.

Directory of Open Access Journals (Sweden)

Itxaso Merino

1991-01-01

Full Text Available Se describen los restos óseos humanos procedentes del dolmen de Larrarte y tres piezas dentarias procedentes del túmulo de Trikuaizti I, ambos de Beasain (Gipuzkoa. En Larrarte se hallaron numerosos restos óseos humanos, muy fragmentados y en muy malas condiciones de conservación, hecho que ha imposibilitado su diagnóstico sexual. El estudio demográfico ha permitido deducir la existencia de un número mínimo de 12 individuos de los que dos son infantiles: uno de 4-5 años y otro de 12-15 años.

Evaluación de las Consecuencias de la Nueva Regulación de la OMI sobre Combustibles Marinos

OpenAIRE

Manuel López, Francisco de

2015-01-01

El 10 de octubre de 2008 la Organización Marítima Internacional (OMI) firmó una modificación al Anexo VI del convenio MARPOL 73/78, por la que estableció una reducción progresiva de las emisiones de óxidos de azufre (SOx) procedentes de los buques, una reducción adicional de las emisiones de óxidos de nitrógeno (NOx), así como límites en las emisiones de dióxido de Carbono (CO2) procedentes de los motores marinos y causantes de problemas medioambientales como la lluvia ácida y efecto invernad...

鸭多杀性巴氏杆菌外膜蛋白A基因表达及抗原性鉴定%Cloning and Expression of the omp A Gene of pasteurella multocida

Institute of Scientific and Technical Information of China (English)

孙龚; 郭东春; 刘家森; 姜骞; 司昌德; 林欢; 韩凌霞; 崔玉东; 曲连东

2010-01-01

根据已发表的Pm 70株的序列(GenBank登录号:AE004439)设计了两对引物,用PCR方法扩增了鸭多杀性巴氏杆菌标准株C48-102的外膜蛋白基因A(omp A),扩增的片段为1 062 bp.将测序结果与GenBank中多杀性巴氏杆菌P52、PM 70、T931317、194289的omp A序列比对结果表明,核苷酸水平上同源性为89.0%～98.9%;在氨基酸水平上同源性为90.7%～99.2%.全omp A序列在大肠杆菌中干扰蛋白的正常表达,因此截断omp A蛋白的信号肽序列,将去信号肽的omp A基因插入到pPRO-EX-Htb载体上,构建了原核表达载体Htb-omp A,转化BL21,并诱导表达,SDS-PAGE结果表明,表达蛋白约为35 kDa,与预期的分子量大小相符.Western-blot结果表明,表达的蛋白具有良好的抗原活性.本研究重组蛋白omp A的获得,为敲除omp A基因多杀性巴氏杆菌突变株的血清学检测奠定基础.

First report of a human case of polycystic echinococcosis due to Echinococcus vogeli from neotropical area of Peru, South America Primer reporte de un caso humano de echinococcosis poliquística causada por E. vogeli procedente del área neotropical del Perú, America del Sur

Directory of Open Access Journals (Sweden)

José R. Somocurcio

2004-02-01

Full Text Available We report a human case of polycystic hidatidosis due to Echinococcus vogeli from Contamana (Department of Loreto village located in the central jungle of Peru. The patient is a 44 year-old lady, teacher, who carried a painless liver mass since a year ago. She was submitted to abdominal surgery and the liver mass was removed and showed multiple cysts containing colorless liquid as is showed in the polycystic hidatidosis. The morphology and measure of the hooks obtained from the liquid contained in the cysts are from Echinococcus vogeli. It is the first report of this parasitism in Perú.Reportamos un caso humano de hidatidosis poliquística debido a Echinococcus vogeli procedente de Contamana (Departamento de Loreto, localidad ubicada en la selva central del Perú. La paciente es una mujer de 44 años de edad, profesora, quien portaba una hepatomegalia no dolorosa de un año de evolución. Sometida a intervención quirúrgica, se removió la masa hepática que macroscópicamente mostró múltiples quistes conteniendo líquido incoloro. El examen microscópico correspondió a una hidatidosis poliquística. El examen y medida de los ganchos obtenidos del contenido de los quistes correspondieron a Echinococcus vogeli. Es el primer reporte de este parasitismo en el Perú.

All projects related to | Page 27 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Region: Kenya, Morocco, Canada. Program: Agriculture and Food Security. Total Funding: CA$ 213,100.00. Supporting the production of quality livestock vaccines for enterotoxaemia, pasteurella and Rift Valley fever in Kenya. Project. It is estimated that Kenya has 18. Region: Kenya, Morocco, Canada. Program: Agriculture ...

21 CFR 558.415 - Novobiocin.

Science.gov (United States)

2010-04-01

... susceptible to novobiocin; treatment of acute outbreaks of fowl cholera caused by strains of Pasteurella... lb. body weight per day. (a) Indications for use. Aid in the treatment of breast blisters associated.... body weight per day. (a) Indications for use. Treatment of staphylococcal synovitis and generalized...

Caracterización fenotípica de células madre mesenquimales humanas de médula ósea y tejido adiposo. Resultados preliminares

Directory of Open Access Journals (Sweden)

Consuelo Macías-Abraham

Full Text Available Introducción:las células madre mesenquimales (CMM poseen características fenotípicas y funcionalesque les confieren un amplio potencial terapéutico por su posible uso en la terapia celular regenerativa, en el rechazo del trasplante alogénico y en enfermedades inflamatorias crónicas. Objetivo: evaluar la expresión de moléculas de membrana que permiten identificar la expresión de patrones moleculares característicos de CMM humanas mantenidas en cultivo. Métodos: se estudió la expresión fenotípica de células mononucleares procedentes de médula ósea obtenidas mediante aspiración medular, separadas por gradiente de Ficoll y cultivadas ex vivo entre los pases o subcultivos 3 y 16; y adipocitos cultivados procedentes de la extracción enzimática de tejido adiposo de donantes sanos. Se realizó doble marcaje para las moléculas CD34/CD45, CD34/CD90, CD34/CD117, y CD34/CD44. Resultados: en los resultados preliminares obtenidos se observó que las células cultivadas procedentes de médula ósea, entre los pases 4 y 8 de cultivo expresaron 45,13 % de células CD34-/CD45- (doblemente negativas, lo que correspondió con el 25,24 % de células CD34-/CD90+ y el 96,90 % de CD34-/CD117-. En las células procedentes de cultivo de adipocitos se observó el52,3 % de CD34-/CD45- (doblemente negativas,12,31 % de CD34-/CD90+,43,31 % de CD34-/CD117- y 64,68 % de CD34-/CD44+.Estos resultados sugieren que ambos cultivos se diferenciaron a CMM. Las CMM procedentes de adipocitos mostraron el 64,68 % de células con expresión de la molécula de adhesión CD44 a la que se atribuyen propiedades funcionalescomo el asentamiento tisular. Conclusiones: estos resultados preliminares permiten corroborar que ambos métodos experimentales de cultivo son efectivos para la obtención de CMM con fines terapéuticos.

Evaluación de la concentración de mercurio en arroz (Oryza sativa crudo y cocido procedente del municipio de San Marcos- Sucre y zona aurífera del municipio de Ayapel - Córdoba

Directory of Open Access Journals (Sweden)

Marcela P. Argumedo G.

2015-08-01

Full Text Available Introducción: Los metales se encuentran en todos los alimentos, siendo de mayor preocupación la presencia de metales tóxicos como el mercurio, debido a los efectos adversos que causa en la salud del hombre, lo que lo ha convertido en un grave problema de salud pública. Objetivo: Evaluar la concentración de mercurio en arroz (Oryza sativa crudo y cocido procedente del municipio de San Marcos - Sucre y zona aurífera del municipio de Ayapel - Córdoba. Metodología: El presente estudio es de tipo exploratorio y experimental. La toma de muestras fue realizada en tiempo de recolección del arroz (septiembre y se tomaron tres repeticiones de cada tipo o variedad de arroz (Fedearroz 2000 - LD 473. La cocción del alimento fue realizada en el laboratorio en condiciones similares a las utilizadas por habitantes de las comunidades donde fueron recolectadas las muestras. Para los análisis de relación estadística entre los tratamientos de cocción y la concentración de mercurio total en muestras, fue realizado un análisis de correlación simple. La determinación de diferencias estadísticamente significativas entre las muestras de arroz crudo y cocido fue realizada mediante un t-test y Anova. Resultados: Se presentaron concentraciones bajas de mercurio total y metilmercurio en las muestras de arroz crudo y cocido. Además, fue detectado que el proceso de cocción del alimento disminuye las concentraciones de HgT, en los diferentes tratamientos de tiempo de cocción. Conclusiones: Los habitantes de los municipios en estudio están expuestos a concentraciones mínimas de mercurio que podrían ser perjudiciales para su salud, debido a la alta ingesta de este cereal en la dieta de las comunidades.

Anglicismos y germanismos en el lenguaje de la publicidad del español peninsular contemporáneo (1998-2007)

OpenAIRE

Rodríguez Díaz, José Antonio

2012-01-01

Se trata de un estudio en su estadio sincrónico actual del préstamo léxico del inglés y del alemán al español en la variedad geográfica peninsular, en un ámbito muy concreto: la publicidad escrita en prensa. El análisis se ocupa, por un lado, del préstamo procedente del inglés, el más abundante actualmente, y del préstamo genuinamente germánico, el procedente del alemán, que aunque más limitado cuantitativamente, no desmerece cualitativamente. Comienza el estudio con la revisión crítica de aq...

Qualidades organolépticas de purês de batatinhas procedentes de culturas tratadas com inseticidas Application of insecticides and their influence on the potato puree flavor

Directory of Open Access Journals (Sweden)

Ruth dos Santos Garruti

1961-01-01

Full Text Available Resultados significativos foram obtidos na análise do sabor de amostras de purês preparados com batatinhas procedentes de ensaios de aplicação de vários inseticidas no solo, na folhagem e em batatas-semente. Em 1959, dos inseticidas aplicados no solo (BHC, Heptaclor, Aldrin, Parathion e Lindane apenas o BHC imprimiu sabor estranho bastante pronunciado semelhante a môfo, diferindo da testemunha ao nível de 1%.Para Heptaclor e Aldrin não foram verificadas alterações de sabor; Lindane e Parathion apresentaram leves odores estranhos, semelhantes a medicamento. Disyston, aplicado nas batatas-semente, e Metasystox, na folhagem, imprimiram ao purê sabor ardido e odor a remédio, mostrando-se inferiores, respectivamente, aos níveis de 5 e 1%. tanto à testemunha, tratada com carvão, como ao item sem qualquer tratamento. Parathion, aplicado na folhagem, comparado com as mesmas testemunhas, não apresentou diferenças significativas. Em 1960, dos inseticidas aplicados no solo, apenas Lindane, em dose normal e dobrada, diferiu da testemunha ao nível estatístico de 1%, apresentando sabor estranho, semelhante a môfo. Heptaclor, Aldrin e Toxafeno. em doses normal e dobrada, não diferiram da testemunha. classificando-se o sabor do primeiro como regular e dos dois últimos como bom.Organoleptic tests were carried out in 1959 and 1960 to determine the possible occurrence of off-flavor in potato tubers, caused by the application of insecticides to the soil where the plants were grown, on the seed, and on the plant leaves. In 1959 the treated samples were compared against the control by the triangular test; in 1960, in a lattice square 3x3 with four replications. The insecticides applied to the soil in 1959 were as fallows: BHC (gamma-isomer, Heptaclor, Aldrin, Parathion, and Lindane. BHC induced a very strong mold-like «rmusty» off-flavor, significant in relation to the control at the 1% level. Parathion and Lindane induced an unidentified off

Catálogo de los Reptiles procedentes de la Comunidad de Madrid (España que se conservan en el Museo Nacional de Ciencias Naturales

Directory of Open Access Journals (Sweden)

González Fernández, J. E.

2006-05-01

Full Text Available A complete catalogue of reptiles found in Comunidad de Madrid (Spain is provided in this paper. The catalogue is taxonomically indexed and listed in alphabetical order including all basic data. It includes all information available in card files and old collection books of the MNCN. We have confirmed which reptiles in the current collection appear as being collected in Madrid, in old records, catalogue books and collection cards in the collection of amphibians and reptiles of the MNCN. The information of these old databases has been verified and mistakes corrected. As a consequence of this revision, the existence of 2237 specimens of reptiles originating in the above-indicated area and exisincluded in 1039 computer records, has been confirmed as of 30 November 2005. Among the oldest specimens included in the collection are some collected by the founding father of Spanish herpetology (Eduardo Boscá y Casanoves or by a member of the Pacific Scientific Commission (Francisco de P. Martínez y Sáez and deposited in the MNCN more than 140 years ago. These specimens and their data are preserved at the MNCN as part of our common National Heritage, for future generations of researchers as witnesses of the past and present biodiversity. Distribution areas for several species have been extended.

En el presente trabajo, se proporciona un catálogo actualizado de los reptiles de la Comunidad de Madrid (España elaborado gracias a la información disponible en los ficheros y libros de colección del MNCN. Se han confirmado los datos que figuraban en los antiguos libros de registro, catálogo y fichas de colección referentes a los reptiles procedentes de Madrid existentes en la colección de anfibios y reptiles del MNCN, comprobándose que ejemplares se conservan en la actualidad. También se ha actualizado y comprobado que la información disponible en las bases de datos del MNCN era correcta y acorde con los datos existentes en los ejemplares. Los

Using Inuit traditional ecological knowledge for detecting and monitoring avian cholera among Common Eiders in the eastern Canadian Arctic

Directory of Open Access Journals (Sweden)

Dominique A. Henri

2018-03-01

Full Text Available In recent decades, traditional ecological knowledge (TEK has played an increasing role in wildlife management and biodiversity conservation in Canada and elsewhere. This study examined the potential contribution that Inuit TEK (which is one aspect of Inuit Qaujimajatuqangit or Inuit traditional knowledge could offer to detect and monitor avian cholera and other disease-related mortality among Northern Common Eiders (Somateria mollissima borealis breeding in the eastern Canadian Arctic. Avian cholera is an infectious disease (Pasteurella multocida that has been a major conservation issue because of its potential to cause high rates of disease and mortality in several bird species in repeating epizootics; it has spread geographically in North America since the 1940s. In 2004, Inuit hunters from Ivujivik, Nunavik, Québec, were the first to detect avian disease outbreaks among Northern Common Eiders nesting in northeastern Hudson Bay and western Hudson Strait. Laboratory analysis of bird tissues confirmed avian cholera in that region. From 2007 to 2009, we collected Inuit TEK about mortality among Common Eiders and other bird species north and west of where the outbreaks were first detected. During interviews in the communities of Kimmirut, Cape Dorset, Coral Harbour, and Igloolik, Nunavut, Canada (n = 40, Inuit participants reported seeing a total of 8 Common Eiders and 41 specimens of other bird species either sick or dead in northern Hudson Strait, Hudson Bay, and Foxe Basin. Most of the observed disease and mortality events were at sea, on sea ice, or on small nesting islands. Such events probably would have gone undetected by biologists, who were mainly monitoring avian cholera outbreaks on large nesting islands in that region. Inuit participants readily recalled details about the timing, location, and numbers of sick and dead birds that they observed. Some reported signs of disease that were consistent with avian cholera. Inuit also revealed

INTERPRETACIÓN DE LA COSMOVISIÓN AMAZÓNICA SHUAR A TRAVÉS DE UN MONOLITO ANTROPOZOOMORFO PROCEDENTE DE WAPULA (MORONA SANTIAGO, ECUADOR (Interpretation of the Shuar Amazonian Worldview through an Anthropozoomorphic Monolith from Wapula, Morona Santiago, Ecuador

Directory of Open Access Journals (Sweden)

Edwin Hernán Ríos Rivera

2017-06-01

Full Text Available El presente trabajo pretende introducirse en el proceso cognoscitivo de paradigmas y estructuras teocráticas, posiblemente politeístas —representadas en el código iconográfico, iconológico y morfoespacial— a través del estudio de un monolito de andesita procedente del sitio arqueológico de Wapula (Morona Santiago, Ecuador. La pieza, sin contexto arqueológico conocido pero con una clara iconografía shuar, ha sido seleccionada para hacer un acercamiento a la cosmovisión de este pueblo y la importancia de la figura del uwishin en la misma. El estudio de estas piezas contribuye a la puesta en valor y conservación preventiva de uno de los más importantes bienes culturales del enclave amazónico ecuatoriano. El monolito en cuestión permite entender la cosmovisión del pueblo shuar a través del estudio de sus características, lo cual se vio ampliado con un análisis químico-mineralógico realizado en el Instituto Universitario de Restauración del Patrimonio de la Universidad Politécnica de Valencia (España. ENGLISH: This article is intended to introduce readers to the cognitive processes of potentially polytheistic theocratic structures and paradigms represented in the iconographic, iconological, and morpho-spatial characteristics of an andesite monolith from the archaeological site of Wapula (Morona Santiago, Ecuador. The piece, whose archaeological context is unknown but whose iconography is clearly Shuar, was selected in order to study the worldview of Wapula and the importance of the uwishin figure there. The study of these figures contributes to the valuation and preventative conservation of one of the most important pieces of cultural heritage in the Ecuadorian Amazon. Our analysis of allowed us to understand the Shuar worldview through the analysis of its features; this was amplified by a chemical-mineralogical analysis accomplished in the University Institute of Heritage Restoration, Polytechnic University of Valencia

Neurobanco del grupo de Neurociencias de Antioquia

Directory of Open Access Journals (Sweden)

Francisco Javier Lopera Restrepo

2005-03-01

Full Text Available El material biológico procedente de personas afectadas por enfermedades neurodegenerativas y el de controles sanos, es una necesidad para la investigación de las enfermedades neurodegenerativas.

A new species of Adelpharctos (Mammalia, Carnivora, Ursidae from the late Oligocene of the “Phosphorites du Quercy” (France

Directory of Open Access Journals (Sweden)

de Bonis, L.

2011-12-01

Full Text Available The genus Adelpharctos was known until now through the species A. mirus by a unique mandible (p2-m2 from the old collections of the Quercy whose geological age was unknown. New material coming from the locality of Pech-du-Fraysse completes our knowledge of the genus particularly for the maxilla and upper teeth. Adelpharctos belongs to the sub-family Hemicyoninae in the family Ursidae. It differs from the middle Miocene hemicyonines which have more massive molars and from the group Cephalogale-Phoberogale by some morphological characters. It seems to be a branch coming from the ancestral stem group of the sub-family.El género Adelpharctos era solo conocido por una especie A. mirus representada por una única mandibular (p2-m2 procedente de las colecciones antiguas del Quercy, cuya edad geológica es desconocida. Nuevo material procedente de la localidad de Pech-du-Fraysse completa nuestro conocimiento sobre el género, en particular para el maxilar y la dentición superior. Adelpharctos pertenece a la subfamilia Hemicyoninae, familia Ursidae. El género difiere de los hemicioninos del Mioceno medio, que tienen dentición más robusta, y de los del grupo Cephalogae-Phoberogale por algunos caracteres morfológicos. Se interpreta como perteneciente a una línea procedente del grupo ancestral primitivo de la subfamilia Hemicyoninae.

Contabilidad, información y control en un contexto de actividades económicas diversificadas en la edad moderna: el Monasterio de Silos y su sofisticado sistema contable

Directory of Open Access Journals (Sweden)

Lorenzo Maté Sadornil

2008-12-01

Full Text Available El artículo permite observar el complejo sistema contable utilizado por los monjes benedictinos del Monasterio de Silos (Burgos, España durante la Edad Moderna, así como mostrar su utilidad para el registro y control de las variadas actividades económicas que de forma eficiente llevó a cabo. La riqueza documental del Archivo del Monasterio de Silos, en cuanto a Libros de Cuentas se refiere, ha permitido el análisis, cuantificación e interpretación de dicha actividad. Se obtienen resultados globales acerca de la importancia absoluta y relativa del conjunto de aportaciones que contribuyeron al desarrollo económico del Monasterio y su entorno desde finales del siglo XVII hasta principios del XIX. El trabajo incluye el desglose de los diferentes tipos de ingresos existentes, tanto los procedentes de la administración y gestión económica de los bienes propiedad del Monasterio: rentas de los censos, rentas de las tierras cedidas en explotación y productos de tierras y ganados obtenidos mediante la explotación directa, como los procedentes de su condición eclesiástica y actividad religiosa: diezmos, sacristía y extraordinarios. Igualmente, se analizan las aplicaciones a las que fueron destinados los flujos financieros procedentes de los ingresos y se vierte la síntesis de los resultados obtenidos.

Nueva estela decorada procedente de El Viso (Córdoba)

OpenAIRE

Iglesias Gil, José Manuel

2009-01-01

RESUMEN: El artículo nos ofrece el estudio de una estela inédita hallada en El Viso (Córdoba). La estela se sitúa cronológicamente en la fase orientalizante antigua probablemente en el siglo Vil a. J.C., y geográficamente en la región del suroeste de la Península. Los escudos sin escotadura y la ausencia de cascos en los guerreros concretan más su área de dispersión entre el Guadiana y el Guadalquivir. Los motivos representados denotan una procedencia de Oriente con una expansión hacia la Pen...

Nueva estela decorada procedente de El Viso (Córdoba

Directory of Open Access Journals (Sweden)

José Manuel IGLESIAS GIL

2009-10-01

Full Text Available RESUMEN: El artículo nos ofrece el estudio de una estela inédita hallada en El Viso (Córdoba. La estela se sitúa cronológicamente en la fase orientalizante antigua probablemente en el siglo Vil a. J.C., y geográficamente en la región del suroeste de la Península. Los escudos sin escotadura y la ausencia de cascos en los guerreros concretan más su área de dispersión entre el Guadiana y el Guadalquivir. Los motivos representados denotan una procedencia de Oriente con una expansión hacia la Península Ibérica a través del Mediterráneo.ABSTRACT: The article offers us the study of a unique trail found in El Viso (Córdoba. The trail is situated chronologically around ancient times probably in the VII century B. C , and geographically in the region of the southwest of the Peninsula. The smooth shields and the absence of helmets on the warriors fix their area of dispersion morebetween the Guadiana and the Guadalquivir. The motifs represented indicate that they proceeded from the Orient, extending towards the Iberian Peninsula across the Mediterranean.

La cronología de las inscripciones funerarias latinas de Alava.

Directory of Open Access Journals (Sweden)

Ana Echevarria

1989-01-01

Full Text Available El estudio que se presenta tiene como objetivo principal clasificar cronológicamente los restos de epigrafía latina procedentes de los principales focos alaveses, en relación, sobre todo, a sus formulismos funerarios.

Identificación de Chlamydophila abortus en un aborto ovino en Almoloya de Juárez, México

OpenAIRE

Edgardo Soriano-Vargas; Celene Salgado-Miranda; Juan Manuel Jiménez-Estrada; Marcela López-Hurtado; Fernando M. Guerra-Infante; Marcos R. Escobedo-Guerra

2011-01-01

ResumenSe identificó la presencia de Chlamydophila abortus en un aborto ovino procedente de Almoloya de Juárez, México.SummaryChlamydophila abortus was identified in an ovine aborted fetus from Almoloya de Juárez, México

Le FIVB annonce le financement de huit autres projets | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

5 avr. 2018 ... Découvrez les derniers récents projets soutenus par le Fonds d'innovation en matière de vaccins pour le bétail : Maladie de Newcastle · Pleuropneumonie contagieuse caprine – cowdriose · Plateforme de modification génétique CRISPR/cas9 · Entérotoxémie, la bactérie Pasteurella et la fièvre de la vallée ...

Prevalence and Biotyping of Pasteurella Haemolytica Isolates from ...

African Journals Online (AJOL)

P. haemolytica isolated from Sahel sheep and goat in Maiduguri was characterized phenotypically. A total of 92 P. haemolytica isolates were obtained from the nasopharyngeal swabs while a total of 15 isolates came from pneumonic lung samples. The results showed that 37(20.22%) P. haemolytica isolates were obtained ...

Estudio bacteriológico de la Pasteurella pestis

Directory of Open Access Journals (Sweden)

Héctor Colichón

1942-10-01

Full Text Available Un considerable número de cepas de P. pestis aisladas en el Perú han sido estudiadas bacteriológicamente y los resultados obtenidos pueden ser resumidos en la forma siguiente: 2 cepas entre 148 estudiadas en caldo produjeron franco enturbiamiento del medio. La liquefación de la gelatina, la producción de indol y acetil metilcarbinol fueron negativos para todas las cepas estudiadas. En las condiciones ordinarias puede haber débil producción de SH2 por muy pocas cepas; en cambio, en el agar-Martín-infusión-extracto hepático la producción de SH2 ocurre en el mayor número de cepas, y en un considerable número de ellas en forma notablemente intensa. La temperatura de incubación es decisiva en la producción de hidrógeno sulfurado. Salvo una excepción la reducción del azul de metileno fue negativa para las cepas estudiadas, en esta misma forma la reducción de nitratos a nitritos, la producción de ácido nitroso y reacción del rojo de metilo fueron positivas para las cepas de P. pestis probadas. Todas las cepas estudiadas dieron reacción de catalasas positiva y no desarrollaron en ácido úrico, ni en medio de Koser. La acción de la P. pestis sobre los carbohidratos fue dividida en los siguientes grupos: Carbohidratos atacados constantemente con producción de ácido, no gas; ellos son: glucosa, maltosa, manita, xilosa, salicina y leche tornasolada. Carbohidratos constantemente no atacados, como son: sacarosa, rafinosa, dulcita, inosita, glicerina y dextrina. Carbohidratos, inconstantemente atacados y son: rhamnosa, trehalosa, lactosa, sorbita y arabinosa. En condiciones adecuadas de cultivo, muchas cepas pueden desarrollar en papa, entre las que desarrollaron se observaron algunas que producen pigmentación amarillo-cepia o amarillo dorado. Las pruebas, del ácido nitroso, de la reducción del azul de metileno y de la rahmnosa tienen valor relativo para el Diagnóstico de la Peste, en cambio la glicerina, el indol, la sacarosa, salicina, el agar-sangre-humana y la leche tornasolada son pruebas de valor en la diferenciación de la P. pestis, P. pseudotuberculosis y la P. séptica.

Letalidad de hongos entomopatogenos sobre Dysdercus peruvianus (Hemiptera: Pirrhocoridae

Directory of Open Access Journals (Sweden)

Francesca Falconi

2011-05-01

Full Text Available Se evaluó la patogenicidad y virulencia sobre Dysdercus peruvianus de una cepa de Acremonium y una de Scopulariopsis, aisladas de adultos infectados de D. peruvianus procedentes de Mala, Provincia de Cañete. También se evaluó una cepa de Beauveria sp. aislada de Schistocerca piceifrons peruviana procedente de Ayacucho. Los bioensayos se realizaron sobre ninfas del cuarto estadío de D. peruvianus y las concentraciones empleadas fueron 3,7x108, 1,9x108, 9,4x107 conidias/mL para Beauveria sp., Acremonium sp. y Scopulariopsis sp. respectivamente. Veinte días posteriores al tratamiento, los mayores porcentajes de mortalidad los causaron Beauveria sp. (83,3% y Acremonium sp. (80%. Scopulariopsis sp. causo una mortalidad de 23,3%. Acremonium sp. fue la cepa más agresiva con un tiempo de letalidad (TL50 3,8 días.

Aspectos éticos sobre la investigación y tratamiento con células troncales

Directory of Open Access Journals (Sweden)

Koldo Martínez

2008-01-01

Full Text Available La popularización de la existencia de las células madre y sus posibles usos en la medicina regenerativa han despertado un vivo interés en la población y unas expectativas desaforadas de curación de todas o casi todas las enfermedades. Sin embargo, la utilización de estas células merece distintas valoraciones éticas según cuál sea su procedencia y métodos de obtención. Las procedentes de adulto y de cordón umbilical no presentan problemas éticos distintos a cualquier otro tipo de investigación y/o tratamiento. Son las procedentes de embriones las que generan problemas específicos y en el texto se defiende la moralidad de su uso siempre que se respeten unos límites mínimos.

Qualidade fisiológica e tratamentos de sementes de cedrela fissilis procedentes do sul do Brasil Physiological quality seeds and treatments of cedrela fissilis seeds from south of Brazil

Directory of Open Access Journals (Sweden)

Marília Lazarotto

2013-04-01

Full Text Available Os objetivos deste trabalho foram: avaliar a qualidade fisiológica de sementes de cedro (Cedrela fissilis, procedentes de localidades do sul do Brasil, através de testes de vigor e avaliar diferentes tratamentos nas sementes para controle de patógenos e para promoção da germinação da espécie. Para tanto, foram utilizadas seis amostras com procedências dos Estados do Rio Grande do Sul, Santa Catarina e Paraná, as quais foram submetidas à determinação de teor de água, teste de germinação e primeira contagem, envelhecimento acelerado (testando períodos de exposição às condições de envelhecimento, emergência em viveiro e tratamento de sementes. Os tratamentos utilizados para controle de patógenos foram: testemunha (T0; físico com calor seco a 70°C±3°C por 48 horas (T1; extrato aquoso de alho (Allium sativum (T2; biológico à base de Trichoderma spp. - Agrotich Plus® (T3; e químico com fungicida protetor Captan (T4. A germinação variou de 56 a 87%; o período de 48 h sob temperatura de 41 °C foi o mais eficiente para estratificar as amostras em níveis de vigor; a emergência variou de 51 a 88% e as variáveis de desempenho de plântulas analisadas conseguiram estratificar as amostras em níveis de vigor. Quanto ao tratamento de sementes, o calor seco e o tratamento à base de extrato de alho se mostram eficientes no controle de microrganismos em semente de cedro, sem prejuízos ao vigor destas.The objectives of this study were to evaluate the physiological quality of Cedrela fissilis seeds, from different origins, using different vigor tests and evaluating different seeds treatments for control of pathogens and to promote the germination of the species. Therefore, six samples from different places in states of Rio Grande do Sul, Santa Catarina and Paraná were used, which were subjected to determination of water content, germination and first count of germination, accelerated aging (testing different periods

Caracterización arqueométrica de pigmentos y soportes procedentes de pinturas murales góticas (S. XIII-XV

Directory of Open Access Journals (Sweden)

Kriznar, A.

2007-04-01

ípica para pintura italiana gótica: fresco buono sobre varias capas de mortero, con empleo de polvo de mármol para hacerlo más liso y blanco. Los resultados obtenidos han permitido caracterizar e identificar los morteros y pigmentos inorgánicos empleados y que son apropiados para pinturas murales. A título de ejemplo, se han empleado óxidos de hierro para amarillo, naranja, rojo y verde, pero no se ha encontrado malaquita ni existen indicios de compuestos de cobre para el color verde. En capas más antiguas se ha encontrado cinabrio para el color rojo, típico de Italia. Las pinturas fueron realizadas sin emplear otro aglutinante que la propia cal procedente del mortero. Estas características y el empleo de cinabrio, sitúan las pinturas del 1400-1410 en la corriente artística italiana del Trecento. La segunda manera es típica del norte de Europa: técnica de una o dos capas de mortero, con una capa fina de cal superpuesta para dar mayor fuerza a la cal del mortero como aglutinante. Teniendo en cuenta los resultados obtenidos en este estudio sobre los dos tipos de muestras estudiadas, se concluye que las corrientes italiana y norteeuropea se encontraron en territorio esloveno, lo que se aprecia tanto desde el punto de vista estilístico como científicamente. Investigaciones en esta temática ayudan a conocer mejor tanto el Arte de Europa Central y el de Eslovenia con la zona adriática, como el mapa general del Arte Europeo en el tiempo de la Edad Media.

Primer registro para Peru del genero Nielsonia Young, 1977 (Hemiptera: Cicadellidae: Cicadellinae: Cicadellini)

Science.gov (United States)

En este articulo se reporta por primera vez para el Peru una especies del genero Nielsonia Young, 1977, de material procedente del Departamento de Tumbes. El genero ha sido reportada anteriormente de Ecuador, como unico registro para Sudamerica, y America Central. El unico especimen hembra encontra...

Estudio de la adsorción de cadmio, níquel y zinc sobre una bentonita natural y homoiónica de sodio

Directory of Open Access Journals (Sweden)

Germán Darío Silva Giraldo

2010-09-01

Full Text Available Se esmdió la adsorción de cadmio, níquel y zinc, en solución acuosa a 25 "C, sobre una bentonita procedente del Valle del Cauca, tanto en su estado natural como en su forma homoiónica de sodio.

Inundaciones en la rambla Albuñol. Causas y posibles medidas de intervención

OpenAIRE

Sánchez Holgado, José Ramón

2015-01-01

Con motivo de las lluvias acaecidas el pasado día 07 de Septiembre del 2015, la rambla Albuñol sufrió una crecida exponencial de agua procedente de otras ramblas, barrancos y depresiones anexas, que ocasionó desgraciadamente pérdidas humanas y con

La contabilidad presupuestaria: instrumento de información y control. La transición de los ayuntamientos españoles del Antiguo al Nuevo Régimen

Directory of Open Access Journals (Sweden)

Mª Soledad Campos Lucena

2006-07-01

Para el desarrollo de este trabajo y siguiendo una metodología positivista hemos hecho uso de fuentes primarias procedentes del Archivo Histórico Municipal de Carmona, así como de la legislación vigente en cada momento a lo largo del periodo de análisis.

El actor de Las revoluciones científicas

OpenAIRE

González Ruiz, Agustín

1998-01-01

En Este Estudio Utilizamos La Teoria Estructural De La Accion Desarrollada Porburt Para Iluminar El Concepto De Revolucion Cientifica Procedente De Kuhn. Conello Obtenemos Un Doble Resultado: Ganamos Por Una Parte Una Nueva Aplicacionintencional Para La Teoria Estructural De La Accion Y Resolvemos Por Otraciertas Insuficiencias Del Concepto Kuhniano De Revolucion.

Isolation of Mannheimia (Pasteurella) haemolytica serotypes A2 and ...

African Journals Online (AJOL)

http://dx.doi.org/10.4314/tv.v23i2.4572 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...

Caso clínico de la Unidad de Medicina Interna Integral: Neumonía

Directory of Open Access Journals (Sweden)

Analida E. Pinilla Roa

1994-07-01

Full Text Available Paciente masculino de 27 años, natural y procedente de Bogotá, indigente. Enfermedad actual. Consultó portos, con expectoración mucopurulenta y hemoptoica, dolor plurítico en hemitorax derecho, fiebre, diaforesis nocturna, astenia, adinamia y disnea progresiva de ocho días de evolución.

Alterações bioquímicas post-mortem de matrinxã Brycon cephalus (Günther, 1869 procedente da piscicultura, mantido em gelo Post-mortem biochemical alterations in aquacultured matrinxã fish Brycon cephalus (Günther, 1869 when stored on ice

Directory of Open Access Journals (Sweden)

Gilvan Machado Batista

2004-12-01

Full Text Available No presente trabalho, foram estudadas as alterações bioquímicas post-mortem que ocorreram em matrinxã Brycon cephalus (Günther, 1869 procedente da piscicultura e mantido em gelo em Manaus - AM. Foi determinado o tempo de estocagem em gelo por meio das avaliações sensoriais físicas e gustativas, das análises de pH, Nitrogênio das Bases Voláteis Totais (N-BVT e bacteriológicas durante 29 dias. Foram determinados os índices de rigor-mortis, as concentrações de ATP e seus produtos de degradações e o valor K. De acordo com a composição química, o peixe foi classificado como "semi-gordo". Os peixes entraram em rigor-mortis aos 75 minutos após a morte por hipotermia, tendo permanecido durante 10 dias. As avaliações sensoriais (físicas e gustativas mostraram que os peixes apresentaram condição de consumo até 26 dias. As análises de ATP e de seus produtos de degradação mostraram que a referida espécie foi considerada formadora de inosina (HxR, nas condições de experimento. O valor K mostrou que os exemplares de matrinxãs permaneceram "muito frescos" até 16 dias de estocagem em gelo, concordante com a avaliação sensorial gustativa.Post-mortem biochemical alterations in aquacultured matrinxã fish Brycon cephalus (Günther, 1869 when stored on ice in Manaus-AM, were studied in this paper. The storage time on ice was determined through tasting and physical sensory evaluations, pH, total volatile bases nitrogen (TVB-N and bacteriological analyses during 29 days. Rigor-mortis index, ATP-related compounds and K value were also determined. Chemical composition demonstrated that fish was classified as "semi-fat". The specimens presented rigor-mortis 75 minutes after death caused by hypothermia and remained that way for 10 days. Shelf life time on ice was 26 days, according to sensory evaluations, pH, TVBN determinations and bacteriological analyses. ATP-related compounds pointed out that the referred species was considered to

Efecto de la inoculación con rizobios procedentes de Alberta, Canadá, en sorgo (Sorghum bicolor L. Moench, en condiciones de campo Effect of the inoculation with rhizobia from Alberta, Canada, in sorghum (Sorghum bicolor L. Moench, under field conditions

Directory of Open Access Journals (Sweden)

C. J Bécquer

2011-09-01

Full Text Available Se realizó un experimento de campo con el objetivo de medir el efecto de cepas de rizobio en las variables agronómicas del sorgo, en las condiciones ambientales de Sancti Spíritus, Cuba. Se utilizaron 10 cepas de Sinorhizobium meliloti, procedentes de ecosistemas ganaderos de Alberta, Canadá; así como cuatro cepas de referencia pertenecientes a diferentes géneros y especies de rizobio, que procedían de la colección de Agriculture and AgriFood Canada. La confección de los inóculos y la inoculación de las semillas se realizaron por métodos estándar. El diseño experimental fue de bloques al azar, con 16 tratamientos y cuatro réplicas. Se evaluó el peso seco aéreo, la longitud del tallo y la longitud de la panoja; además, se calculó el incremento del peso seco aéreo en los tratamientos inoculados con relación al control absoluto. Los resultados demostraron la capacidad de las cepas estudiadas de influir en las variables agronómicas, ya que los tratamientos seleccionados igualaron sus valores a los del control fertilizado y presentaron un incremento de más del 100% del peso seco aéreo, comparado con el control absoluto.A field trial was conducted with the objective of measuring the effect of rhizobium strains on the agronomic variables of sorghum under the environmental conditions of Sancti Spiritus, Cuba. Ten Sinorhizobium meliloti strains, from livestock production ecosystems of Alberta, Canada, were used; as well as four reference strains belonging to different rhizobium genera and strains, which were from the collection of Agriculture and AgriFood Canada. The inoculi confection and seed inoculation were made by standard methods. The experimental design was randomized blocks, with 16 treatments and four replications. The dry aerial weight, stem length and ear length were evaluated; in addition, the increase of aerial dry weight was calculated in the inoculated treatments as compared to the absolute control. The results

Superficie específica de una bentonita mediante la adsorción de azul de metileno

OpenAIRE

Pinzón Bello, Jorge Alejo

2010-01-01

Se estudió la determinación de la superficie específica de una bentonita colombiana, procedente del Valle del Cauca, mediante la adsorción de azul de metileno, a 298 K. Este método se comparó con el de la adsorción de nitrógeno a 77 K.

La esperanza de vida en la ciudad de México (siglos XVI al XIX

Directory of Open Access Journals (Sweden)

Lourdes Márquez Morfín

2016-09-01

Full Text Available Se contrastan los diferentes escenarios demográficos construidos a partir del análisis de varias series osteológicas procedentes de la ciudad de México cuya temporalidad corresponde a los siglos xvii al xix, conformada por criollos, mestizos e indígenas; y otra procedente de un área rural fechada en el siglo xvi, en Xochimilco, de composición eminentemente indígena. La técnica paleodemográfica permite obtener perfiles demográficos específicos para cada serie que se comparan y discuten con la información histórica disponible para la ciudad de México. Los resultados de las series urbanas y la rural, describen poblaciones con bajas esperanzas de vida, escasa sobrevivencia hacia las edades adultas y una alta mortalidad infantil producto de las condiciones sanitarias, de la pobreza y de la violencia, teniendo como telón de fondo grandes cambios sociales y económicos, además de crisis demográficas epidémicas y hambre.

Isolation of the bacterial causes of tonsillitis in dogs

Directory of Open Access Journals (Sweden)

B. Al-Mufti

2014-06-01

Full Text Available The study was performed to identify the bacterial causes of tonsillitis in dogs. Twelve clinical cases of dogs (5 males and 7 females of different ages and breeds were observed. Tonsils swabs were taken from all the dogs, then cultured on different agars and bacterial smears prepared from all cultures and Gram stains were done. The study confirmed that the most bacterial causes of tonsillitis in dogs were Escherichia coli, Staphylococcus aureus, Staphylococcus intermedius, Staphylococcus albus, Streptococcus pyogenes, Klebsiella spp. and Pasteurella spp.

Hernia diafragmática traumática (presentación de un caso

Directory of Open Access Journals (Sweden)

Guillermo Rueda Montaña

1958-03-01

Full Text Available M. A. C. de 9 años de edad, procedente de Bogotá, fué hospitalizado el 17 de septiembre de 1957 en el Hospital de La Misericordia de Bogotá. Pocos momentos antes había sido atropellado por un camión, una de cuyas ruedas le pasó por encima del abdomen.

Superficie específica de una bentonita mediante la adsorción de azul de metileno

Directory of Open Access Journals (Sweden)

Jorge Alejo Pinzón Bello

2010-07-01

Full Text Available Se estudió la determinación de la superficie específica de una bentonita colombiana, procedente del Valle del Cauca, mediante la adsorción de azul de metileno, a 298 K. Este método se comparó con el de la adsorción de nitrógeno a 77 K.

Interpretación en arqueología : piezas de collar de una necrópolis navarra

Directory of Open Access Journals (Sweden)

Amparo Castiela Rodríguez

2005-01-01

Full Text Available Los restos de ajuar, recuperados en la necrópolis que han seguido el rito de la cremación, nos llegan muy alterados y requieren en ocasiones un esfuerzo especial para su comprensión. En el caso de varias piezas procedentes de La Atalaya, que formaban parte de collares, cuya interpretación ofrecemos

Estudo da procedência dos pacientes e dos tipos de tireoidopatias encontradas no Ambulatório de Endocrinologia do HSL-PUCRS nos anos de 2005 e 2006 = Study of the origin of patients and types of thyroidopathies observed in the Endocrinology Outpatient Department of Hospital São Lucas – PUCRS from 2005-2006

Directory of Open Access Journals (Sweden)

Grazia, Yara Roesch

2006-01-01

Conclusões: Os pacientes eram procedentes, em sua grande maioria, de locais próximos à região metropolitana. Acredita-se que seja menos oneroso o deslocamento do paciente a centros de atendimento de nível terciário do que a implementação de um serviço altamente especializado nessas regiões

Un tensador textil procedente de la Cueva de Nerja (Málaga

Directory of Open Access Journals (Sweden)

Francisco Javier GONZÁLEZ-TABLAS SASTRE

2009-10-01

Full Text Available Durante la segunda campaña de excavaciones en la cueva de Nerja (Maro, Màlaga, dirigidas por el Catedrático de la Universidad de Salamanca don Francisco Jordá Cerda, fue hallada una pieza que, por su notoriedad, se ha creído conveniente dar a conocer fuera del contexto general de la excavación. El soporte de la pieza es un fragmento de caña de hueso largo de 112 x 19 x 8 mm., sobre el que se han realizado cuatro perforaciones, después de haber alisado y rebajado la parte externa del hueso mediante un sistema de frotación. Asimismo, en ambos extremos, se observan dos grandes muescas en «V» con claras muestras de abrasión por frotación. Las perforaciones son en doble «V» y su realización ha debido ser mediante un perforador dentado, ya que presenta una serie de rebajes escalonados. Las medidas de las misma oscilan entre 3,5 y 4 mm. en la parte media y entre 5 y 6 mm. en la superficie exterior.

Fíbula romana “de rodilla” (Kniefibeln procedente de Hijes (Guadalajara

Directory of Open Access Journals (Sweden)

María Luisa CERDEÑO

2014-01-01

Full Text Available En este artículo se quiere llamar la atención sobre la aparición de una “fíbula de rodilla” (Kniefibeln en el yacimiento romano de Los Arroyos II en Hijes (Guadalajara; su presencia es muy significativa dado que se trata de un tipo propio de Europa central y este es el primer ejemplar conocido en la Península Ibérica. El estudio tipológico de los elementos materiales es imprescindible en la investigación arqueológica pero, más allá de su mera clasificación, deben ser considerados como parte de las prácticas sociales y como reflejo de las personas que los fabricaron y utilizaron. La presencia de esta fíbula en la Meseta, lugar muy alejado de los territorios centroeuropeos, puede indicar movimientos de personas, presumiblemente militares termestinos, entre los ejércitos que defendían el limes germánico y renano-danubiano. Esta conclusión está avalada no solo por los datos que aporta la arqueología, sino también por documentos epigráficos, lo que confirma la necesidad metodológica de manejar diferentes fuentes de información para abordar un mismo estudio histórico.

Complementos alimenticios funcionales: péptidos antihipertensivos procedentes de la leche

Directory of Open Access Journals (Sweden)

Gómez Sala B

2011-09-01

Full Text Available Los complementos alimenticios representan una importante fuente de nutrientes esenciales y otros elementos. Últimamente, se está produciendo un aumento de su consumo relacionado con la importancia que está adquiriendo el autocuidado de la salud, donde el farmacéutico juega un importante papel. Dentro de esta categoría de sustancias han aparecido recientemente los péptidos bioactivos. Estos péptidos son secuencias de aminoácidos de pequeño tamaño, inactivas dentro de la proteína intacta, pero que pueden ser liberados durante la digestión del alimento en el organismo o por un procesado previo del mismo. Tienen efectos beneficiosos en diversos casos y pueden influir positivamente en la salud de la población. Algunas actividades que han demostrado tener son: antihipertensiva, opiácea, antioxidante, quelante de minerales o inmunomoduladora. De entre los diferentes grupos de péptidos bioactivos, los péptidos antihipertensivos están recibiendo una especial atención debido a la frecuencia de la hipertensión arterial en la población mundial. Estos péptidos obtenidos por fermentación o hidrólisis enzimática han demostrado su actividad antihipertensiva como inhibidores de la enzima convertidora de angiotensina, mediante ensayos in vitro e in vivo en animales de experimentación en pruebas agudas, crónicas y toxicológicas, así como en ensayos clínicos en humanos. Son unos productos de probada seguridad y eficacia. Su aparición como complementos alimenticios permite al farmacéutico tener un recurso terapéutico, que no es de prescripción, para su indicación en aquellos casos en los que se detecten valores de presión arterial que sin llegar a la hipertensión sean susceptibles de una intervención farmacéutica.

Las remesas indianas en Gran Canaria en el primer cuarto del siglo XVII

Directory of Open Access Journals (Sweden)

Elisa TORRES SANTANA

2009-12-01

Full Text Available El estudio de las remesas indianas, del dinero que bien en efectivo o en joyas afluía a la isla de Gran Canaria procedente del continente americano, ha sido un problema que ha preocupado en gran medida a los historiadores canarios. Sin embargo, su análisis siempre ha resultado problemático, por varias razones.

Effect of addition of opaline siliceous rocks at different proportions to portland cement

Directory of Open Access Journals (Sweden)

de Luxan, M. P.

1989-03-01

Full Text Available En este trabajo se estudia la influencia de la presencia de rocas silíceas opalinas, procedentes de las provincias de Salamanca, Zamora y Avila, en las propiedades de los cementos mixtos fabricados con cemento portland y proporciones variables de estas rocas utilizadas como adiciones activas. La caracterización de estos materiales y el estudio de las propiedades de los cementos preparados revelan la capacidad puzolánica de las rocas opalinas, y su singularidad respecto a otras puzolanas naturales, así como su posibilidad de empleo en la fabricación de cementos con adiciones.

En este trabajo se estudia la influencia de la presencia de rocas silíceas opalinas, procedentes de las provincias de Salamanca, Zamora y Avila, en las propiedades de los cementos mixtos fabricados con cemento portland y proporciones variables de estas rocas utilizadas como adiciones activas. La caracterización de estos materiales y el estudio de las propiedades de los cementos preparados revelan la capacidad puzolánica de las rocas opalinas, y su singularidad respecto a otras puzolanas naturales, así como su posibilidad de empleo en la fabricación de cementos con adiciones.

Una aproximación a Wikipedia como polisistema cultural

Directory of Open Access Journals (Sweden)

Elisa Alonso-Jiménez

2015-01-01

Full Text Available En el presente trabajo, de naturaleza cualitativa e interpretativa, se abordan los alcances culturales de Wikipedia desde una aproximación transdisciplinar. Para ello, se analiza la literatura existente centrada en Wikipedia, procedente de medios de comunicación generalistas y de distintas disciplinas académicas (inteligencia artificial, ciencias de la información, educación y estudios de traducción. En dichos trabajos, fundamentalmente de naturaleza descriptiva, empírica y pragmática, se alude a Wikipedia como enciclopedia colaborativa en línea que aúna mecanismos de creación de contenido y de innovación procedentes del software libre. Nuestra propuesta reclama la pertinencia de recurrir a trabajos teóricos que contemplen la dimensión cultural de Wikipedia. Desde una aproximación semiótica, basamos nuestra hipótesis de análisis en el imaginario social de Vázquez Medel y la Teoría de los polisistemas de Even-Zohar, en los que encontramos claves para la consideración de Wikipedia como sistema cultural, en tanto que repositorio de conocimiento y relaciones humanas.

Evaluación de métodos de extracción y purificación de enzimas pectinolíticas obtenidas por fermentación en estado semisólido del Aspergillus niger

OpenAIRE

Rojas Muñoz, Víctor René

2009-01-01

El presente estudio se llevó a cabo para evaluar diferentes métodos de bioseparación orientados a la recuperación de exopoligalacturonasas (exo-PG) y endopoligalacturonasas (endo-PG) contenidas en el extracto enzimático procedente de la fermentación en medio semisólido de Aspergillus niger utilizando cáscara de naranja para la preparación de los sustratos.

Analizan partículas calientes del accidente nuclear de Palomares

OpenAIRE

León Dueñas, Sergio David

2012-01-01

Investigadores pertenecientes al Centro Nacional de Aceleradores, CNA, (Universidad de Sevilla-Junta de Andalucía-CSIC) en colaboración con la Organización Internacional de la Energía Atómica (IAEA), han llevado a cabo me didas de elementos transuránicos en partículas calientes procedentes de accidentes nucleares tales como el de Thule (Groenlandia) o Palomares (España).

Mechanical properties of hot bituminous mixes manufactured with recycled aggregate of Silestone® waste

Directory of Open Access Journals (Sweden)

Rubio, M. C.

2011-03-01

Full Text Available This article presents the results of a research project which analyzes the viability of incorporating waste material from decorative quartz solid surfacing in the manufacture of hot bituminous mixes. For this purpose, various bituminous mixes were manufactured with waste aggregate in different percentage. A set of tests were carried out that permitted the characterization of the mechanical behavior of these mixes. The results of these tests were similar to the results obtained when conventional mixes made from virgin quarry aggregate were tested. The results for moisture sensitivity as well as for wheel track rutting on mixes showed the optimal performance of this waste material even under very demanding traffic conditions. Laboratory studies showed that the use of this waste material in the manufacture of bituminous mixes is technically viable and can provide high-quality recycled aggregates at a very low cost, which can be used in the pavement of road.

Este artículo muestra los resultados de un proyecto de investigación que tiene por objeto analizar la viabilidad de incorporación de residuos procedentes de piedra decorativa en la fabricación de mezclas bituminosas en caliente. Para ello se fabricaron mezclas con áridos reciclados de residuos procedentes de piedra decorativa en distintos porcentajes, realizando un conjunto de ensayos que posibilitaron caracterizar el comportamiento mecánico de dichas mezclas. Los resultados obtenidos fueron similares a los de las mezclas convencionales fabricadas con áridos vírgenes procedentes de cantera. Los valores de resistencia conservada ante la acción del agua y deformación en pista, pusieron de manifiesto la aptitud del residuo incluso ante las condiciones de tráfico más exigentes. Los trabajos realizados en el laboratorio indican que la utilización del residuo en la fabricación de mezclas bituminosas es técnicamente viable, pudiendo obtenerse áridos reciclados de gran calidad y

Estudio de los niveles de plomo, cadmio, zinc y arsénico, en aguas de la provincia de Salamanca

Directory of Open Access Journals (Sweden)

Blanco Hernández Angel Luis

1998-01-01

Full Text Available FUNDAMENTOS: Conocer el grado de contaminación por plomo, cadmio, cinc y arsénico de las aguas de la provincia de Salamanca y su relación con la zona de procedencia de las muestras y el punto de recogida de las mismas. MÉTODO: Estudio epidemiológico transversal, observacional y descriptivo. Se han estudiado aguas procedentes de redes de abastecimiento, fuentes, manantiales, pozos, ríos, riveras y lagunas de la provincia de Salamanca, analizándose los contenidos de plomo, cadmio, zinc y arsénico de 180 muestras, mediante espectroscopía de absorción atómica. Se han comparado los niveles de contaminación por los cuatro elementos de las muestras de agua entre las cuatro unidades comarcales de la provincia. Se han comparado los niveles de contaminación por los cuatro elementos entre las aguas procedentes de redes de abastecimiento y aquellas muestras de pozos, fuentes, manantiales y aguas de superficie. RESULTADOS: Los resultados indican que un 56% de las muestras analizadas superan las concentraciones máximas admisibles de cadmio, y un 28% del total de muestras analizadas supera las concentraciones máximas admisibles de plomo, según la legislación vigente presentando niveles tolerables de zinc y arsénico. No se han observado diferencias importantes en el grado de contaminación de las aguas por los elementos estudiados entre las cuatro unidades comarcales de la provincia. No se han observado diferencias en los niveles de contaminación por los cuatro elementos entre las aguas procedentes de redes de abastecimientos y aquellas muestras de pozos, fuentes, manantiales y aguas de superficie. CONCLUSIONES: Los resultados sugieren que las aguas de la provincia de Salamanca presentan de forma "natural" altos contenidos de cadmio y plomo, probablemente debido a las características geológicas del terreno.

Intoxicação experimental em coelhos por Mascagnia sp (Malpighiaceae procedente do Estado de Santa Catarina Experimental poisoning in rabbits by Mascagnia sp (Malpighiaceae collected in the State of Santa Catarina, southern Brazil

Directory of Open Access Journals (Sweden)

Carlos Hubinger Tokarnia

1998-04-01

Full Text Available As folhas novas ou a brotação e as folhas maduras de Mascagnia sp, arbusto escandente da família Malpighiaceae, procedente de Santa Catarina, planta comprovadamente tóxica a bovinos, foram administradas sob forma de pó suspenso em água por sonda gástrica, até poucas semanas após a sua colheita, a 45 coelhos adultos. A planta colhida em três municípios do Estado de Santa Catarina, dessecada na sombra a temperatura ambiente, demonstrou possuir toxidez também para essa espécie animal. Porém a sua toxidez para coelhos foi muito variável. Os experimentos realizados não permitem concluir que a procedência da planta, o seu estado de evolução ou a época do ano da colheita, sejam fatores que influenciam a sua toxidez. Já em relação ao quadro clínico, os achados de necropsia e histopatológicos, a planta teve um comportamento muito constante. Os coelhos mostraram os primeiros sintomas de intoxicação entre 3 horas e 24h49min após o começo da administração da planta. A evolução do quadro clínico foi de 1 a 4 minutos. Os sintomas consistiram sempre em que o animal subitamente começava a fazer movimentos desordenados, geralmente violentos; finalmente ficava caído, tinha respiração dispnéica com movimentos respiratórios cada vez mais espaçados, dava alguns gritos e logo morria. Os achados de necropsia se resumiram em congestão hepática e esplenomegalia; o fígado ao corte tinha a lobulação nítida, às vezes com o centro dos lóbulos mais claro. Os exames histopatológicos revelaram alterações regressivas e circulatórias no fígado, rim e baço. A planta moída guardada em vidros hermeticamente fechados com tampa plástica e à temperatura ambiente, submetida a experimentos em outros 22 coelhos 1 ano ou mais após sua colheita, demonstrou ter perdido variavelmente em toxidez.Freshly dried and ground young leaves or sprouts and mature leaves of Mascagnia sp, a creeping shrub of the Malpighiaceae family from Santa

The tad locus: postcards from the widespread colonization island.

Science.gov (United States)

Tomich, Mladen; Planet, Paul J; Figurski, David H

2007-05-01

The Tad (tight adherence) macromolecular transport system, which is present in many bacterial and archaeal species, represents an ancient and major new subtype of type II secretion. The tad genes are present on a genomic island named the widespread colonization island (WCI), and encode the machinery that is required for the assembly of adhesive Flp (fimbrial low-molecular-weight protein) pili. The tad genes are essential for biofilm formation, colonization and pathogenesis in the genera Aggregatibacter (Actinobacillus), Haemophilus, Pasteurella, Pseudomonas, Yersinia, Caulobacter and perhaps others. Here we review the structure, function and evolution of the Tad secretion system.

Restos óseos humanos procedentes de las sierras de Guasayán

Directory of Open Access Journals (Sweden)

Drube, Hilton

2003-01-01

Full Text Available Los restos óseos humanos que son objeto del presente informe fueron exhumados en el área pedemontana oriental de las sierras de Guasayán, provincia de Santiago del Estero. La información disponible en cuanto a las condiciones del hallazgo y al contexto inhumatorio no es precisa, si bien corresponden a un sitio de ocupación prehispánico. El análisis e identificación de las piezas óseas permite constatar la presencia de al menos tres individuos en el material esqueletal. En efecto, forman parte del conjunto estudiado tres porciones distales de un mismo elemento esqueletal, en este caso correspondientes al húmero derecho. En la asignación de la edad probable de muerte solamente pudo tomarse como elemento diagnóstico el grado de atrición de las piezas dentales y algunos aspectos morfológicos generales de las piezas presentes. Con los datos obtenidos se infieren edades estimadas para el primer caso en 45-50 años; aproximadamente 30 años en el segundo; en tanto que el tercer caso correspondería a un subadulto. Dos de los individuos presentan rasgos morfoscópicos y métricos correspondientes al sexo femenino, en tanto que no existen elementos suficientes para evaluar la expresión dimórfica en el tercer caso. El neurocráneo correspondiente a uno de los individuos presenta deformación artificial del tipo tabular erecta en su variante plano sagital. Los datos recabados en el presente informe revisten carácter preliminar. Un análisis ulterior permitirá develar mayor información, particularmente en cuanto a las modificaciones de origen patológico y tafonómico observables en el material óseo en consideración.

Producción de pigmentos procedentes de Arthrospira maxima cultivada en fotobiorreactores

Directory of Open Access Journals (Sweden)

Lolymar de los Ángeles Romero Maza

2017-01-01

Full Text Available El cultivo de cianobacterias, como Arthrospira, puede realizarse en sistemas abiertos y sistemas cerrados o fotobiorreactores. El objetivo de la presente investigación fue evaluar la producción de pigmentos de Arthrospira maxima cultivada en dos tipos de fotobiorreactores. El cultivo se realizó de forma discontinua (Batch bajo ambiente controlado, en fotobiorreactores helicoidales y cilíndricos, durante 30 días, en medio Zarrouk. La determinación de los pigmentos se realizó en las fases de crecimiento exponencial y estacionario. Para los pigmentos liposolubles, la biomasa se sometió a extracción con acetona 90%, y posterior determinación por Cromatografía Líquida de Alta Eficiencia, y para la extracción de los pigmentos ficobiliproteínicos se ensayaron cuatro métodos: 1. regulador de fosfatos/enzimas; 2. solución alcalina, previo tratamiento con CaCl2; 3. buffer de fosfato, previo tratamiento con hielo seco y 4. agua (4ºC, y posterior determinación por Espectrofotometría UV-Visible. Los mayores valores de pigmentos liposolubles fueron obtenidos en los cultivos realizados en fotobiorreactor helicoidal durante la fase exponencial (clorofila a 11,08±0,006 µg mL-1; β-caroteno 1,82±0,003 µg mL-1; zeaxantina 0,72±0,002 µg mL-1; mientras que los mayores contenidos de los pigmentos ficobiliproteínicos se obtuvieron en fotobiorreactor cilíndrico, durante la fase estacionaria, utilizando el buffer de fosfato tratado con hielo seco para la extracción. Dentro de las ficobiliproteínas, fue la ficocianina la que se encontró en mayor proporción (FC = 77,74±0,767 mg L-1, seguido por la aloficocianina y ficoeritrina. Se concluye que la biomasa de Arthrospira maxima presenta potencial biotecnológico por sus altos contenidos de pigmentos.

Helmintos oxiuridae parasitos de Iguana iguana (Squamata, Lacertilia, Iguanidae procedentes do Brasil

Directory of Open Access Journals (Sweden)

P. Breves

2011-12-01

Full Text Available The results of a study on nematode fauna occurring in wild iguanas (Iguana iguana from Brazilian Northeast (Alagoas and Maranhão and Central-west (Goiás and Mato Grosso areas were presented. Six adult iguanas, three males and three females, were necropsied and the digestive system removed to examination. All the iguana specimens were heavily parasitized. The helminths diagnosed were: Ozolaimus cirratus in the cecum and colon of five iguanas; Ozolaimus megatyphlon in cecum, colon and rectum of three iguanas; and Alaeuris vogelsangi in the small intestine, cecum, colon and rectum of five animals. Two larvae of Ozolaimus sp. were recovered from the pyloric region of the stomach of one iguana. The three diagnosed species of nematodes were reported for the first time in the Brazilian Central-West region.

Sand for concrete

Directory of Open Access Journals (Sweden)

Editorial, Equipo

1959-08-01

Full Text Available Not availableEn este trabajo considera el autor sólo las arenas de origen natural, sin tener en cuenta los áridos finos procedentes de piedra machacada, ladrillo o cualquier otro material usado con este fin. Como sabemos, la arena, juntamente con los ladrillos y la grava, es uno de los materiales más utiliza4dos, principalmente en la fabricación de hormigones.

Analysis of the generation of electric energy through the use of biogas obtained from sanitary fillings in Mexico; Analisis de la generacion de energia electrica a traves de biogas procedente de rellenos sanitarios en Mexico

Energy Technology Data Exchange (ETDEWEB)

Cerda Sauvage, Tania Kalinka [Facultad de Ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

2004-06-15

tecnologia en nuestro pais. En la parte introductoria de este trabajo se plantean algunas causas que han favorecido el desarrollo de tecnologias como la aqui planteada. En la primera parte se expone que es el biogas y que condiciones son necesarias para su produccion lo cual explica la produccion de biogas en los rellenos sanitarios, ademas se describe la distribucion de los residuos solidos que dan origen a la situacion actual de los rellenos sanitarios y el proceso de produccion de biogas en estos. El trabajo continua con una descripcion del proceso de generacion de energia electrica a traves del biogas procedente de rellenos sanitarios indicandose las condiciones necesarias para que el relleno cumpla sus funciones basicas; siguiendo nuestro proceso hasta la obtencion del producto final, energia electrica. Para la descripcion del proceso y analizar algunos factores que intervienen me ha parecido conveniente incluir los principales aspectos de una planta ubicada en Monterrey, que ocupa esta tecnologia. Este proyecto muestra de una forma tangible las barreras a las que esta tecnologia se enfrenta, asi como sus principales ventajas y desventajas. Se exponen las limitantes de esta tecnologia en los aspectos tecnologicos, economicos, politicos y sociales, las barreras que pueden y deben vencerse asi como las razones que justifican el esfuerzo para vencerlas. Finalmente se presentan las conclusiones a que conduce asi como los comentarios y sugerencias con respecto al tema.

Las viviendas de la colonización alemana en el sur de Chile

Directory of Open Access Journals (Sweden)

Jocelyn Tilleria González

2017-07-01

Full Text Available La ocupación efectiva del territorio austral chileno se produjo en la segunda mitad del siglo XIX. Para su ejecución fueron claves las medidas dictadas por el Estado a través del denominado “proyecto de colonización”, que favoreció la llegada de inmigrantes procedentes de Europa durante un periodo de grandes flujos migratorios hacia el continente americano. La ciudad de Valdivia fue el punto de partida de este proyecto. En 1845 desembarcan los  pobladores procedentes de los territorios de la Confederación Alemana. En esta ciudad se producen los primeros intercambios culturales entre la población local y la extranjera, en un “laboratorio constructivo” que estableció las bases de la arquitectura de la colonización y determinó la formación de la vivienda tradicional del sur del país. Mediante un estudio histórico y constructivo hemos identificado los invariantes arquitectónicos generados en este periodo de la colonización. Hemos comprobado su permanencia en distintos ejemplos de viviendas tradicionales localizadas, entre las ciudades de Valdivia y Puerto Montt, a lo largo del territorio que fue ocupado entre 1845 y 1875 con esta población alemana.

Análisis del impacto de los Fondos Europeos 2000-2006 en la Comunidad de Madrid a partir de la matriz de contabilidad social del año 2000

Directory of Open Access Journals (Sweden)

Ángeles Cámara Sánchez

2009-11-01

Full Text Available El objetivo de este artículo es analizar el impacto de los Fondos Europeos recibidos por la Comunidad de Madrid durante el período de programación 2000-2006. Para ello se trabajará con una matriz de contabilidad social construida con datos del año 2000, SAM-MAD-2000. Se utilizará un modelo de multiplicadores lineales para analizar cómo las inyecciones exógenas de renta procedentes de estos Fondos generarán un impacto sobre las cuentas endógenas. Consideramos adecuado el uso de la técnica de multiplicadores lineales, pues la estrategia seguida tradicionalmente por la Política Regional Europea ha sido la de incentivar el desarrollo mediante inversiones que produzcan cambios estructurales en sectores clave que tiren del crecimiento de la economía regional. Esta técnica permite identificar los sectores que se ven más beneficiados ante inyecciones de renta procedentes de Fondos Europeos. La ventaja de esta metodología frente a la metodología inputoutput es su mayor alcance a la hora de reflejar el impacto de las ayudas comunitarias sobre todos los sectores de la economía, incluidos los Sectores Institucionales.

Vigilancia del riesgo de ocurrencia de incendios forestales mediante estaciones meteorológicas de superficie

Directory of Open Access Journals (Sweden)

I. M. Domínguez-Hurtado

2008-01-01

Full Text Available Para la estimación del riesgo de ocurrencia de incendios forestales se emplean diferentes variantes a nivel mundial, en este trabajo se propone un sistema de vigilancia para la detección del riesgo de ocurrencia de incendios forestales a partir de la información procedente de estaciones meteorológicas de superficie, debido básicamente a la carencia de salidas operativas diarias que evaluarán las condiciones de riesgo de fuegos a nivel nacional. Se emplearon los índices de Nesterov modificado y Monte Alegre, los cuales se estimaron a partir de los datos procedentes de las 68 estaciones meteorológicas de Cuba. A partir de dicha información se obtiene la salida mapificada diaria de cada uno de ellos, mediante la utilización de la técnica de interpolación bicubic spline. Se obtuvo un sistema operativo totalmente automatizado para la evaluación de las condiciones de riesgo de ocurrencia de incendios para Cuba, el cual brinda la posibilidad de completar y perfeccionar el sistema de vigilancia de fuegos, basado en la reducción de la escala temporal y el tratamiento de la información.

Further Pasteurella Isolates from the republic of Zambia: A brief report

African Journals Online (AJOL)

http://dx.doi.org/10.4314/tv.v20i3.4491 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...

First record of Crepidobothrium gerrardii (Cestoda: Proteocephalidae in Peru Primer registro de Crepidobothrium gerrardii (Cestoda: Proteocephalidae en el Perú

Directory of Open Access Journals (Sweden)

Luis A. Gomez-Puerta

2012-02-01

Full Text Available It is the first record of cestode Crepidobothrium gerrardii in Peru, parasitizing the intestine of a boa constrictor (Boa constrictor from Loreto. Four tapeworms were studied and identified as C. gerrardii.Se registra por primera vez la presencia en el Perú del cestodo Crepidobothrium gerrardii parasitando el intestino de una boa constrictora (Boa constrictor procedente del departamento de Loreto. Cuatro especímenes fueron estudiados e identificados como C. gerrardii.

Diseño de una planta para la captura de SO2 y CO2 de gases industriales y reutilización de residuos de minería

OpenAIRE

Macías Leal, Roberto

2016-01-01

Diseño y dimensionamiento de las diferentes unidades de una planta de captura/eliminación de gases de efecto invernadero con según la Ley 1/2005, además de la línea de tuberías que interconectan a estas unidades. Se utiliza carbonato cálcico e hidróxido cálcico procedentes de residuos mineros como agentes extractantes por sus propiedades químicas y bajo coste.

La compatibilidad vegetativa: un método para diferenciar razas fisiológicas y formas especiales de Fusarium oxysporum Schlecht.

OpenAIRE

Posada Buitrago Martha Lucia; Orozco de Amézquita Martha

1994-01-01

La compatibilidad vegetativa fue estudiada en 15 aislamientos de Fusarium oxysporum, nueve procedentes de suelos de...

Efecto de la adición de fitasa sobre la biodisponibilidad mineral in vitro en papillas infantiles

OpenAIRE

Frontela Saseta, Carmen

2007-01-01

Los cereales son empleados como dieta complementaria a la lactancia materna a partir del 4º mes ya que suministra nutrientes esenciales (especialmente hidratos de carbono, proteínas, minerales y vitaminas (particularmente tiamina). Los alimentos infantiles elaborados a partir de harinas procedentes de cereales pueden presentar compromiso en la biodisponibilidad de determinados minerales, por ello, es de gran importancia tratar de establecer los tratamientos tecnológicos necesarios para que la...

Estudo da potencialidade de populações de Biomphalaria straminea do Estado de Minas Gerais, como hospedeiras do Schistosoma mansoni Potentiality of the Biomphalaria straminea populations of the State of Minas Gerais, as hosts of Schistosoma mansoni

Directory of Open Access Journals (Sweden)

Cecília Pereira de Souza

1983-09-01

Full Text Available Caramujos de Biomphalaria straminea, descendentes de exemplares coletados em nove municípios do Estado de Minas Gerais, foram infectados experimentalmente com três cepas de Schistosoma mansoni: "LE", procedente de Belo Horizonte (MG; "SJ", procedente de São José dos Campos (SP e "AL" procedente do Nordeste (AL. As taxas de infeção variaram de 0,0 a 24,0% com a cepa "LE"; de 0,0 a 16% com a cepa "SJ" e de 2,0 a 9,0% com a cepa "AL". Os índices de infecção experimental obtidos foram semelhantes aos registrados por outros autores, para B. straminea dessa região. Comparou-se o número de cercárias de cepa "LE", eliminadas por oito exemplares de B. straminea de Baldim e oito Biomphalaria glabrata do controle, após 30 minutos de exposição à luz. O número de cercárias eliminadas por B. straminea foi de 4.550, aproximadamente cinco vezes menor que o de B. glabrata, 22.679. Discute-se a potencialidade desses moluscos como hospedeiros do S. mansoni nessa região.The decendents of Biomphalaria straminea snails collected in nine regions from the State of Minas Gerais were experimentally infected with three strains of Schistosoma mansoni: "LE", from Belo Horizonte, Minas Gerais; "SJ", from São José dos Campos, State of São Paulo and "AL", from State of Alagoas. The infection rates obtained were of 0 to 24% (LE strain, 0 to 16% (SJ strain and 2 to 9% (AL strain. These infection rates were similar to those obtained by other authors for B. straminea from this region. Comparation were made between the numbers of cercariae (LE strain shed by eight specimens of B. straminea from Baldim and eight B. glabrata of the control group, after 30 minutes of exposure to light. B. straminea shed 4,550 cercariae, about five times less than B. glabrata (22,679. The authors discuss the potentiality of theses molluscs as hosts of S. mansoni in this region.

Epidemiological aspects of the Brazilian spotted fever: serological survey of dogs and horses in an endemic area in the State of São Paulo, Brazil Aspectos epidemiológicos da febre maculosa brasileira: inquérito sorológico em cães e equinos em uma área endêmica no estado de São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Elba R.S. de Lemos

1996-12-01

Full Text Available In order to obtain information on Brazilian spotted fever, a study in domestic animals was performed in the County of Pedreira, State of São Paulo, Brazil, where 17 human cases had been notified. Serum samples obtained from animals were tested by indirect immunofluorescence for detectable antibodies to spotted fever-group rickettsiae. Seropositivity was revealed in 12 (36.4% of 33 dogs and seven (77.8% of nine horses from the endemic area. For comparison, blood samples from dogs and horses from non endemic area were tested and four (12.9% of 31 dogs and three (27.3% of 11 horses were positive. The highest titers of antibodies by IFA (IgG > 1:1024 were found only in three dogs and six horses from endemic area. The results suggest that dogs as horses may serve as environmental sentinels for estabilishing the prevalence of foci of spotted fever in Brazil.Com o objetivo de obter informações sobre a febre maculosa brasileira, um estudo em animais domésticos foi conduzido no município de Pedreira, São Paulo, Brasil, onde 17 casos humanos foram notificados. Amostras de soro obtidas de animais foram testadas pelo teste de imunofluorescência indireta para detecção de anticorpos para rickettsia do grupo da febre maculosa. Soro reatividade foi observada em 12 (36,4% dos 33 cães e sete (77,8% dos nove eqüinos procedentes da área endêmica. Para comparação, amostras de sangue de cães e de eqüinos procedentes de área não endêmica foram testadas e quatro (12,9% dos 31 cães e três dos 10 eqüinos foram positivos. Somente três cães e seis eqüinos procedentes da área endêmica tinham títulos de anticorpos imunofluorescentes elevados (> 1:1024. Os resultados obtidos sugerem que além dos cães, os eqüinos poderiam servir também como animal sentinela na febre maculosa brasileira

Histiocitosis maligna: Reporte de un caso

Directory of Open Access Journals (Sweden)

Oscar Ruiz

2004-12-01

Full Text Available Paciente varón de 14 años, procedente de Huancayo, que presenta un mes antes de su hospitalización intolerancia gástrica, ictericia, fiebre y síndrome linfoproliferativo. Se encontró en los exámenes de laboratorio pancitopenia severa por hemofagocitosis. El diagnóstico hematológico y anatomopatológico fue histiocitosis maligna. Se presenta este caso por ser una entidad infrecuente y una emergencia médica.

Factores familiares asociados al embarazo adolecente reincidente de pacientes de 15 a 19 años atendidas en el Hospital Sergio E. Bernales - Lima - 2014

OpenAIRE

Luís Osorio, Laura

2015-01-01

Objetivo. Determinar los factores familiares que están asociados con el embarazo reincidente en las adolescentes de 15 a 19 años. Métodos. Se llevó a cabo un estudio correlacional compuesto por 98 adolescentes gestantes, procedentes del Hospital Sergio E. Bernales del distrito de Comas – Lima 2014. Se utilizaron un cuestionario para medir los factores familiares y el embarazo reincidente. Para el análisis inferencial se utilizó la Prueba Chi cuadrado. Resultados. ...

La población de oso de las cavernas (Ursus spelaeus parvilatipedis n. ssp. de Troskaeta'ko-Kobea (Ataun - Gipuzkoa (Campañas de excavación de 1987 y 1988.

Directory of Open Access Journals (Sweden)

Trinidad de Torres Perezhidalgo

1991-01-01

Full Text Available Se estudia una abundante colección de restos óseos de oso de las cavernas (Ursus spelaeus parvilatipedis n.ssp. procedente de dos campañas de excavación paleontológica (1987 y 1988 llevadas a cabo en la cueva de Troskaeta (Gipuzkoa. El material es analizado métrica, taxonómica, morfológica y tafonómicamente. El trabajo incluye datos geomorfológicos sobre la cavidad.

El Título de Ingeniero Agrónomo

Directory of Open Access Journals (Sweden)

Universidad Nacional de Colombia Facultad de Agronomía

1941-08-01

Full Text Available Como es ocurrencia frecuente la controversia sobre la propiedad académica o el derecho que asiste a los profesionales que han cursado estudios superiores de Agronomía para usar el título de Ingenieros Agrónomos, es procedente aclarar este punto sobre todo hoy que en Colombia la carrera agronómica está ocupando destacada posición en el panorama social y económico del país.

Cruzamiento interespecífico entre Aedes aegypti y Aedes albopictus en el laboratorio

OpenAIRE

Martínez López, Yanisley; Martinez Pérez, Yanet; Acosta Rodríguez, Miriam; Fuentes González, Omar

2014-01-01

Introducción: existen algunos estudios realizados para verificar el posible apareamiento interespecífico, pero solo algunos trabajos han obtenido resultados positivos en este fenómeno. Objetivo: probar la posibilidad de obtener huevos viables del cruce entre Aedes aegypti y Aedes albopictus. Métodos: experimentos de apareamiento recíproco entre Aedes aegypti procedentes del insectario del Departamento de Control de Vectores del Instituto de Medicina Tropical "Pedro Kourí" y una población de A...

La escoba de bruja del cacao [Crinipellis perniciosa (Stahel Singer] : descripción de síntomas de la enfermedad

Directory of Open Access Journals (Sweden)

Tovar Germán

1991-06-01

Full Text Available La descripción de síntomas de la enfermedad es un compendia de las observaciones sobre las diversas manifestaciones de la enfermedad en yemas vegetativas, cojines florales, frutos y plántulas procedentes de semillas infectadas, derivado de estudios sistemáticos sobre la infección de C  perniciosa en el cacao (Tlieobroma cacao L con el fin de contribuir al reconocimiento y diagnóstico de la enfermedad.

ESTUDIO SEROLÓGICO SOBRE NEOSPOROSIS EN BOVINOS CON PROBLEMAS REPRODUCTIVOS EN MONTERÍA, CÓRDOBA, COLOMBIA

OpenAIRE

Teresa Oviedo S; Cesar Betancur H; Alberto Mestra P; Marco González T; Lázaro Reza G; Karina Calonge G

2007-01-01

Objetivo. Determinar la presencia de anticuerpos contra N. caninum en vacas con desordenes reproductivos. Materiales y métodos. Se utilizaron muestras de suero de 196 vacas procedentes de 27 fincas del municipio de Montería, Colombia. La prueba utilizada para la determinación de anticuerpos fue ELISA. Los criterios de inclusión para las vacas fueron: antecedentes de aborto, momificaciones, reabsorciones embrionarias y repetición de servicios. Resultados. El estudio determinó una seropositivid...

Sistema de diagnóstico para la estimación de secciones en fallo en sistemas eléctricos de potencia; A Diagnostic Systems to Estimate Faulty Sections in Power Electric Systems

OpenAIRE

Marta Bravo de las Casas; Humberto Machado Fernández; Zenaida García Valdivia; Alain Álvarez Chávez; Isis Bonet Cruz; Norma E Cabrera González

2011-01-01

El sistema de diagnóstico para la estimación de secciones en fallo (SDESF) para sistemas eléctricos depotencia (SEP) expuesto en el trabajo, usa la información procedente de los relés operados e interruptoresdisparados. Está escrito en Prolog, lenguaje de inteligencia artificial e implementado en una computadorapersonal. La tarea básica de este sistema es entrenar a los despachadores y utilizarlo como una herramientade apoyo a la toma de decisi...

Movilidad de metales en jales procedentes del distrito minero de Guanajuato, México

OpenAIRE

RAMOS-GÓMEZ, Magdalena; AVELAR, Javier; MEDEL-REYES, Alejandro; YAMAMOTO, Laura; GODINEZ, Luis; RAMIREZ, Marcela; GUERRA, Ricardo; RODRÍGUEZ, Francisco

2012-01-01

Se realizó la caracterización de tres jales del distrito minero de Guanajuato: uno abandonado hace 20 años (Presa Abandonada), uno reciente (Presa en Operación) y un jal proveniente de la mezcla de diferentes compañías (Presa Mezcla). Los tres jales presentaron carácter alcalino, condiciones aerobias con tendencias oxidantes, bajo contenido de humedad, muy baja capacidad de intercambio catiónico y ausencia de materia orgánica. Estas condiciones limitan la lixiviación de metales. Los análisis ...

Estudio sobre la incorporación y retención de plomo en zeolita natural

Directory of Open Access Journals (Sweden)

Abraham Mendoza Córdoba

2014-12-01

Full Text Available Las zeolitas son un grupo de minerales que corresponden a la clase de los silicatos (tectosilicatos, entre las diversas utilidades que tienen estos minerales está la resolución de problemas ambientales, particularmente en la eliminación de contaminantes, entre estos se encuentran los metales pesados, los cuales están presentes en los suelos de zonas industriales, en el agua potable, en los afluentes de aguas procedentes de la industria y de la actividad minera, o bien procedentes de mantos acuíferos. Su utilidad se debe en parte por tener una gran capacidad de intercambio iónico, así como también por tener una estructura con cavidades de dimensiones nanométricas, eso le da la capacidad de incorporar elementos ajenos al mineral dentro de dichas cavidades. En el presente trabajo se ha experimentado con Pb incorporándolo en zeolitas (chabazita como acetato de plomo (Pb(CH3COO2 3H2O con el fin de conocer, por una parte, la capacidad del mineral para alojar dicho metal después de activarla, y por otra parte, conocer la capacidad de retención del metal después de un proceso reversible a la incorporación de Pb (activación.

Trayectorias de persistencia y abandono de estudiantes universitarios no convencionales: implicaciones para la orientación

Directory of Open Access Journals (Sweden)

Pilar Figuera Gazo

2015-01-01

Full Text Available Uno de los objetivos de la política universitaria a nivel nacional e internacional ha sido la diversificación de las vías de entrada a la universidad para favorecer el acceso más generalizado a la educación superior. Sin embargo, el establecimiento de políticas de acceso debe ir acompañado de medidas para garantizar la permanencia en el sistema. La orientación es uno de los instrumentos más significativos. El artículo presenta los resultados de una investigación longitudinal sobre los procesos de transición y persistencia de una cohorte de estudiantes de ADE y Pedagogía de la Universidad de Barcelona que iniciaron los estudios en el año 2010. Los datos confirman que las situaciones de retraso académico, fracaso y abandono son significativamente superiores entre los estudiantes que accedieron a través de las vías no convencionales (específicamente aquellos procedentes de las vías CFGS, mayores de 25 años y 45 años. A partir de los resultados procedentes de las bases de datos institucionales y de los cuestionarios de seguimiento, se discute las implicaciones para el establecimiento de acciones de orientación y tutoría que contribuyan a la verdadera equidad del sistema.

A educação física tradicional sofre, mas ainda vive - doi: 10.4025/actascieduc.v36i1.21583

Directory of Open Access Journals (Sweden)

Jarbas Gomes Remonte

2014-02-01

Full Text Available Esportivista, militarista, disciplinadora, acrítica... são vários os adjetivos utilizados para qualificar negativamente a Educação Física tradicional. Isso provocou um interesse imediato em verificar se tais críticas são procedentes e realizar uma breve discussão sobre possibilidades de utilização de elementos ditos tradicionais na atual Educação Física escolar. Para tanto, buscamos em pesquisadores da História da Educação Física brasileira referências à Educação Física tradicional que justifiquem aquelas críticas. Em seguida, recorremos à Didática para conceituar a Pedagogia tradicional e aplicar esse conceito à Educação Física, de modo que ela possa ser denominada também de tradicional. Num terceiro passo, analisamos algumas críticas a esse tradicionalismo na tentativa de verificar se são procedentes. Concluímos que, se algumas o são, outras apresentam equívocos. Entendemos que há uma confusão conceitual importante quando se falaem Educação Físicatradicional. Por fim, sugerimos que a Educação Física tradicional ainda tenha espaço no quadro atual da Educação Física escolar.

Epidemic pasteurellosis in a bighorn sheep population coinciding with the appearance of a domestic sheep.

Science.gov (United States)

George, Janet L; Martin, Daniel J; Lukacs, Paul M; Miller, Michael W

2008-04-01

A pneumonia epidemic reduced bighorn sheep (Ovis canadensis) survival and recruitment during 1997-2000 in a population comprised of three interconnected wintering herds (Kenosha Mountains, Sugarloaf Mountain, Twin Eagles) that inhabited the Kenosha and Tarryall Mountain ranges in central Colorado, USA. The onset of this epidemic coincided temporally and spatially with the appearance of a single domestic sheep (Ovis aires) on the Sugarloaf Mountain herd's winter range in December 1997. Although only bighorns in the Sugarloaf Mountain herd were affected in 1997-98, cases also occurred during 1998-99 in the other two wintering herds, likely after the epidemic spread via established seasonal movements of male bighorns. In all, we located 86 bighorn carcasses during 1997-2000. Three species of Pasteurella were isolated in various combinations from affected lung tissues from 20 bighorn carcasses where tissues were available and suitable for diagnostic evaluation; with one exception, beta-hemolytic mannheimia (Pasteurella) haemolytica (primarily reported as biogroup 1(G) or 1(alphaG)) was isolated from lung tissues of cases evaluated during winter 1997-98. The epidemic dramatically lowered adult bighorn monthly survival in all three herds; a model that included an acute epidemic effect, differing between sexes and with vaccination status, that diminished linearly over the next 12 mo best represented field data. In addition to the direct mortality associated with epidemics in these three herds, lamb recruitment in years following the pneumonia epidemic also was depressed as compared to years prior to the epidemic. Based on observations presented here, pasteurellosis epidemics in free-ranging bighorn sheep can arise through incursion of domestic sheep onto native ranges, and thus minimizing contact between domestic and bighorn sheep appears to be a logical principle for bighorn sheep conservation.

Evaluación del tamizaje selectivo de errores innatos del metabolismo en el instituto materno infantil en colombia

OpenAIRE

Bermúdez, M.; Arteaga, C.; Cifuentes, Y.

2011-01-01

El programa de detección de Errores Innatos del metabolismo del Instituto Materno Infantil (IMI) de Bogotá, en un periodo de cinco años ha estudiado 1.147 pacientes de alto riesgo (nacidos y remitidos al IMI como también procedentes de otras Instituciones) con:
1.Antecedentes en la historia familiar
2.Alteraciones neurológicas.
3.Sepsis sin respuesta al tratamiento.
4.Asfixia perinatal severa, falla cardiaca, dificultada respiratoria sin causa evide...

Vacunas, biotecnología y su relación con el aborto provocado

OpenAIRE

José Luis Redondo Calderón

2008-01-01

Las vacunas de células diploides humanas (WI-38, MRC-5) tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6) transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respi...

Educaci??n antirracista: algunas propuestas para su incorporaci??n a proyectos educativos

OpenAIRE

L??pez L??pez, Mar??a del Carmen; Fern??ndez Herrer??a, Alfonso

1996-01-01

En los ??ltimos a??os y con motivo de la crisis econ??mica, la enorme desigualdad social y los frecuentes conflictos pol??ticos, estamos asistiendo a una creciente afluencia de inmigrantes, exiliados o refugiados que procedentes de pa??ses en conflicto tienden hacia pa??ses que puedan proporcionalres mejores condiciones de vida. Este fen??meno socio-pol??tico parece venir acompa??ado de un recudecimiento de las ideas y movimientos racistas y xen??fobos en los pa??ses receptores, impulsado por...

Aislamiento de microorganismos productores de biosurfactantes y lipasas a partir de efluentes residuales de camales y suelos contaminados con hidrocarburos

OpenAIRE

Lizzie Karen Becerra Gutiérrez; María Valeria Horna Acevedo

2016-01-01

Los biosurfactantes son moléculas anfipáticas que reducen la tensión en la interfase, incrementando así la solubilidad en agua y disponibilidad de compuestos orgánicos, son producidos por bacterias, hongos, y levaduras. Para el aislamiento de bacterias productoras de biosurfactante y lipasas, se sembró en medios inductores 10% de efluentes residuales procedentes de camales y suelos de grifos contaminados con hidrocarburos de la Provincia de Trujillo - Perú. Los cultivos aislados se sembraron ...

Consumo de frutos secos y aceites vegetales en personas con diabetes mellitus tipo 1

OpenAIRE

Ferrer-García, Juan Carlos; Granell Vidal, Lina; Muñoz Izquierdo, Amparo; Sánchez Juan, Carlos

2015-01-01

Introducción: estudios recientes han demostrado los beneficios cardiovasculares de la dieta mediterránea enriquecida con aceite de oliva y frutos secos. Las personas con diabetes, que tienen un mayor riesgo de complicaciones cardiovasculares, podrían beneficiarse en gran medida de seguir ese tipo de patrón alimentario. Objetivos: análisis de la ingesta de grasas vegetales procedentes de frutos secos y aceites vegetales en pacientes con diabetes mellitus tipo 1 (DM1). Métodos: estudio transver...

Propiedades físicas y mecánicas de los agregados reciclados de concreto

OpenAIRE

Gómez Soberón, José Manuel Vicente; Agulló Fité, Luís; Vázquez Ramonich, Enric

2002-01-01

Las propiedades a largo plazo, como la contracción y fluencia, de los concretos reciclados(CR) presentan algunas variaciones con los concretos usuales. Dichas variaciones son interpretadas por las diferencias de densidad, porosidad y absorción de los agregados reciclados procedentes de concreto (ARC), dada su constitución de carácter parcial. En este trabajo se presenta el análisis experimental de especimenes de CR con reemplazo de agregados naturales por ARC. Se proporcionan y discuten la...

Medio de cultivo utilizando residuos-sólidos para el crecimiento de una bacteria nativa con potencial biofertilizante

OpenAIRE

Lara Mantilla, Cecilia; García Támara, Liliana Pahola; Oviedo Zumaqué, Luis E

2010-01-01

En el presente trabajo se muestran los resultados obtenidos de la evaluación del crecimiento, desarrollo y viabilidad de una cepa bacteriana nativa Azotobacter A15M2G con potencial biofertilizante, sobre un medio de cultivo preparado con residuos sólidos vegetales procedentes del mercado: Brassica Oleracea (repollo), Lactusa sativa (lechuga) y Allium fistulosum (cebollín). El crecimiento de la bacteria en el medio de residuo vegetal a diferentes concentraciones: 25, 50 y 75% p/v fue evaluado,...

Transformación de biomasa en productos de química fina y biocarburantes mediante procesos sostenibles.

OpenAIRE

De La Torre Alfaro, Olalla

2013-01-01

En los últimos años se han incrementado de manera notable los gases responsables del efecto invernadero que contribuyen al calentamiento global del planeta. Este aumento está estrechamente relacionado con el consumo de materias procedentes de recursos fósiles, es decir, de naturaleza no renovable. La presente tesis doctoral se ha centrado en el diseño de rutas sostenibles para obtener compuestos de interés para la industria a partir de materias primas derivadas de biomasa....

INNOVACION TECNOLOGICA Y COMERCIAL DE PRODUCTOS FORESTALES NO MADEREROS (PFNM) EN CHILE.

OpenAIRE

VALDEBENITO R., GERARDO

2013-01-01

Los Productos Forestales No Madereros (PFNM) son definidos por FAO como "bienes de origen biológico distinto de la madera, procedentes de los bosques, de otros terrenos arbolados y de árboles situados fuera de los bosques". Chile posee una gran cantidad de PFNM, los cuales han sido utilizados históricamente por nuestra población, destacando las especies que poseen propiedades medicinales, frutos silvestres y alimentos, entre otros bienes. Este rubro económico, a pesar de presentar bajos ni...

Optimización y análisis del comportamiento de materiales tratados con cal en carreteras : aplicación a lodos de tuneladora y mezclas bituminosas

OpenAIRE

Movilla Quesada, Diana

2012-01-01

En esta tesis doctoral se presentan diversos estudios experimentales mediante los cuales se mejoran materiales utilizados en carreteras, tanto en terraplenes como firmes, añadiendo diferentes filleres. Esta tesis está constituida por una compilación de artículos centrados en una misma línea de investigación: Tratamiento de materiales con cal, como material de aportación. Este tratamiento abarca diversos tipos de materiales, desde lodos procedentes de tuneladora que no han sido dispuestos e...

Mecanismos de Adherencia de Pseudomonas aeruginosa a nuevos Biomateriales de uso Médico.

OpenAIRE

Martínez Martínez, Luis

2017-01-01

En 1882 Gessard aisló por primera vez Pseudomonas aeruginosa (Bacillus pyoceaneus) de muestras procedentes de heridas quirúrgicas. Hasta 1947 sólo se conocían 91 casos de bacteriemia por este microorganismo, pero en la década actual, cien años después de su descripción, Pseudomonas aeruginosa, ha pasado a ser un microorganismo de creciente interés en patología humana debido a su estrecha relación con enfermos inmun...

Desafíos migratorios de carácter multidimensional en el norte de África

OpenAIRE

Klaauw, Johannes van der

2007-01-01

Dado que el control de las fronteras europeas es ahora más estricto, cada vez son más los refugiados y solicitantes de asilo procedentes de los países subsaharianos que deambulan por el norte de África. En ausencia de estructuras estatales eficaces que les den cobertura y debido al incremento en el número de solicitudes, ACNUR está trabajando para reforzar la capacidad de protección en la región, especialmente en Marruecos.

The sensitivity of the most common microorganisms of pig liquid manure to the effect of 60Co irradiation

International Nuclear Information System (INIS)

Szemeredy, Gy.; Simon, J.

1979-01-01

In model experiments the most common representatives of pathogens and facultative pathogens of pig liquid manure contaminating bacterial flora were examined for their sensitivity to different doses of 60 Co, using liquid medium supplemented with 1% glucose, as well as Korthof-medium and different kinds of selective media. Erysipelothrix rhusiopathiea, Brucella suis, Mycoplasma hyorhinis and Pasteurella haemolytica proved to be the most senstive ones to irradiation, as they did not survive 100 krad dose. The highest resistances were observed in the cases of the following microorganisms: the spore containing Bacillus anthracis, killed by 700 krad irradiation dose, the saprophytic and pathogenic Mycobacteria and the spore containing Clostridium perfringens, killed by 1000-1500 krad irradiation. (author)

Caracterización del material granular obtenido por reciclado de residuos cerámicos

OpenAIRE

Blandón González, Begoña

2003-01-01

Debe destacarse, en primer lugar, como objetivo general, el interés por conservar la calidad del Medio Ambiente en el que vivimos mediante la minimización de los residuos producidos por la actividad humana, concretamente los derivados de los trabajos de construcción. Tradicionalmente, estos residuos procedentes de la construcción y/o demolición de edificios, han tenido como destino final las escombreras, produciendo un Impacto negativo, no sólo de deterioro del paisaje, sino en la propia capa...

Inmigración comunitaria ¿discriminación inversa? (Carlota Solé, dir.)

OpenAIRE

Inma Hurtado

2007-01-01

Inmigración comunitaria ¿discriminación inversa? es un libro sobre inmigración, pero no la que habitualmente suele ser objeto de análisis, sino que en este caso se trata de la inmigración llamada comunitaria, esto es, la procedente de la Unión Europea. De hecho, el panorama migratorio en el Estado Español es mucho más heterogéneo que el que el imaginario social de la inmigración nos ofrece.

Nuevos movimientos migratorios en una unión europea ampliada

Directory of Open Access Journals (Sweden)

Andrés Tornos Cubillo

2014-11-01

Full Text Available Con ocasión de la última ampliación de la Unión Europea se han suscitado en diversos países no pocas preocupaciones a propósito de un posible aumento excesivo de los flujos migratorios procedentes de la antigua Europa del Este. Se ha elaborado una dura normativa para impedirlo y se han realizado numerosos estudios para prevenir una tal incidencia. Pero ni las cifras hoy disponibles ni los trabajos de prospectiva confirman en modo alguno esos temores.

Estudio del efecto del pretratamiento básico con peróxido de hidrógeno en la liberación de azúcares de microalgas

OpenAIRE

Castaño Ojero, Lucía

2015-01-01

El trabajo estudia la valorización de biomasa algal procedente de un tratamiento de aguas residuales domésticas, mediante su transformación en biocombustibles. Se consiguen así dos objetivos medioambientales, el tratamiento de aguas residuales mediante una tecnología limpia y el aprovechamiento de los residuos generados para obtener biocombustibles, que sustituyan a los combustibles fósiles. El estudio se centra en la producción de alcoholes a partir de la fracción de hidratos de carbono exis...

Eliminación del arsénico en diferentes clases de aguas con zeolitas naturales

OpenAIRE

Lazo Camposano, Roberto

2013-01-01

Para el desarrollo del presente trabajo de Investigación se ha tenido Ia referencia sobre todo de las contaminaciones de las diferentes aguas sea este de origen natural, aguas subterráneas, aguas de rio, aguas procedentes de Iluvias, aguas de filtraciones, aguas de minas, etc, es decir toda clase de agua que contenga el arsénico que es perjudicial a la salud humana. En el presente trabajo se utilizará un medio adsorbente que consiste de zeolita natural (clinoptilolita) recubierta con óxido...

Las dimensiones de la identidad europea

OpenAIRE

Albert Guardiola, María Carmen; Santacreu, Oscar

2004-01-01

Este working paper pertenece a una serie procedente del proyecto de investigación financiado por la Comisión Europea: "Pioneers of Europe's Integration ‘from Below’: Mobility and the Emergence of European Identity among National and Foreign Citizens in the EU" (PIONEUR) (V Programa Marco – Contrato HPSE–CT–2002–00128). Más información sobre el proyecto en la web site de PIONEUR: http://www.obets.ua.es/pioneur. En la actualidad, Europa sigue siendo un espacio de continuos cambios y transfor...

Fundamentos psicopedagógicos de las inteligencias múltiples

OpenAIRE

Ferrándiz, Carmen; Prieto, María Dolores; Bermejo, María Rosario; Ferrando, Mercedes

2006-01-01

El objetivo del trabajo es estudiar las raíces psicopedagógicas del modelo de las Inteligencias Múltiples. Analizamos los datos procedentes de nuestro estudio realizado con 294 alumnos (preescolar y primeros niveles de educación primaria). Es hacia 1983 cuando Gardner publica su libro titulado Estructura de la Mente, donde propone la existencia de siete inteligencias, que más tarde amplia a ocho (lingüística, lógico-matemática, visoespacial, corporal-cinestésica, musical, interpersonal, i...

SENSIBILIDADE IN VITRO DE STAPHYLOCOCCUS AUREUS ISOLADOS DE AMOSTRAS DE LEITE DE VACAS COM MASTITE SUBCLÍNICA

Directory of Open Access Journals (Sweden)

Albenones José de Mesquita

2006-10-01

Full Text Available Foram submetidas a teste de sensibilidade in vitro a cinco antibióticos e quimioterápicos, 291 cepas de Staphylococcus aureus isolados de 667 amostras de leite procedentes de 375 vacas reagentes ao California Mastitis Test (CMT. Verificaram-se os seguintes percentuais de sensibilidade aos antimicrobianos: gentamicina, 90,72% (264/291; enrofloxacina, 89,35% (260/291; cefaperazona, 88,66% (258/291; kanamicina, 87,63% (255/291 e penicilina, 23,71% (69/291. PALAVRAS-CHAVE: Leite bovino, mastite subclínica, antimicrobianos.

Apropiaciones sociodeportivas de espacios públicos urbanos. El caso de la comunidad cochabambina en Barcelona

OpenAIRE

Borrás Tissoni, Omar

2013-01-01

[spa] Estudio cualitativo y cuantitativo de las apropiaciones de espacios públicos y semipúblicos de Barcelona y poblaciones limítrofes para la práctica del deporte por parte de colectivos de trabajadores extranjeros procedentes preferentemente de la región de Cochabamba, en Bolivia. Una parte del trabajo investigador se realizó en las poblaciones bolivianas de origen, con el fin de establecer qué pautas se reproducen y cuáles se modifican o se generan de nuevo en Catalunya. La investigac...

Diversidad genética y persistencia ambiental de "Listeria Monocytogenes" en dos plantas de procesado de carne de cerdo ibérico: influencia de la resistencia a desinfectantes de amonio cuaternario

OpenAIRE

Ortiz Jareño, María del Sagrario

2016-01-01

La clasificación en subtipos moleculares de los aislados de L. monocytogenes procedentes de productos cárnicos y del ambiente de las plantas de procesado donde se elaboran, habitualmente muestra la presencia de un reducido número de cepas y la persistencia durante largos periodos de tiempo de cepas específicas que sobreviven a la limpieza y la desinfección. Entre los mecanismos que facilitan la supervivencia de L. monocytogenes en el ambiente de las plantas de procesado de alimentos se incluy...

La ciudad en el contexto de la Internet de las cosas

OpenAIRE

Roman Castellanos, Esteban

2014-01-01

Obtención y publicación web de magnitudes físicas procedentes de todo tipo de dispositivos, como teléfonos móviles, para mejorar la gestión y desarrollo de las ciudades desde una perspectiva sostenible. Obtenció i publicació web de magnituds físiques procedents de tot tipus de dispositius, com telèfons mòbils, per millorar la gestió i desenvolupament de les ciutats des d'una perspectiva sostenible. Master thesis for the Free Software program.

Caso clínico de la Unidad de Medicina Interna Hipertensión arterial de origen renovascular

Directory of Open Access Journals (Sweden)

Análida E. Pinilla Roa

1993-10-01

Full Text Available Hombre de 28 años, natural y procedente de Bogotá, consulto por cefalea progresiva fronta-occipital de treinta horas de evolución, acompañada de vomito en dos oportunidades y de trastorno de la conciencia, con relajación del esfínter vesical. La esposa informo episodio similar un mes ames, cuando fue hospitalizado, encontrándose HTA y hemorragia subaracnoidea. Salió contratamiento triconjugado (captopril, nifedipina, propanolol, el cual suspendió ocho días antes del ingreso.

Tres nuevas especies de Sterculia L. (Sterculiaceae) de Venezuela

OpenAIRE

MONDRAGÓN, Alcides

2005-01-01

Como resultado del estudio taxonómico del género Sterculia L. (Sterculiaceae) en Venezuela, se describen tres nuevas especies: Sterculia abbreviata, procedente de los estados Amazonas, Aragua, Delta Amacuro, Mérida y Miranda; S. amazonica, a lo largo del Río Ocamo del estado Amazonas, y estado Bolívar; S. steyermarkii, en bosques siempreverdes en las costas del estado Miranda y en el estado Mérida. As a result of a taxonomical study of the genus Sterculia L. (Sterculiaceae) in Venezuela, t...

Renewable energy resources of the marine environment and its control requirements

OpenAIRE

García Moreno, Emilio; Correcher Salvador, Antonio; Quiles Cucarella, Eduardo; Morant Anglada, Francisco José

2016-01-01

[ES] En este artículo se presentan una serie de dispositivos generadores de energía renovable procedente del entorno marino, que en los últimos años han despertado creciente interés. En especial se describen los tipos principales de Generadores Eólicos Flotantes, las Turbinas de Corriente Marina y diversos dispositivos basados en Energía Undimotriz. Se destacan los principales requerimientos a considerar bajo el punto de vista de la ingeniería de control, considerando los objetivos d...

Nuevas herramientas para el análisis de opinión en flujos de texto

OpenAIRE

Hidalgo Santamaría, Vicente

2015-01-01

La minería de opinión se ha convertido en uno de los objetivos de las grandes plataformas de Internet, analistas y entes gubernamentales que desean conocer las opiniones de los usuarios que hacen uso de ellas. En este proyecto fin de carrera se ha implementado un sistema de procesamiento de flujos de textos procedentes de Twitter, basado en el uso de algoritmos de análisis de sentimiento. Se pretende analizar las diferentes opciones existentes hasta ahora. Previamente a ésta...

Estudio de técnicas de análisis y tratamiento de información en P300: Aproximaciones hacia la clasificación adaptativa

OpenAIRE

Sarasa Durán, Guillermo

2016-01-01

Las interfaces cerebro máquina (Brain Computer Interface, BCI) constituyen un acceso alternativo a las tecnologías de la información, mediante el registro y clasificación de señales procedente de la actividad cerebral. Las tecnologías de la información, abarcan cualquier sistema, servicio, o dispositivo informático. Como cualquier otra Interfaz de Usuario, los sistemas BCI representan un intermediario entre el software principal y el usuario. En este caso, este tipo de interfaz...

Entrenamiento asistido por neurofeedback: análisis de los efectos psicofisiológicos inmediatos y factores de personalidad influyentes

OpenAIRE

Aliño Costa, Marta

2017-01-01

Basado en la tecnología y principios de interfaz cerebro-ordenador (del inglés brain computer interface o BCI), el entrenamiento asistido por Neurofeedback (NF) se concibe como una técnica de autorregulación. Su paradigma estándar es, por excelencia, el condicionamiento operante o instrumental con la finalidad de enseñar a los individuos a controlar su actividad cerebral (Frank et al., 2010). Concretamente, la información procedente de las ondas cerebrales es representada a tiempo real en for...

Enterramiento y ritual en el Neolítico Hispano

Directory of Open Access Journals (Sweden)

Isabel RUBIO DE MIGUEL

2009-10-01

Full Text Available La religiosidad es uno de los aspectos menos conocidos, por no decir el menos, dentro del mundo neolítico hispano. Nada o muy poco procedente del registro arqueológico perteneciente a esta etapa puede incluirse en este apartado. Artículos como el de Siret sobre las religiones neolíticas peninsulares han de ser forzosamente revisados o incluso desechados, ya que prácticamente la totalidad de los materiales allí citados pueden ser atribuidos claramente a contextos diferentes.

Residuos de almidones y el uso de plantas durante el holoceno medio en el cauca medio (colombia)

OpenAIRE

Aceituno, Francisco; Lalinde, Veronica

2012-01-01

En este artículo se presentan datos de almidones que sugieren el uso de plantas porgrupos forrajeros que ocuparon el río San Eugenio (Cauca medio) durante la primeramitad del Holoceno medio. Se logró recuperar una gran cantidad de granos dealmidón (325) de instrumentos de molienda (manos y placas) procedentes de nivelesprecerámicos del sitio arqueológico La Pochola. Los datos indican el aprovechamientode plantas ricas en carbohidratos, entre las que se encuentra una variedad de Phaseolus(silv...

Salmonella spp. in carcasses, mechanically deboned meat, sausages and chicken meat

OpenAIRE

Carvalho, Angela Cleusa de Fátima Banzatto de; Cortez, Ana Lígia Lordello

2005-01-01

Alimentos de origem animal representam papel fundamental na epidemiologia das salmoneloses humanas. Apesar dos avanços tecnológicos, a carne de frango ainda é passível de contaminação bacteriana, especialmente por microrganismos do gênero Salmonella, que podem encontrar-se albergados no trato intestinal ou em outra parte do corpo das aves. O presente trabalho objetivou pesquisar a ocorrência de Salmonella em carne de frango e derivados procedentes da região Nordeste do Estado de São Paulo. Fo...

Caso clínico de la Unidad de Medicina Interna : absceso hepático piógeno

Directory of Open Access Journals (Sweden)

Juan Manuel Gómez

1993-04-01

Full Text Available Se presenta el caso de un hombre de 23 años procedente de Puerto Lleras (Meta, operario de motosierra, soltero, quien ingresó a esta institución, remitido de un Centro de Salud urbano. Refería sintomatología de aproximadamente 12 días de evolución, consistente en fiebre vesperal, astenia, adinamia, hiporexia, mialgias, cefalea frontal, dos episodios diarreicos sin moco, pujo o sangre. Además, vomito, nauseas y dolor urente en epigastrio y zona subcostal derecha.

Servidores públicos del estado con especial protección constitucional. Políticas de prevención del daño antijurídico en relación con su retiro del servicio

OpenAIRE

Fajardo Urrea, Claudia Bolena

2015-01-01

El retiro del servicio de los empleados públicos aparece como una facultad reglada en las normas del empleo público que, cuando se da alguna de las hipótesis legales que lo hacen procedente, facultan al nominador para ejercer sus atribuciones legales, persiguiendo, ante todo, razones del servicio: su mejora, renovación, eficiencia y moralidad, entre otras. A partir del concepto de una buena administración del Estado, establecer la procedencia y elementos estructurales de una política de ...

Servidores públicos del estado con especial protección constitucional. Políticas de prevención del daño antijurídico en relación con su retiro del servicio

OpenAIRE

Fajardo Urrea, Claudia Bolena

2015-01-01

El retiro del servicio de los empleados públicos aparece como una facultad reglada en las normas del empleo público que, cuando se da alguna de las hipótesis legales que lo hacen procedente, facultan al nominador para ejercer sus atribuciones legales, persiguiendo, ante todo, razones del servicio: su mejora, renovación, eficiencia y moralidad, entre otras. El problema jurídico a resolver con el presente trabajo se plantea a partir del concepto de una buena administración del Estado, estab...

The bowel: A key component of the immune system

OpenAIRE

Ramiro-Puig, E.; Pérez-Cano, F. J.; Castellote, C.; Franch, A.; Castell, M.

2008-01-01

El intestino se halla expuesto constantemente a una elevada carga antigénica procedente de la dieta y de bacterias comensales. El tejido linfoide asociado al intestino (Gut-Associated Lymphoid Tissue, GALT) constituye la parte más extensa y compleja del sistema inmunitario y es capaz de discriminar de forma eficaz entre patógenos invasivos y antígenos inocuos. El conocimiento de su particular subdivisión en tejido organizado, inductor de la respuesta inmunitaria (placas de Peyer y ganglios li...

Campo Acústico en Recintos de Planta en I En L y en U. Aplicación al Diseño Acústico en Restauración

OpenAIRE

Rodriguez Alves, Rosa Maria

2012-01-01

Este trabajo aborda el estudio de la calidad acústica de restaurantes y propone la inteligibilidad como magnitud adecuada para su valoración. La conversación en el entorno de cada mesa se considera como señal de interés para quienes la ocupan, mientras que las conversaciones de los comensales de las restantes mesas se consideran ruido perturbador junto con el procedente de otras fuentes interiores o exteriores, ruido este que por otra parte suele estar limitado por ordenanzas o reglamentacion...

Biodisponibilidad y especiación de arsénico en las algas marinas

OpenAIRE

García Sartal, Cristina

2013-01-01

Las algas, desde un punto de vista alimenticio, constituyen una fuente de proteínas, aminoácidos esenciales, vitaminas, lípidos y minerales. Sin embargo, las algas también pueden acumular elementos no esenciales procedentes del agua marina circundante, entre ellos, el arsénico, elemento ampliamente reconocido por su toxicidad. La toxicidad del arsénico depende fundamentalmente de su especiación, resultando más toxicas las especies inorgánicas de arsénico que sus correspondie...

Dos cupas complutenses

Directory of Open Access Journals (Sweden)

Stylow, Armin U.

2006-12-01

Full Text Available Publication of two cupae from the ancient territory of Complutum. One was found in excavations in Alcalá de Henares (Madrid and is unpublished; of the other one, which came to light in the church of Alovera (Guadalajara, a new reading is given.Se publican dos cupas del antiguo territorio de Complutum, una, inédita, encontrada en excavación en Alcalá de Henares (Madrid, y la segunda, procedente de la iglesia de Alovera (Guadalajara, con una nueva lectura.

Caracterización acústica de mezclas bituminosas con polvo de caucho: correlación con textura

OpenAIRE

Paje, S.E.; Bueno, M.; Terán, F.; Miró Recasens, José Rodrigo; Pérez Jiménez, Félix Edmundo; Martínez Reguero, Adriana Haydée

2009-01-01

El objeto de este trabajo ha sido caracterizar el comportamiento acústico in situ de mezclas bituminosas que contienen polvo de caucho procedente de neumáticos fuera de uso incorporadas por diferentes métodos. Las mezclas han sido extendidas en diversos tramos de ensayo experimentales de 200 m de longitud en la carretera B-140 en Barcelona. Los tramos experimentales han sido pavimentados con una capa de rodadura de unos 3 cm de espesor con mezcla de microaglomerado discontinuo tipo M-10...

Evaluación del proceso de extracción de aceite de aguacate hass (Persea americana Mill) utilizando tratamiento enzimático

OpenAIRE

Buelvas Salgado, G. A; Patiño Gómez, J. H; Cano-Salazar, J. A

2012-01-01

Introducción. El aceite de aguacate es rico en vitaminas A, B, C y E, y está compuesto mayoritariamente por ácidos grasos monoinsaturados los cuales reducen de manera efectiva el nivel de colesterol en la sangre, ayudando en la prevención de enfermedades cardiovasculares. Objetivo. Evaluar el rendimiento de extracción de aceite de aguacate Hass (Persea americana Mill) en estado E3-M (maduro) procedente del Oriente Antioqueño, empleando complejos enzimáticos comerciales. Materiales y métodos. ...

Diseño de una planta de producción de vinagre a partir de melazas de remolacha azucarera

OpenAIRE

González Alba, Almudena

2014-01-01

Según el Real Decreto 56/2002, de 18 de enero, se describe a la melaza de remolacha como “un subproducto constituido por el residuo de jarabe recogido durante la fabricación o el refinado del azúcar procedente de remolachas azucareras”. Es interesante destacar la gran cantidad de nutrientes presentes en las melazas, haciéndolas aptas como suplemento alimenticio en gran variedad de piensos animales. Las melazas de remolacha serán el sustrato en la primera etapa de fermentació...

Worldwide Report, Nuclear Development and Proliferation No. 186

Science.gov (United States)

1983-05-03

normality that at first took a great deal of effort to achieve. 33 C___ ACIRC//TO AGUA VAPOR SECUNt/ CMMWMI CU’CTO AG3UA RMFI(3PACION 1. Nucleo del reactor 6...is used to cool various components of the powerplant, but in any case it is separated from possibly contaminated ele- ments by at least two...Central do Asc6 10. Aqua do ref rigeracibn hay 3 generadorea do vapor) (Procedente en este caso del rio Ebro) 4. Presurizador 11. Transformador (Sirve

Análisis del impacto de los Fondos Europeos 2000-2006 en la Comunidad de Madrid a partir de la matriz de contabilidad social del año 2000

Directory of Open Access Journals (Sweden)

Ángeles Cámara Sánchez

2009-01-01

mediante inversiones que produzcan cambios estructurales en sectores clave que tiren del crecimiento de la economía regional. Esta técnica permite identificar los sectores que se ven más beneficiados ante inyecciones de renta procedentes de Fondos Europeos. La ventaja de esta metodología frente a la metodología inputoutput es su mayor alcance a la hora de reflejar el impacto de las ayudas comunitarias sobre todos los sectores de la economía, incluidos los Sectores Institucionales.

Dimensionamiento de una EDAR para una población de 60.000 habitantes equivalentes

OpenAIRE

Vila Gordillo, Daniel Esteban

2018-01-01

La creciente importancia del agua como recurso natural indispensable, irreemplazable y altamente vulnerable, unida al creciente interés por la protección del medio ambiente, en general, han motivado una concienciación de la necesidad de depurar aguas procedentes de usos, tanto urbanos como industriales, e incluso, más recientemente, de los efluentes de riego. Es por ello necesario ayudar a la naturaleza con el diseño y la construcción de depuradoras que limiten los parámetros de c...

Evaluación del funcionamiento de motores de combustión interna trabajando con biodiesel. // Evaluation of engine performance working with biodiesel.

OpenAIRE

R. Piloto Rodríguez; R. Sierens; S. Verhelst; N. Ferrer Frontela

2008-01-01

En el presente trabajo se determinó la característica exterior de velocidad para dos motores de combustión internatrabajando con combustible biodiesel procedente de varias fuentes naturales y se comparó con la característica exterior develocidad de los motores originalmente trabajando con combustible diesel. Los motores fueron evaluados con variacionesde carga y velocidad. En uno de los motores ensayados fue determinada la presión en el interior de la cámara decombustión con el objetivo de ev...

Percepción de los afroamericanos por parte del migrante laboral mexicano en Estados Unidos

OpenAIRE

Ricardo CONTRERAS-SOTO; Roberto HERNÁNDEZ-SAMPIERI

2011-01-01

La presente investigación forma parte de un estudio más amplio donde se analiza la percepción de distintas alteridades por parte de inmigrantes mexicanos en Estados Unidos, con testimonios de 1 265 migrantes procedentes principalmente de la región del corredor industrial abajeño de Guanajuato. El tratamiento de la información por medio de entrevistas se apoya en la hermenéutica profunda. Los testimonios directos sobre identidades culturales suman 76 casos, que conforman seis por ciento de ...

Mature Turkey Breeder Hens Exposed to Pandemic Influenza H1N1: Resultant Effects on Morbidity, Mortality, and Fecundity.

Science.gov (United States)

Evans, Robert; Bommineni, Yugendar; Falk, Jonathan; Blackway, Adam; Young, Brent; Isenhart, Connie

2015-03-01

During the artificial insemination process, turkey breeder hens may become infected with influenza virus acquired from humans. The virus has been shown, through experimental infection, to localize in the reproductive tract, with limited dissemination in other tissues. A limited number of hens were used during these studies, and the overall flock morbidity, mortality, and fecundity were not able to be determined. The current case follows the progression of clinical signs in a flock of commercial breeder hens from onset of egg production losses in one house through the subsequent drops in four remaining houses. Each house contained approximately 3000 hens and followed a sequential loss of shell quality, reduced numbers of eggs, and fertility, while mild clinical signs were observed and mortality was slightly increased in a house with concurrent fowl cholera (Pasturella multocida) infection.

DE LA INNOVACIÓN DESEADA A LA INNOVACIÓN POSIBLE. ESCUELAS ALTERADAS POR LAS TIC

Directory of Open Access Journals (Sweden)

Mª Lourdes Montero

2010-01-01

Full Text Available Se presentan algunos resultados procedentes de dos proyectos de investigación financiados. Ambos tienen como finalidad analizar y valorar los factores implicados, las fortalezas y debilidades, que se generan a la hora de hacer frente a proyectos de innovación educativa cuando dicha innovación está centrada en favorecer nuevos entornos de enseñanza y aprendizaje mediados por Tecnologías de la Información y la Comunicación (TIC. El enfoque teórico y metodológico responde a una perspectiva de investigación-acción colaborativa y se articula como un estudio de casos, longitudinal, desarrollado con cuatro centros educativos de diferente tipología: Centro Público Integrado (CPI, Instituto de Educación Secundaria (IES, Centro Rural Agrupado (CRA y Centro de Educación Infantil y Primaria (CEIP. Los datos se analizaron utilizando las siguientes dimensiones: contexto socio-político y económico; profesorado e institución. Las mismas emergieron de la construcción de relaciones entre el marco teórico de la investigación y la información procedente de la realidad estudiada. Entre las conclusiones más relevantes están: 1-La escuela y el profesorado se encuentran en una situación dilemática entre su rol tradicional de conservación de los aspectos culturales más significativos y las presiones y demandas que emergen hacia la innovación procedentes de las condiciones de la nueva economía; 2-Las TIC están siendo utilizadas como instrumento político del discurso de la innovación y, al mismo tiempo, están posibilitando mantener fijas tanto la cultura del centro educativo, como los contenidos y las metodologías docentes; 3- el escaso cambio de la cultura de los centros influye en el mantenimiento del status quo, y constriñe el valor de las TIC para la movilización de las condiciones de la enseñanza y el aprendizaje; 4- en los centros educativos, se evidencia un clima de agobio por la falta de tiempo del profesorado para pensar

Susceptibilidad de Biomphalaria tenagophila de las cuencas de los ríos Paraná y Uruguay a Schistosoma mansoni

Directory of Open Access Journals (Sweden)

C. Edgardo Borda

1997-03-01

Full Text Available Con el fin de estudiar la posibilidad de extensión de la esquistosomiasis a las cuencas de los ríos Paraná y Uruguay se expusieron experimentalmente a infección por Schistosoma mansoni 1 711 caracoles criados en laboratorio a partir de ejemplares de Biomphalaria tenagophila recolectados en 15 poblaciones de dicha zona geográfica. Se utilizaron tres cepas de S. mansoni: la BH2, adaptada a B. glabrata, y las cepas SJ y SJ2, adaptadas a B. tenagophila. No se produjo infección de ninguno de los 543 caracoles expuestos a la cepa BH2 ni de los 668 expuestos a la SJ. En cambio, de los 500 expuestos a la cepa SJ2, fueron susceptibles a la infestación 4 de 163 caracoles (2% procedentes de Ayolas, una localidad de la cuenca del Paraná, y 8 de 45 (18% de los procedentes de Fuente Salto, en la cuenca del Uruguay. Estos hallazgos son similares a los de otras áreas geográficas en las que se han encontrado poblaciones de B. tenagophila que no se infectan y otras que sí son susceptibles a S. mansoni. Los resultados de este trabajo señalan la posibilidad de expansión de la esquistosomiasis a una amplia región de Sudamérica en la que se halla B. tenagophila.

Desarrollo de una hoja excel para metaanálisis de comparaciones indirectas y mixtas

Directory of Open Access Journals (Sweden)

Aurelio Tobías

2014-01-01

Full Text Available En investigación clínica, el meta análisis ha servido generalmente para evaluar la eficacia y la seguridad de un tratamiento a través de la comparación con un único comparador. Las comparaciones indirectas, a través del método de Bucher, permiten combinar datos procedentes de estudios primarios de una forma sencilla cuando la información para las comparaciones directas es limitada o inexistente. Las comparaciones mixtas permiten combinar las estimaciones procedentes de comparaciones directas e indirectas, aumentando el poder estadístico. En la actualidad, es necesario el desarrollo de aplicaciones informáticas para el cálculo de meta análisis de comparaciones indirectas y mixtas. Por este motivo, se ha desarrollado una hoja de cálculo con Microsoft Office Excel para el cálculo de comparaciones indirectas y mixtas, de uso sencillo para investigadores clínicos interesados en revisiones sistemáticas con meta análisis, pero no familiarizados con el uso de paquetes estadísticos más avanzados. La utilización de esta hoja de cálculo para las comparaciones indirectas y mixtas puede ser de gran utilidad en epidemiología clínica, con el fin de extender el conocimiento proporcionado por el metaanálisis tradicional cuando la evidencia de las comparaciones directas es limitada o inexistente.

Pharmacokinetics of Enrofloxacin and Danofloxacin in Plasma, Inflammatory Exudate, and Bronchial Secretions of Calves following Subcutaneous Administration

Science.gov (United States)

McKellar, Quintin; Gibson, Ian; Monteiro, Ana; Bregante, Miguel

1999-01-01

concentration-time curve/MIC ratios in plasma) for Pasteurella multocida (MIC of enrofloxacin, 0.06 μg/ml [24]; MIC of danofloxacin, 0.06 μg/ml [6]), enrofloxacin produced scores of 8.17 and 52.00, respectively, compared to those of danofloxacin, which were 4.02 and 23.05, respectively. With the dosing rates recommended in some markets by manufacturers, enrofloxacin and danofloxacin achieved concentrations above the MICs for important pathogenic organisms in plasma, tissue cage exudate, and bronchial secretion. Since fluoroquinolones display concentration-dependent activities, Cmax/MIC ratios may be critical to efficacy. In the United States enrofloxacin is currently the only fluoroquinolone licensed for food animals and dosages for acute respiratory disease are 2.5 to 5 mg/kg for 3 days or 7.5 to 12.5 mg/kg once. The higher dosages on a single occasion are likely to confer Cmax/MIC ratios that are associated with greater clinical efficacy. PMID:10428924

Clinical, epidemiological and mycological report on 65 patients from the Eastern Amazon region with chromoblastomycosis Relato clínico, epidemiológico e micológico de 65 pacientes com cromoblastomicose procedentes da Amazônia oriental

Directory of Open Access Journals (Sweden)

Carla Andréa Avelar Pires

2012-08-01

cromoblastomicose é uma infecção fúngica crônica, causada por fungos da família Dematiaceae, sendo Fonsecaea pedrosoi a mais comum, segundo vários estudos. É mais frequente em países tropicais e o estado do Pará possui grande casuística mundial. A doença é de difícil tratamento e apresenta recorrência frequente. OBJETIVOS: Descrever os aspectos epidemiológicos, micológicos e formas clínicas dos casos de cromoblastomicose procedentes do estado do Pará - Brasil. MÉTODOS: Foram realizados exames micológicos (direto, cultura e microcultivo e observação clinicoepidemiológica em 65 pacientes do Serviço de Dermatologia da Universidade Federal do Pará, atendidos no período de 2000 a 2007. Empregou-se a classificação clínica proposta por Carrión em 1950. RESULTADOS: Os pacientes eram, em sua maioria, homens (93,8%, lavradores (89,2%, faixa etária entre 45-55 anos, com predominância de lesões verruciformes (55,4%, localizadas principalmente nos membros inferiores (81,5%. A maioria dos casos pesquisados (61,5% apresentou um longo tempo de doença, com uma média de 11 anos. O exame micológico direto foi realizado em 86,2% (n=56 dos pacientes; destes, 96,4% (n=54 apresentaram resultado positivo. Foram realizados cultura e microcultivo in vitro de 47 pacientes com exame micológico positivo e os resultados mostraram o Fonsecaea pedrosoi como único agente etiológico identificado nesta amostra. CONCLUSÃO: Este estudo mostrou o quanto a cromoblastomicose ainda compromete a qualidade de vida da população local, principalmente a de indivíduos que trabalham em lavouras, cursando com evolução crônica e sem tratamento eficaz. Observa-se a importância de dar continuidade a este estudo, o que poderá proporcionar novas contribuições clínicas ou epidemiológicas.

Nuevos restos humanos procedentes de la Cueva de la Zarzamora (Segovia, España

Directory of Open Access Journals (Sweden)

SALA, N., ALGABA, M., GÓMEZ-OLIVENCIA, A., PABLOS, A., BONMATÍ, A., RODRÍGUEZ, L., GARCÍA, R. y ARSUAGA, J.L.

2013-01-01

Full Text Available Once restos humanos, dos dientes y nueve fragmentos del esqueleto postcraneal pertenecientes al tronco, pelvis y pie, han sido recuperados en la cueva de la Zarzamora, situada en el límite meridional de la meseta Castellana (Segovia, España. Los resultados obtenidos del estudio métrico y morfológico permiten inferir que podrían corresponder a un solo individuo con una edad de muerte en torno a los diez años. Los huesos humanos se encontraban englobados en un relleno sedimentario del Pleistoceno superior interpretado como cubil de hienas. No obstante, una datación directa ha proporcionado una fecha de 4.749±34 años BP correspondiente a una fase temprana del Calcolítico. Estos hallazgos son de gran relevancia, teniendo en cuenta la escasez de restos humanos de esta época en esta región de la Península Ibérica.

«Ancient armour and arms recently received from Spain» Eusebio Zuloaga, Henry Lepage, and the Real Armería in Madrid

Directory of Open Access Journals (Sweden)

Pyhrr, Stuart W.

1999-12-01

Full Text Available In 1835 an important group of arms, some of them from Real Armeria, was sent by Eusebio Zuloaga to the gunmaker Henri Lepage in Paris. This paper documents the transaction and seeks to identify the present location of some items.

En 1835 un importante conjunto de armas, algunas procedentes de la Real Armeria, fue enviado por Eusebio Zuloaga a1 arcabucero Henri Lepage de París. Este artículo documenta dicho envió y pretende señalar el paradero actual de alguno de los objetos

Religión e integración: Creencias y prácticas de los inmigrantes

OpenAIRE

Odgers Ortiz, Olga

2013-01-01

Las creencias y prácticas religiosas pueden constituir un importante recurso en el proceso de integración de los migrantes, sin embargo, la forma y la dirección en que dichos recursos son empleados, puede variar significativamente, incluso entre grupos de inmigrantes procedentes de un mismo país de origen, establecidos en una misma región, y que profesaban la misma religión al iniciar la migración. A partir de la experiencia de tres grupos de inmigrantes mexicanos establecidos en la región me...

Novedades en alimentación complementaria Novelties in complementary feeding

OpenAIRE

J.M. Marugán de Miguelsanz

2010-01-01

La alimentación complementaria o beikost, son los términos clásicamente utilizados para referirnos a todos los alimentos, que no sean la leche humana ni la procedente de fórmula adaptada, utilizados en la alimentación del lactante, y esenciales.
Desde el establecimiento de las recomendaciones históricas sobre alimentación complementaria realizadas por la Academia Americana de Pediatría (AAP) y seguidamente por la Sociedad Europea de Gastroenterología, Hepatología y Nutrición Pediá...

Influencia del estatus de cobre sobre la acumulación de metales tóxicos y esenciales en ganado vacuno

OpenAIRE

I Blanco Penedo; JM Cruz; M López-Alonso; M Miranda; C Castillo; J Hernández; JL Benedito

2005-01-01

La interacción entre elementos tóxicos y esenciales, así como de elementos esenciales entre sí, condiciona tanto la acumulación de estos elementos en el organismo como sus efectos nocivos. En este estudio se evaluaron las correlaciones entre los niveles de cobre y los elementos tóxicos (cadmio, plomo) y esenciales (molibdeno, hierro, selenio, zinc, manganeso y cobalto) en dos tejidos (hígado y riñón) de 195 terneros procedentes de la comarca del Deza (NO de España), una z...

Coliphages as fecal pollution and removal bacterial indicators in the drinking water process

OpenAIRE

Paz-y-Miño, Marco; Barzola, Carmen; Lazcano, César; Ponce, Milagros; León, Jorge

2003-01-01

El presente trabajo analiza la eficacia del tratamiento de agua procedentes del río Rímac. Se comparan muestras de agua no tratadas con las fases sucesivas del tratamiento: decantación, filtración y clorinación. La cuantificación de colifagos fue realizada por los métodos de Capa Simple y Filtro de Membrana. Los Coliformes Totales (CT), Coliformes Termotolerantes (CTT) y Bacterias Heterótrofas (BH) fueron determinados por los métodos del Número Más Probable (NMP) y Filtro de Membrana. La cepa...

Estudio de polimorfismos genéticos implicados en el metabolismo de hormonas sexuales y su asociación con Abortos Espontáneos de causa desconocida.

OpenAIRE

Pérez Nevot, Beatriz

2016-01-01

En este trabajo nos hemos centrado en el estudio de 8 polimorfismos relacionados con el metabolismo de las hormonas sexuales en el feto y su relación con los abortos espontáneos de causa desconocida, bajo la hipótesis de que un desequilibrio en la producción de hormonas sexuales en el feto está implicado en la interrupción de la gestación. Para ello se seleccionaron muestras de tejido fetal procedentes de abortos espontáneos de causa desconocida y se estudiaron varios polimorfismos de dos enz...

LAS NEURONAS DEL SEPTUM LATERAL MODIFICAN LA ACTIVIDAD DE LAS NEURONAS DEL NUCLEO TUBEROMAMILAR DEL HIPOTALAMO

OpenAIRE

FARIAS RODRIGUEZ, PAULA ANDREA; FARIAS RODRIGUEZ, PAULA ANDREA

2012-01-01

El septum lateral (SL), es un núcleo del cerebro anterior, que, procesa la información sensorial afectiva procedente del hipocampo y dirige sus respuestas, importantes para la supervivencia, hacia las zonas del hipotálamo importantes para la motivación, como lo es el núcleo tuberomamilar del hipotálamo (TMN). El TMN contiene las neuronas histaminérgicas en el cerebro, la cual relacionamos con la vigilia y alerta en conductas motivadas y así puede dirigir y reforzar el comportamiento. El TM...

Efectos de rizosfera, microorganismos y fertilización en la biorremediación y fitorremediación de suelos con petróleos crudo nuevo e intemperizado

OpenAIRE

Maldonado-Chávez, E; Rivera-Cruz, MC; Izquierdo-Reyes, F; Palma-López, DJ

2010-01-01

Se evaluó el potencial de un consorcio microbiano constituido por bacterias (Pseudomonas sp y Serratia marcescens y hongos (Aspergillus sp y Trichoderma sp) y de fertilizante inorgánico incorporados al suelo en la biorremediación, y el potencial del pasto egipto (Brachiaria mutica) y de la leguminosa guaje (Leucaena leucocephala) en la fitorremediación de un suelo contaminado con petróleos nuevo (PN) recién incorporado al suelo y el intemperizado (PI) procedente de derrames crónicos de petról...

Degradación de alcanos mediante Alcanivorax venutensis inmovilizada en hidrogeles adhesivos y biodegradables

OpenAIRE

Largo Pereda, Eneko

2014-01-01

188 p. El petróleo y sus derivados son los mayores contaminantes del medio marino. Además puntualmente se producen grandes vertidos accidentales como el que en Noviembre de 2002 produjo un desastre ecológico sin precedentes en la costa norte de la Península Ibérica. En este trabajo se ha desarrollado y se ha ensayado a escala de laboratorio un producto de biorremediación para zonas rocosas contaminadas con restos de hidrocarburos procedentes de vertidos. Se ha utilizado para el producto un...

Aplicación del proceso Fenton en el tratamiento de aguas residuales de origen petroquímico

OpenAIRE

Rubio-Clemente, Ainhoa; Chica, Edwin L.; Peñuela, Gustavo A.

2014-01-01

Este artículo hace una revisión sobre las aplicaciones del proceso Fenton para el tratamiento de aguas residuales procedentes de la industria petroquímica. En él se describe brevemente el mecanismo de reacción y se analizan las principales variables que influyen en la eficiencia de este proceso (concentración del agente oxidante y del catalizador, temperatura, pH, tiempo de reacción, tipo de contaminante y presencia de aniones). Asimismo, se detallan diversos estudios que evalúan la viabilida...

Representaciones sociales de universitarios sobre la abstinencia sexual y los condones como mecanismos de prevención

OpenAIRE

Estupiñán-Aponte, Maria Rosa; Amaya-Estupiñán, Laura; Rojas-Jiménez, Yuri A.

2013-01-01

Objetivo Interpretar las representaciones sociales de estudiantes de la Universi­dad Pedagógica y Tecnológica de Colombia, Seccional Sogamoso, frente al uso de la abstinencia sexual y el condón, como referentes estratégicos en la preven­ción de enfermedades de transmisión sexual y embarazo no deseado. Método Mediante muestreo intencional, participaron 67 estudiantes universitarios, entre los 16 y 31 años de edad, procedentes de diferentes regiones del departa­mento de Boyacá. Para la recolecc...

Hidatidosis periapendicular en un adulto mayor: reporte de un caso

OpenAIRE

Velásquez-Roque, Mario; Muñoz del Carpio Toia, Agueda; Velásquez-Ortega, Luis; Velásquez Lazo, César

2016-01-01

La hidatidosis es una zoonosis causada por los Echinococcus granulosus y Echinococcus multilocularis de forma más frecuente. La localización primaria peri apendicular es sumamente rara. Se presenta el caso de una paciente de 63 años. Procedente de zona alto andina del Cusco. Destaca la crianza de ganado vacuno, ovino y canes. Presentó síntomas de enfermedad por un lapso de 10 años aproximadamente. La sintomatología predominante era dolor abdominal en hemi-abdomen derecho. Al examen médico se ...

Efecto de la cerveza frente al estrés oxidativo inducido por la adriamicina.

OpenAIRE

Torres Rodríguez, Mª Carmen

2007-01-01

RESUMEN La cerveza es una bebida alcohólica de baja graduación resultante de fermentar mediante levadura seleccionada el mosto procedente de malta de cebada, sólo o mezclado con otros productos amiláceos transformables en azúcares por digestión enzimática, cocción y aromatizado con flores de lúpulo. Los constituyentes de la cerveza provienen de sus cuatro principales materias primas, malta, lùpulo, agua y levadura. El principal componente de la cerveza es el agua, que se acompaña de otros ...

Fractura y mecanismos de deformación de un polipropileno reforzado con cenizas y modificado con un copolímero de bloque

OpenAIRE

García Pardo, Santiago

2013-01-01

[Resumo] Nesta memoria, preséntase os resultados do estudio da fractura e deformación de compostos de polipropileno (PP), un copolímero olefínico en bloque (OBC) e cinzas, procedentes da queima de biomasa forestal, modificadas cun axente de acoplamento silano e procesadas por técnicas de extrusión. Caracterizáronse as propiedades mecánicas dos novos materiais mediante a súa resistencia á tracción, ó impacto e a morfoloxía asociada obtida por microscopia electrónica de varrido (SEM). As ...

Diagnóstico y tratamiento de la esquistosomiasis vesical desde la atención primaria penitenciaria: a propósito de un caso Diagnosis and treatment of bladder schistosomiasis from penitentiary primary care: case report

OpenAIRE

A. Bedoya del Campillo; P. A. Martínez-Carpio; M. J. Leal; N. Lleopart

2012-01-01

Se describe un caso clínico de un paciente procedente de Senegal con síndrome miccional y hematuria microscópica que fue diagnosticado y tratado de esquistosomiasis vesical en los servicios médicos del Centro Penitenciario de Jóvenes de Barcelona. Según nuestra información en la base de datos Medline no existen casos de esquistosomiasis vesical abordados en atención primaria fuera de áreas endémicas. Los pacientes pueden diagnosticarse y tratarse antes de ser derivados a la asistencia especia...

Hematuria intermitente: Esquistosomiasis vesical. A propósito de un caso Intermittent hematuria: Vesical schistosomosis. Concerning one case

OpenAIRE

D. Morales; J. Molina; A. Martínez Ortiz; V. Martínez Artola; X. Beristáin

2009-01-01

Presentamos un caso clínico de un paciente con esquistosomiasis vesical que consideramos inusual en nuestro entorno. El cuadro clínico de esta parasitosis es habitualmente el de una hematuria intermitente de semanas de evolución que no se resuelve con las medidas terapéuticas habituales. Debido al aumento de población inmigrante procedente de áreas endémicas, debemos pensar cada vez más en esta patología emergente. Con el tratamiento el proceso se resuelve satisfactoriamente, pudiéndose evita...

Eficacia de una crema dental para dientes sensibles con citrato de potasio al 5,6% y fluoruro de sodio al 0,3%: ensayo clínico aleatorizado controlado

OpenAIRE

Ramón Morales, Oscar Miguel; Londoño, Walter; González Ortíz, Leydi Yisela; González Patiño, Elizabeth; Blandón, Nadya; García González, Nora Patricia

2010-01-01

Introducción: las sales de potasio y el flúor han sido usadas en el tratamiento de la hipersensibilidad dentinaria. El objetivo de este estudio fue determinar la eficacia de una crema dental para dientes sensibles con citrato de potasio al 5,6% y fluoruro de sodio al 0,3%, en la disminución de los síntomas de hipersensibilidad dentinaria. Métodos: se obtuvo una muestra aleatoria de 100 personas, hombres y mujeres, mayores de 18 años procedentes del Valle de Aburrá; que presentaran hipersen...

Estudio de la recuperación de cromo hexavalente mediante un reactor electroquímico de compartimentos separados por separadores cerámicos

OpenAIRE

REYES PINEDA, HENRY

2011-01-01

La Tesis Doctoral "Estudio de la recuperación de cromo hexavalente mediante un reactor electroquímico de compartimentos separados por separadores cerámicos" se centra en la posibilidad de recuperación del cromo hexavalente procedente de las disoluciones de mordentado de las industrias de metalizado de plásticos mediante la utilización de un reactor electroquímico de compartimentos separados por separadores cerámicos fabricados a diferente presión y diferente composición de almidón. Con la rec...

Histology of Maca, Lepidium meyenii Walpers (Brassicaceae)

OpenAIRE

Marín-Bravo, Manuel

2003-01-01

Se presenta el estudio histológico de Lepidium meyenii Walpers "maca", enfocado principalmente en la caracterización del órgano reservante. El estudio se realizó en macas de color amarillo, procedentes de Junín, y comprendió la caracterización histológica del órgano reservante subterráneo y detalles adicionales de la estructura interna foliar, a partir de muestras fijadas en FAA y empleando la técnica de inclusión en parafina. Los resultados muestran en el órgano reservante las característica...

Formulación de un yogur funcional de zanahoria

OpenAIRE

Benítez Santillán, Lourdes del Rocío

2011-01-01

El objetivo de este trabajo fue formular yogures con un alto contenido en fibra procedente de zanahoria. Para lo cual se utilizaron diferentes tipos de leches (entera, desnatada y sin lactosa) y endulzantes (sacarosa y jarabe de fructosa), incorporándoles zanahoria en diferentes porcentajes (15 y 25 %) y omega 3 mediante la adición de nueces. Se evaluó la incidencia del porcentaje de adición de fibra y del tipo de azúcar sobre las características fisicoquímicas, microbiológicas y sensoriales ...

Análisis de procesos cognitivos en la escritura de alumnos sordos y oyentes de España e Italia

OpenAIRE

Rafaela GUTIÉRREZ CÁCERES; Antonio LUQUE DE LA ROSA

2014-01-01

En este artículo se muestran algunos resultados principales de una investigación centrada en el análisis de los procesos cognitivos y metacognitivos implicados en la composición escrita por parte del alumnado sordo y oyente procedente de dos contextos escolares (España e Italia). Los sujetos participantes en la investigación fueron 84 alumnos: 72 oyentes y 12 sordos; 44 del contexto español y 40 del italiano. El proceso de recogida de datos ha consistido en la aplicación de un cuestionario ad...

La immigración desde el Magreb. Un reto para la Unión Europea

Directory of Open Access Journals (Sweden)

Gloria Inés Ospina

2015-10-01

Full Text Available Para la Unión Europea, los flujos de emigración irregular procedentes del Mediterráneo han sido una de las piedras donde han tropezado toda la serie de directivas que respecto al tema migratorio y el espacio Schengen se han emitido desde Bruselas a lo largo de los últimos 13 años. El artículo analiza el crecimiento de los flujos migratorios dirigidos hacia la UE tras las revoluciones árabes, las debilidades del acuerdo Schengen y las medidas reactivas adoptadas por la UE, proponiendo algunas recomendaciones.

EDUCACIÓN SANITARIA SOBRE LACTANCIA MATERNA EN MADRES ADOLESCENTES PARA LA PREVENCIÓN DE DIARREAS AGUDAS EN LACTANTES DEL HOSPITAL HERMILIO VALDIZÁN – HUÁNUCO 2015

OpenAIRE

Palacios Zevallos, Julia Marina

2016-01-01

OBJETIVO. Determinar el efecto de la educación sanitaria sobre lactancia materna en madres adolescentes para la prevención de diarreas agudas. MÉTODOS. Se llevó a cabo un estudio cuasi-experimental con pre y post test para 24 lactantes que conformaron el grupo experimental y 24 lactantes el grupo control, procedentes del hospital Regional Hermilio Valdizán, Huánuco 2015. Se utilizó un cuestionario de conocimiento, una guía de observación y una ficha de registros. Para el aná...

Simulación del impacto medioambiental en relación a la nueva directiva de transportes

OpenAIRE

Pavón Buenache, Miriam

2015-01-01

La contaminación es la existencia en el entorno de cualquier sustancia que al introducirse o interactuar en la atmósfera, en el medio acuático, en el medio terrestre, flora, fauna u otro medio natural, modifique o transforme su composición y forma natural, causando inestabilidad ecológica. El deshielo de los glaciales, el aumento de la temperatura media, las inundaciones o el incremento de sequías son unos de los principales efectos atribuidos a este hecho, procedente principalmente de las em...

Fotocatálisis heterogénea de colorantes azoicos hidrolizados y efluentes textiles simulados sobre nanopartículas inmovilizadas de TIO2

OpenAIRE

Díez Martín, Laura

2012-01-01

En nuestra sociedad, muchos procesos industriales generan efluentes contaminados que deben ser tratados debido a sus efectos sobre la salud y el medio ambiente. En el caso de las aguas residuales procedentes de la industria textil, las tecnologías físicas y químicas convencionales resultan insuficientes para lograr la degradación total de las sustancias contaminadas que contienen. Por esta razón, la búsqueda de tratamientos alternativos es necesaria. La fotocatálisis heterogénea es una técnic...

Tratamiento y gestión de baños ácidos de decapado

OpenAIRE

Domínguez Hernández, Elena

2012-01-01

El objetivo del presente proyecto es describir y dimensionar una planta de tratamiento físico-químico de residuos ácidos procedentes de baños agotados de decapado. El decapado es un procedimiento industrial para eliminar la capa superficial de óxidos de hierro, la calamina (carbonato de zinc natural) y partículas metálicas de la superficie del metal base Departamento de Ingeniería Química y Tecnología del Medio Ambiente Ingeniero Técnico Industrial, Especialidad en Química I...