WorldWideScience

Sample records for pasteurella multocida procedentes

  1. Pasteurella multocida mastitis in cow - case report

    OpenAIRE

    Milanov Dubravka; Aleksić Nevenka; Todorović Dalibor; Bugarski Dejan

    2017-01-01

    Pasteurella (P.) multocida is a heterogeneous species of Gram-negative bacteria which are common commensals of the upper respiratory system of various mammal and bird species, but are also opportunistic contagious zoonotic pathogens which cause a wide spectre of infections in domestic animals and humans. P. multocida is a rare cause of mastitis in dairy cows. The source of infection mainly remains unknown, mastitis usually is acute, and the therapy by intramammary administration of antibiotic...

  2. Pasteurella multocida mastitis in cow: Case report

    OpenAIRE

    Milanov, Dubravka; Aleksić, Nevenka; Todorović, Dalibor; Bugarski, Dejan

    2017-01-01

    Pasteurella (P.) multocida is a heterogeneous species of Gram-negative bacteria which are common commensals of the upper respiratory system of various mammal and bird species, but are also opportunistic contagious zoonotic pathogens which cause a wide spectre of infections in domestic animals and humans. P. multocida is a rare cause of mastitis in dairy cows. The source of infection mainly remains unknown, mastitis usually is acute, and the therapy by intramammary administration of antibiotic...

  3. Pasteurella multocida Osteomyelitis: An Unusual Case Presentation

    Directory of Open Access Journals (Sweden)

    Herbert P von Schroeder

    1996-01-01

    Full Text Available A healthy male farm employee developed an unusual infection caused by Pasteurella multocida. Atypical features included the chronic nature of the infection, the development of osteomyelitis of the tibia without direct animal inoculation, and lack of fever and leukocytosis. Radiographic appearance of P multocida osteomyelitis may be the result of osteoclast activation and can be confused with musculoskeletal tumour. P multocida infection requires a high degree of suspicion, and should be considered in cases of farm- or animal-related injuries even if there is no history of direct animal contact.

  4. Pasteurella multocida mastitis in cow - case report

    Directory of Open Access Journals (Sweden)

    Milanov Dubravka

    2017-01-01

    Full Text Available Pasteurella (P. multocida is a heterogeneous species of Gram-negative bacteria which are common commensals of the upper respiratory system of various mammal and bird species, but are also opportunistic contagious zoonotic pathogens which cause a wide spectre of infections in domestic animals and humans. P. multocida is a rare cause of mastitis in dairy cows. The source of infection mainly remains unknown, mastitis usually is acute, and the therapy by intramammary administration of antibiotics does not lead to satisfactory results. Lethality is possible due to presence of endotoxins in blood. Literature data on P. multocida mastitis in dairy cows is particularly scarce, which is why such a case is described in the current work, with past medical history, clinical findings, laboratory diagnostics and therapeutic approach. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. TR 31071 and Grant no. III 46002

  5. Isolation of Pasteurella multocida from broiler chickens

    Directory of Open Access Journals (Sweden)

    Sri Poernomo

    1996-06-01

    Full Text Available Pasteurella multocida, the etiological agent of fowl cholera, was isolated from five, 32 days oldbroilerchickens in the late of 1992. The chickens were from a farm located in Bogor area, raised in cages and each flock consisted of 1,550 broilers . Therewere 230 birds, aging from 28-31 days old, died with clinical signs of lameness and difficulty in breathing. Serological test of the isolate revealed serotype Aof Carter classification . To prove its virulences, the isolate was then inoculated into 3 mice subcutaneously. The mice died less then 24 hours postinoculation and P. multocida can be reisolated . The sensitivity test to antibiotics and sulfa preparations showed that the isolate was sensitive to ampicillin, doxycyclin, erythromycin, gentamycin, sulfamethoxazol-trimethoprim and baytril, but resistance to tetracyclin, kanamycin and oxytetracyclin. This is the first report of P. multocida isolation in broiler chickens in Indonesia, and it is intended to add information on bacterial diseases in poultry in Indonesia.

  6. Pasteurella multocida Bacteremia in an Immunocompromised Patient.

    Science.gov (United States)

    Kukrety, Shweta; Parekh, Jai; Townley, Theresa

    2016-01-01

    We present the case of a 61-year-old Caucasian gentleman who presented with a one-day history of fever, chills, and altered mental status. His symptoms were initially thought to be secondary to cellulitis. Blood cultures grew Pasteurella multocida , a rare pathogen to cause bacteremia. Our patient was treated with ciprofloxacin for two weeks and made a complete and uneventful recovery. Our patient's uncontrolled diabetes mellitus and chronic kidney disease put him at a higher risk for developing serious P. multocida infection. The patient's dog licking the wounds on his legs was considered as the possible source of infection. As P. multicoda bacteremia is rare, but severe with a high mortality rate, it is imperative to have a high index of suspicion for this infection especially in the vulnerable immunocompromised population.

  7. Pasteurella multocida Bacteremia in an Immunocompromised Patient

    Directory of Open Access Journals (Sweden)

    Shweta Kukrety

    2016-01-01

    Full Text Available We present the case of a 61-year-old Caucasian gentleman who presented with a one-day history of fever, chills, and altered mental status. His symptoms were initially thought to be secondary to cellulitis. Blood cultures grew Pasteurella multocida, a rare pathogen to cause bacteremia. Our patient was treated with ciprofloxacin for two weeks and made a complete and uneventful recovery. Our patient’s uncontrolled diabetes mellitus and chronic kidney disease put him at a higher risk for developing serious P. multocida infection. The patient’s dog licking the wounds on his legs was considered as the possible source of infection. As P. multicoda bacteremia is rare, but severe with a high mortality rate, it is imperative to have a high index of suspicion for this infection especially in the vulnerable immunocompromised population.

  8. Draft genome sequences of two virulent serotypes of avian Pasteurella multocida

    Science.gov (United States)

    Here we report the draft genome sequences of two virulent avian strains of Pasteurella multocida. Comparative analyses of these genomes were done with the published genome sequence of avirulent Pasteurella multocida strain Pm70....

  9. [Molecular typing methods for Pasteurella multocida-A review].

    Science.gov (United States)

    Peng, Zhong; Liang, Wan; Wu, Bin

    2016-10-04

    Pasteurella multocida is an important gram-negative pathogenic bacterium that could infect wide ranges of animals. Humans could also be infected by P. multocida via animal bite or scratching. Current typing methods for P. multocida include serological typing methods and molecular typing methods. Of them, serological typing methods are based on immunological assays, which are too complicated for clinical bacteriological studies. However, the molecular methods including multiple PCRs and multilocus sequence typing (MLST) methods are more suitable for bacteriological studies of P. multocida in clinic, with their simple operation, high efficiency and accurate detection compared to the traditional serological typing methods, they are therefore widely used. In the current review, we briefly describe the molecular typing methods for P. multocida. Our aim is to provide a knowledge-foundation for clinical bacteriological investigation especially the molecular investigation for P. multocida.

  10. In vitro susceptibility of Pasteurella multocida subspecies multocida strains isolated from swine to 42 antimicrobial agents.

    Science.gov (United States)

    Gutiérrez Martin, C B; Rodríguez Ferri, E F

    1993-08-01

    The minimal inhibitory concentrations (MICs) of 42 antimicrobial agents were determined against 59 strains of Pasteurella multocida subspecies multocida, all isolated from swine lungs with lesions indicative of pneumonia. Penicillins (except cloxacillin), aminoglycosides, tetracyclines, erythromycin, josamycin, thiamphenicol, colistin, rifampin and mupirocin showed good activities, with ranging resistance between 0 and 6.8%. Higher resistance was observed for spiramycin and fosfomycin. Tylosin, vancomycin, metronidazole, dapsone and tiamulin, to which strains showed high rates of resistance, were ineffective. Cephalosporins (especially the third-generation cephalosporins) and quinolones (especially the fluorinated quinolones) were the most effective antimicrobial agents against P. multocida subsp. multocida strains and they might be of value for in vivo use.

  11. 9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...

  12. Isolation of Pasteurella multocida subspec. Multocida from chronic periapical lesion: First isolation in ex-Yugoslavia

    Directory of Open Access Journals (Sweden)

    Suvajdžić Ljiljana Ð.

    2006-01-01

    Full Text Available This study presents five isolates of Pasteurella multocida subsp. multo-cida isolated from chronic periapical inflammatory lesion. We described the methods of sampling and cultivation as well as diagnostic criteria. Pasteurella multocida was diagnosed on the basis of characteristic cultural and tinctorial properties and the facts that all strains produced indole and induced ornithine decarboxilation, glucose, saccharose and manitole fermentation. Isolates produced neither urease, nor fermented lactose and maltose. Further classification to subspecies multocida was based on the fact that all investigated isolates fermented trechalose, xylose and sorbitol the traits which are diagnostically significant for the species. Patients deny any contact with farm animals or pets, which indicates a possible aerosol transport and animal-human as well as human-human infection. We consider that this organism should be paid more attention by dentist, oral surgeons and microbiologists.

  13. Draft Genome Sequences of Two Virulent Serotypes of Avian Pasteurella multocida

    OpenAIRE

    Abrahante, Juan E.; Johnson, Timothy J.; Hunter, Samuel S.; Maheswaran, Samuel K.; Hauglund, Melissa J.; Bayles, Darrell O.; Tatum, Fred M.; Briggs, Robert E.

    2013-01-01

    Here we report the draft genome sequences of two virulent avian strains of Pasteurella multocida. Comparative analyses of these genomes were done with the published genome sequence of avirulent P.?multocida strain Pm70.

  14. Draft Genome Sequences of Two Virulent Serotypes of Avian Pasteurella multocida

    Science.gov (United States)

    Abrahante, Juan E.; Johnson, Timothy J.; Hunter, Samuel S.; Maheswaran, Samuel K.; Hauglund, Melissa J.; Bayles, Darrell O.; Tatum, Fred M.

    2013-01-01

    Here we report the draft genome sequences of two virulent avian strains of Pasteurella multocida. Comparative analyses of these genomes were done with the published genome sequence of avirulent P. multocida strain Pm70. PMID:23405337

  15. Pasteurella multocida Involved in Respiratory Disease of Wild Chimpanzees

    Science.gov (United States)

    Köndgen, Sophie; Leider, Michaela; Lankester, Felix; Bethe, Astrid; Lübke-Becker, Antina; Leendertz, Fabian H.; Ewers, Christa

    2011-01-01

    Pasteurella multocida can cause a variety of diseases in various species of mammals and birds throughout the world but nothing is known about its importance for wild great apes. In this study we isolated P. multocida from wild living, habituated chimpanzees from Taï National Park, Côte d'Ivoire. Isolates originated from two chimpanzees that died during a respiratory disease outbreak in 2004 as well as from one individual that developed chronic air-sacculitis following this outbreak. Four isolates were subjected to a full phenotypic and molecular characterisation. Two different clones were identified using pulsed field gel electrophoresis. Multi Locus Sequence Typing (MLST) enabled the identification of previous unknown alleles and two new sequence types, ST68 and ST69, were assigned. Phylogenetic analysis of the superoxide dismutase (sodA) gene and concatenated sequences from seven MLST-housekeeping genes showed close clustering within known P. multocida isolated from various hosts and geographic locations. Due to the clinical relevance of the strains described here, these results make an important contribution to our knowledge of pathogens involved in lethal disease outbreaks among endangered great apes. PMID:21931664

  16. Development of a typing system for epidemiological studies of porcine toxin-producing Pasteurella multocida ssp. multocida in Denmark

    DEFF Research Database (Denmark)

    Fussing, V.; Nielsen, Jens; Bisgaard, M.

    1999-01-01

    The aim of the present study was to evaluate capsular-typing, plasmid-profiling, phage-typing and ribotyping for epidemiological studies of toxin-producing Pasteurella multocida ssp. multocida in Denmark. The evaluation of methods was based on 68 strains from nasal swabs and 14 strains from...... by HindIII ribotyping, as 85% of isolates from all herds were assigned to one ribotype. In conclusion, HindIII ribotyping seems to represent a useful tool for epidemiological studies of toxigenic P. multocida ssp. multocida....

  17. Interaction between Ascaris suum and Pasteurella multocida in the lungs of mice

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Eriksen, Lizzie; Aalbaek, B

    1992-01-01

    In an experiment including 8 groups of 15 mice, the effect of migrating Ascaris suum larvae in the lungs on the establishment and pathogenicity of aerosol exposure to Pasteurella multocida was investigated. Following aerosol exposure to P. multocida, mice with migrating A. suum in their lungs...

  18. Pasteurella multocida urinary tract infection with molecular evidence of zoonotic transmission.

    Science.gov (United States)

    Liu, Wendy; Chemaly, Roy F; Tuohy, Marion J; LaSalvia, Margaret M; Procop, Gary W

    2003-02-15

    We describe a patient with a urinary tract infection (UTI) caused by Pasteurella multocida. Pulsed-field gel electrophoresis revealed that the clinical isolate recovered from the patient was identical (100% band match) to P. multocida isolates recovered from the patient's cat, but the isolate differed from an isolate recovered from a visiting cat and from a laboratory control strain. The patient also had abnormal urologic anatomy secondary to surgery; this has also been associated with P. multocida UTI.

  19. Host Response in Rabbits to Infection with Pasteurella multocida Serogroup F Strains Originating from Fowl Cholera

    Science.gov (United States)

    The ability of two avian Pasteurella multocida serogroup F strains to induce disease in rabbits was investigated in this study. Two groups of 18 Pasteurella-free rabbits each were intranasally challenged with strains isolated from chicken and turkey, respectively. Half the animals in each challenge ...

  20. Pasteurella multocida Septicemia in a Patient with Cirrhosis: An Autopsy Report

    Directory of Open Access Journals (Sweden)

    Takuma Yamamoto

    2015-01-01

    Full Text Available More people are keeping pets in their homes but may not be sufficiently aware of the potential danger from infections. We report an autopsy case of a 57-year-old man affected by cirrhosis. Septic shock with Pasteurella multocida pneumonia was the cause of his death. P. multocida was the source of infection via the respiratory tract and caused pneumonia. Cirrhosis is one of the risk factors for P. multocida infection. A detailed patient history about animal exposure should be obtained and a differential diagnosis of P. multocida infection must be kept in mind.

  1. Sepsis puerperalis caused by a genotypically proven cat-derived Pasteurella multocida strain.

    Science.gov (United States)

    Voss, A; van Zwam, Y H; Meis, J F; Melchers, W; Steegers, E A

    1998-01-01

    We report a disseminated intrauterine Pasteurella multocida infection in a puerperal woman who could not remember any traumatic exposure to her cat. An oral swab taken from the cat, just 2 days after the patient's admission, grew Pasteurella multocida, with an PCR-fingerprinting pattern identical to the patient's isolate. Hand-washing after every contact with cats and dogs and if feasible separation of in-house pets from mother and infant should be applied to prevent this uncommon but serious occurrence of post-partum infections. To our knowledge this is the first case of Pasteurella multocida 'child-bed fever', with a genotypically identical strain isolated from the in-house cat.

  2. Restriction endonuclease analysis of Pasteurella multocida isolates from three California turkey premises.

    Science.gov (United States)

    Christiansen, K H; Carpenter, T E; Snipes, K P; Hird, D W; Ghazikhanian, G Y

    1992-01-01

    Three California turkey premises that had repeated outbreaks of fowl cholera were studied for periods of 2 to 4 years. Using biochemical, serologic, plasmid DNA, and restriction endonuclease analyses of isolates of Pasteurella multocida from turkeys and wildlife on the premises, strains of the organism were found to be enzootic on two of the premises. On the third, a variety of strains of P. multocida were isolated from fowl cholera outbreak flocks.

  3. Utilization of L-aspartate, L-malate and fumarate by Pasteurella multocida

    Energy Technology Data Exchange (ETDEWEB)

    Hoefer, M.; Flossmann, K.D. (Akademie der Landwirtschaftswissenschaften der DDR, Jena. Inst. fuer Bakterielle Tierseuchenforschung)

    1981-01-01

    Strains of Pasteurella multocida use L-aspartate, L-malate and furmarate, respectively, as substrates for production of succinic acid which accumulates in the medium. As was established by studies with /sup 14/C- and /sup 3/H-labelled substrates, the degradation of these substances proceeds analogously via the citric acid cycle.

  4. Effect of aerial ammonia on porcine infection of the respiratory tract with toxigenic Pasteurella multocida

    DEFF Research Database (Denmark)

    Andreasen, Morten; Bækbo, P.; Nielsen, J.P.

    1999-01-01

    The objective of the experimental study was to examine whether aerial ammonia alone could predispose the respiratory system of pigs to infection with toxigenic Pasteurella multocida type A. Two groups of 5 pigs each were continuously exposed to 50 ppm ammonia and less than 5 ppm ammonia...

  5. Utilization of L-aspartate, L-malate and fumarate by Pasteurella multocida

    International Nuclear Information System (INIS)

    Hoefer, M.; Flossmann, K.D.

    1981-01-01

    Strains of Pasteurella multocida use L-aspartate, L-malate and furmarate, respectively, as substrates for production of succinic acid which accumulates in the medium. As was established by studies with 14 C- and 3 H-labelled substrates, the degradation of these substances proceeds analogously via the citric acid cycle. (author)

  6. Associations between water quality, Pasteurella multocida, and avian cholera at Sacramento National Wildlife Refuge

    Science.gov (United States)

    Lehr, M.A.; Botzler, R.G.; Samuel, M.D.; Shadduck, D.J.

    2005-01-01

    We studied patterns in avian cholera mortality, the presence of Pasteurella multocida in the water or sediment, and water chemistry characteristics in 10 wetlands at the Sacramento National Wildlife Refuge Complex (California, USA), an area of recurrent avian cholera epizootics, during the winters of 1997 and 1998. Avian cholera outbreaks (a?Y50 dead birds) occurred on two wetlands during the winter of 1997, but no P. multocida were recovered from 390 water and 390 sediment samples from any of the 10 wetlands. No mortality events were observed on study wetlands during the winter of 1998; however, P. multocida was recovered from water and sediment samples in six of the 10 study wetlands. The pH levels were higher for wetlands experiencing outbreaks during the winter of 1997 than for nonoutbreak wetlands, and aluminum concentrations were higher in wetlands from which P. multocida were recovered during the winter of 1998. Water chemistry parameters (calcium, magnesium, sodium, and dissolved protein) previously linked with P. multocida and avian cholera mortality were not associated with the occurrence of avian cholera outbreaks or the presence of P. multocida in our study wetlands. Overall, we found no evidence to support the hypothesis that wetland characteristics facilitate the presence of P. multocida and, thereby, allow some wetlands to serve as long-term sources (reservoirs) for P. multocida.

  7. Characterization of sucrose-negative Pasteurella multocida variants, including isolates from large-cat bite wounds

    DEFF Research Database (Denmark)

    Christensen, Henrik Grimmig; Bisgaard, Magne; Angen, Øystein

    2005-01-01

    To validate the identification of Pasteurella multocida-like bacteria negative for acid formation from sucrose, including isolates from bite wounds caused by large cats, 17 strains were phenotypically and genotypically characterized. Phylogenetic analysis of partially sequenced rpoB and infB genes...... showed the monophyly of the strains characterized and the reference strains of P. multocida. The sucrose-negative strains formed two groups, one related to reference strains of P. multocida and the other related to a separate species-like group (taxon 45 of Bisgaard). DNA-DNA hybridization further...... and the reference strains of P. multocida. Two strains isolated from leopard bite wounds were related to the type strain of P. dagmatis; however, they represented a new taxon (taxon 46 of Bisgaard), in accordance with their distinct phenotypic and genotypic identifications. The present study documents that sucrose-negative...

  8. Transmission of Pasteurella multocida on California turkey premises in 1988-89.

    Science.gov (United States)

    Christiansen, K H; Carpenter, T E; Snipes, K P; Hird, D W

    1992-01-01

    Restriction endonuclease analysis (REA) of whole-cell DNA was used to determine possible sources of Pasteurella multocida for each outbreak of fowl cholera occurring in turkey flocks in eight commercial poultry companies in California from October 1988 to September 1989. Over this period, 179 isolates of P. multocida were obtained from dead turkeys in 80 meat and breeder flocks on 43 premises. P. multocida was isolated from wildlife on five premises. Isolates were characterized by subspecies, serotype, presence of plasmid DNA, and REA type. In 52 (65%) flocks, all isolates of P. multocida had the same REA pattern as the M9 live vaccine strain following digestion of DNA with the restriction enzyme SmaI. Field strains of P. multocida were obtained from 27 (34%) flocks, and one flock (1%) yielded both M9 and a field strain of the organism. REA of field strains of P. multocida revealed 17 different SmaI REA types. Based on matching SmaI REA types, potential sources of P. multocida were identified for 15 of the 28 flocks infected with field strains of the organism, and transmission between turkey premises was a possibility in only seven flocks.

  9. The Capsule Is a Virulence Determinant in the Pathogenesis of Pasteurella multocida M1404 (B:2)

    OpenAIRE

    Boyce, John D.; Adler, Ben

    2000-01-01

    Capsules from a range of pathogenic bacteria are key virulence determinants, and the capsule has been implicated in virulence in Pasteurella multocida. We have previously identified and determined the nucleotide sequence of the P. multocida M1404 (B:2) capsule biosynthetic locus (J. D. Boyce, J. Y. Chung, and B. Adler, Vet. Microbiol. 72:121–134, 2000). The cap locus consists of 15 genes, which can be grouped into three functional regions. Regions 1 and 3 contain genes proposed to encode prot...

  10. A novel Erm monomethyltransferase in antibiotic-resistant isolates of Mannheimia haemolytica and Pasteurella multocida

    DEFF Research Database (Denmark)

    Desmolaize, Benoit; Rose, Simon; Warrass, Ralf

    2011-01-01

    Mannheimia haemolytica and Pasteurella multocida are aetiological agents commonly associated with respiratory tract infections in cattle. Recent isolates of these pathogens have been shown to be resistant to macrolides and other ribosome-targeting antibiotics. Direct analysis of the 23S r...... without any dimethyltransferase activity. Erm(42) is a novel addition to the Erm family: it is phylogenetically distant from the other Erm family members and it is unique in being a bona fide monomethyltransferase that is disseminated between bacterial pathogens....

  11. Antimicrobial susceptibility of Pasteurella multocida and Haemophilus parasuis isolates associated with porcine pneumonia

    Directory of Open Access Journals (Sweden)

    Kateřina Nedbalcová

    2013-01-01

    Full Text Available Pasteurella multocida and Haemophilus parasuis pig isolates obtained in the Czech Republic were tested for their susceptibility against selected antimicrobial agents by broth microdilution method between 2008 and 2011. A low degree of resistance was observed for ampicillin, amoxicillin/clavulanic acid, ceftiofur, tulathromycin, tilmicosin, florfenicol and enrofloxacin in 20 (6.0%, 15 (4.5 %, 2 (0.6%, 8 (2.4%, 13 (3.9%, 5 (1.5% and 5 (1.5% P. multocida isolates as well as for tiamulin, gentamicin, tulathromycin, tilmicosin and ampicillin in 2 (2.4%, 2 (2.4%, 3 (3.6%, 3 (3.6% and 6 (7.2% H. parasuis isolates. In addition, moderate level of resistance to tiamulin was found in 60 (18.1% P. multocida isolates and high level of resistance for tetracycline was detected in 107 (32.2 % P. multocida isolates and in 23 (27.7 % H. parasuis isolates. Differences between resistance rates of P. multocida and H. parasuis were significant (P ≤ 0.5 only for tiamulin. These data confirmed that antimicrobial resistance is not very widespread among current porcine P. multocida and H. parasuis isolates in the Czech Republic.

  12. Revised description and classification of atypical isolates of Pasteurella multocida from bovine lungs based on genotypic characterization to include variants previously classified as biovar 2 of Pasteurella canis and Pasteurella avium

    DEFF Research Database (Denmark)

    Christensen, Henrik; Angen, Øystein; Olsen, John E.

    2004-01-01

    Strains deviating in key phenotypic characters, mainly isolated from cases of bovine pneumonia in five European countries, were genotyped in order to examine their genotypic relationship with Pasteurella multocida. Twenty-two strains of Pasteurella avium biovar 2, including variants in indole, xy...

  13. Pneumonia in calves produced with aerosols of Pasteurella multocida alone and in combination with bovine herpesvirus 1.

    OpenAIRE

    Jericho, K W; Carter, G R

    1985-01-01

    Pathological changes in respiratory tracts were studied in 30 calves following exposure to aerosols of Pasteurella multocida or to bovine herpesvirus 1 and P. multocida. Two groups of five calves were exposed to aerosols of one of two types of P. multocida only, which produced lobar pneumonia in one calf of each group. Another five groups of four calves were exposed to aerosols of bovine herpesvirus 1 and four to seven days later to one of the two types or one sub-type of P. multocida. Extens...

  14. Identificación, biotipificación y caracterización de cepas de Pasteurella multocida aisladas en la Argentina Identification, biotypification and characterization of Pasteurella multocida strains isolated in Argentina

    Directory of Open Access Journals (Sweden)

    G. A. Leotta

    2006-09-01

    Full Text Available Treinta cepas de Pasteurella multocida aisladas en la Argentina a partir de muestras de origen humano y animal fueron identificadas, biotipificadas y caracterizadas. Veintidós de ellas (73% correspondieron a P. multocida subsp. multocida; cinco (17% a P. multocida subsp. gallicida y tres (10% a P. multocida subsp. septica. Todas las cepas fueron agrupadas en 8 biotipos; el 70% presentó el tipo capsular A. Los serotipos somáticos más frecuentes fueron el 1 (n:11 y el 3 (n:9. Las cepas de origen porcino fueron resistentes a tiamulina, estreptomicina y tetraciclina. La caracterización de las cepas de P. multocida aisladas en la Argentina es el primer paso para concretar futuros estudios destinados a la prevención y al tratamiento de la pasteurelosis en medicina humana y veterinaria.Thirty Pasteurella multocida strains isolated in Argentina from human and animal samples were identified, biotypified and characterized. Twenty-two (73% strains were identified as P. multocida subsp. multocida, 5 (17% as P. multocida subsp. gallicida, and 3 (10% as P. multocida subsp. septica. All strains were grouped in 8 biotypes, and 70% of the strains presented capsular type A. The most frequent somatic serotypes were 1 (n:11 and 3 (n:9. P. multocida strains from swine source were resistant to tiamulin, streptomycin and tetracycline. Characterization of P. multocida strains isolated in Argentina is the first step to conduct future studies intended for the prevention and treatment of pasteurellosis in human and veterinary medicine.

  15. Plasmid DNA Analysis of Pasteurella multocida Serotype B isolated from Haemorrhagic Septicaemia outbreaks in Malaysia

    Directory of Open Access Journals (Sweden)

    Jamal, H.

    2005-01-01

    Full Text Available A total of 150 purified isolates of Pasteurella multocida serotype B were used (Salmah, 2004 for plasmid DNA curing experiment to determine hyaluronidase activity, antibiotic resistance pattern (ARP and mice lethality test (LD50 for their role of pathogenicity. A plasmid curing experiment was carried out by using the intercalating agent; ethidium bromide and rifampicin, where it was found all the plasmids had been cured (plasmidless from Pasteurella multocida. All of these plasmidless isolates maintained their phenotypic characteristics. They showed the same antibiotic resistancepattern as before curing, produced hyaluronidase and possessed lethality activity in mice when injected intraperitoneally(i.p. Based on this observation, the antibiotic resistance, hyaluronidase activity and mice virulence could probably be chromosomal-mediated. Plasmids were detected 100% in all P. multocida isolates with identical profile of 2 plasmids size 3.0 and 5.5 kb. No large plasmids could be detected in all isolates. Since all the isolates appeared to have identicalplasmid profiles, they were subjected to restriction enzyme(RE analysis. From RE analysis results obtained, it can be concluded that the plasmid DNA in serotype B isolates are identical. Only 4 of 32 REs were found to cleave these plasmids with identical restriction fingerprints; BglII, HaeIII, RsaI and SspI. From RE analysis results, it can be concluded that the plasmid DNA isolates are identical. This plasmid might not played any role in pathogenicity of Pasteurella multocida serotype B, however this information is important for the construction of shuttle vectors in genetic studies of the pathogenicity of haemorrhagic septicaemia(HS.

  16. Characterization of Pasteurella multocida involved in rabbit infections

    DEFF Research Database (Denmark)

    Massacci, Francesca Romana; Magistrali, Chiara Francesca; Cucco, Lucilla

    2018-01-01

    In rabbit, P. multocida is considered a predominant pathogenic agent; despite this, few data on the molecular epidemiology are available so far. The aim of this work was to characterize P. multocida isolates from rabbit affected by various diseases in Italy. Comparison was made to reference strains...... belonged to the LPS genotypes 3 (22/39) or 6 (17/39). The clonal relationships of the Italian strains from rabbit had similarity to previously reported rabbit isolates that belonged to ST9, ST74, ST204 and ST206, however, they differed from other rabbit references strains that belonged to six other STs....... In particular, ST9 with capsular type F has been previously reported from diseased rabbit in Czech Republic and ST74 has been observed for older rabbit isolates. ST50 has probably been reported from Spain. ST9 and ST50 have previously also been reported from birds and pig, respectively, whereas ST74 has...

  17. Isolation, characterization, antibiogram and pathology of Pasteurella multocida isolated from pigs

    Directory of Open Access Journals (Sweden)

    Mamta Tigga

    2014-05-01

    Full Text Available Aim: Isolation, characterization and antibiogram of Pasteurella multocida from diseased pigs of district Durg of Chhattisgarh, and to study pathological changes caused by swine pasteurellosis. Materials and Methods: An outbreak of swine pasteurellosis was suspected in pigs of Ruwabandha (Bhilai, Anjora, Somni, Tedesara, Tirgajhola villages of Durg district in Chhattisgarh, India during August and September of 2011. Nasal Swabs and blood samples from ailing pigs and heart blood and impression smears from morbid pigs were processed for detection and isolation of P. multocida by bacteriological methods. Detailed necropsy was conducted and gross and histopathological lesions were recorded. The test Isolates were subjected to antimicrobial sensitivity profile by disc-diffusion method. Results: The blood smears from heart blood and tissue impression smears revealed teaming of bipolar organisms indicating the presence of Pasteurella spp. The isolates obtained were subjected to Gram's staining for checking the purity and bipolar morphology and characterized biochemically. Gross lesions included severe acute pneumonia and haemorrhages in lungs, petechial haemorrhages on serous membranes and other visceral organs. On histopathological examination, lungs showed typical fibrinous bronchopneumonia, multifocal suppuration. All the isolates of P. multocida were 100% sensitive to Amoxicillin, Gentamicin, Enrofloxacin and showed100% resistance to Ceftizoxim and Cloxacillin. Conclusion: Gross and microscopic lesions in dead animals are of great diagnostic value and are of characteristic of P. multocida infection. Cultural, morphological and biochemical characters are useful to rule out the causative agent as P. multocida. Antibiotic sensitivity pattern of the isolates should routinely be carried out for knowing the antibiotic resistance trends in an endemic area.

  18. The pathogenesis of Pasteurella multocida local isolates in mice and chicken

    Directory of Open Access Journals (Sweden)

    Supar

    2000-03-01

    Full Text Available Avian cholera or fowl cholera is a bacterial disease caused by Pasteurella multocida strain of serogroup A, has been recognized as important disease in domestic poultry such as ducks and chicken. P. multocida strains derived from overseas and local isolates are stored as freeze dried and kept at the Research hlstitute for Veterinary Science (BALITVET culture collection (BCC. Some of those bacteria are still alive and can be used as vaccine candidates. Each strain or isolate was activated in brain heart infusion broth containing foetal calf serum and incubated at 37°C then it was identitied by biochemical reactions. Field surveys Were conducted in Central Java and South Kalimantan to observe fowl cholera problems and sample collections for isolation of pathogens. Of the 14 of Pasteurella multocida strains or isolates from BCC, II strains (9 imported 2 local isolates were still alive. In addition to this 2 isolates trom chicken and duck were viable. Seven out of 9 imported strains killed mice within 3 x 24 hours, similarly for the local isolates (BCC 299, 2331, DYI, DY2, 12TG, 15TG. However, the only BCC 2331 and DY2 isolates were able to kill two week old chicken witIlin 6 x 24 hours post inoculation. From this experiment indicated that the P. multocida local isolates (BCC 2,331 and DY2 are more pathogenic than that of imported strains. Two strains of imported P. multocida BCC 2331, 1362 and 6 local isolates (BCC 299, 2331, DYI, DY2, 12TG and 15TG would be selected for mono- and polyvalent vaccine candidates in the following experiments and the highly patogenic BCC 2331 and DY2 isolates would be used to challenge the vaccinated animals.

  19. Comparative genome analysis of an avirulent and two virulent strains of avian Pasteurella multocida reveals candidate genes involved in fitness and pathogenicity

    Science.gov (United States)

    Fowl cholera is a highly contagious systemic disease affecting wild and domestic birds, frequently resulting in high morbidity and mortality. The causative agent is Pasteurella multocida (P. multocida). The completed genome of P. multocida strain Pm70 has been available for over eleven years and has...

  20. Anatomopathological pneumonic aspects associated with highly pathogenic Pasteurella multocida in finishing pigs

    Directory of Open Access Journals (Sweden)

    Eliana S. Paladino

    Full Text Available ABSTRACT: The bacterium Pasteurella multocida is a frequent cause of porcine respiratory disease complex in finishing pigs. Historically, the bacterium is recognized as an opportunistic agent, causing secondary bacterial pneumonia in pigs. Several Brazilian reports have suggested the ability of P. multocida to cause primary pulmonary infection that leads to the death of finishing pigs prior to slaughter. The aim of this study was to evaluate anatomopathological pulmonary findings associated with P. multocida infection that were obtained from animals with clinical respiratory disease and from animals at slaughter. Twenty-five lung samples from 14 herds of finishing pigs with acute clinical respiratory disease and 19 lungs collected at slaughter from a different set of 14 herds were studied. In all lung samples, bacterial isolation was performed, and only samples with pure P. multocida growth were included in the study. Gross and histopathological lesions were evaluated, as well as Influenza A, porcine circovirus type 2 (PCV2 and Mycoplasma hyopneumoniae co-infections. Pleuritis and pericarditis were more often observed in clinical samples (P<0.05. Moreover, there was a numerical trend indicating that pericarditis, lymphadenomegaly and cavity exudates were more often present in clinical samples. Thirteen lung samples were negative to M. hyopneumoniae, Influenza A and PCV2 by immunohistochemistry (IHC, with only P. multocida identified. In these cases, gross lesions such as pleuritis, pericarditis and lymphadenomegaly were always present, and no histologic lesions indicative of other agents such as Actinobacillus pleuropneumoniae, Actinobacillus suis or Haemophilus parasuis were observed. These findings suggest the ability of some P. multocida isolates to cause primary respiratory and systemic infection. However, in this study, it was not possible to determine specific virulence markers to explain these findings.

  1. Meningencefalite por Pasteurella multocida: estudo clínico-laboratorial de um caso em lactente

    Directory of Open Access Journals (Sweden)

    C. E. Levy

    1989-12-01

    Full Text Available Os autores apresentam descrição clínico-laboratorial e evolutiva do caso de lactente com o diagnóstico de meningencefalite por Pasteurella multocida que apresentou na evolução atraso neuromotor, manifestações epilépticas, surdez neurossensorial e paresia crural à esquerda. Fazem também breve revisão do papel deste agente etiológico na patologia humana. Ressaltam a importância da P. multocida em casos de meningites bacterianas, fazendo-se o diagnóstico laboratorial diferencial com o Haemophilus influenzae e Neisseria meningitidis em processos infecciosos conseqüentes a arranhadura ou mordida de animais e nas bacteremias ou septicemias em pacientes com hepatopatias crônicas ou em estados de imunodepressão.

  2. Virulence Genes and Antimicrobial Resistance Profiles of Pasteurella multocida Strains Isolated from Rabbits in Brazil

    Directory of Open Access Journals (Sweden)

    Thais Sebastiana Porfida Ferreira

    2012-01-01

    Full Text Available Pasteurella multocida is responsible for a wide range of diseases in domestic animals. In rabbits, the agent is related to nasal discharge, pneumonia, otitis media, pyometra, orchitis, abscess, and septicemia. One hundred and forty rabbits with respiratory diseases from four rabbitries in São Paulo State, Brazil were evaluated for the detection of P. multocida in their nasal cavities. A total of twenty-nine animals were positive to P. multocida isolation, and 46 strains were selected and characterized by means of biochemical tests and PCR. P. multocida strains were tested for capsular type, virulence genes, and resistance profile. A total of 45.6% (21/46 of isolates belonged to capsular type A, and 54.34% (25/46 of the isolates were untypeable. None of the strains harboured toxA or pfhA genes. The frequency of the other twenty genes tested was variable, and the data generated was used to build a dendrogram, showing the relatedness of strains, which were clustered according to origin. Resistance revealed to be more common against sulfonamides and cotrimoxazole, followed by erythromycin, penicillin, and amoxicillin.

  3. Variability of Pasteurella multocida isolated from Icelandic sheep and detection of the toxA gene.

    Science.gov (United States)

    Einarsdottir, Thorbjorg; Gunnarsson, Eggert; Sigurdardottir, Olof G; Jorundsson, Einar; Fridriksdottir, Vala; Thorarinsdottir, Gudridur E; Hjartardottir, Sigridur

    2016-09-01

    Pasteurella multocida can be part of the upper respiratory flora of animals, but under conditions of stress or immunocompromisation, the bacteria can cause severe respiratory symptoms. In this study, we compared 10 P. multocida isolates from Icelandic sheep with respiratory symptoms and 19 isolates from apparently healthy abattoir sheep. We examined capsule type, genetic variability and the presence of the toxA gene in the two groups. Surprisingly, we found that all ovine P. multocida isolates examined in this study carried the toxA gene, which markedly differs from what has been published from other studies. Interestingly, all isolates from abattoir animals were capsule type D, whilst bacteria isolated from animals with clinical respiratory symptoms had capsule type A, D or F. Examination of seven housekeeping genes indicated that the clinical respiratory isolates were significantly more heterogeneous than the abattoir isolates (P<0.05, two-tailed Mann-Whitney U test). The results suggest that there may be at least two groups of P. multocida in sheep - a genetically homogeneous group that resides in the respiratory tract and a genetically heterogeneous group that is the predominant cause of disease.

  4. Multiplex PCR To Identify Macrolide Resistance Determinants in Mannheimia haemolytica and Pasteurella multocida

    DEFF Research Database (Denmark)

    Rose, Simon; Desmolaize, Benoit; Jaju, Puneet

    2012-01-01

    The bacterial pathogens Mannheimia haemolytica and Pasteurella multocida are major etiological agents in respiratory tract infections of cattle. Although these infections can generally be successfully treated with veterinary macrolide antibiotics, a few recent isolates have shown resistance...... to these drugs. Macrolide resistance in members of the family Pasteurellaceae is conferred by combinations of at least three genes: erm(42), which encodes a monomethyltransferase and confers a type I MLS(B) (macrolide, lincosamide, and streptogramin B) phenotype; msr(E), which encodes a macrolide efflux pump...

  5. Prosthetic joint infection caused by Pasteurella multocida: a case series and review of literature.

    Science.gov (United States)

    Honnorat, Estelle; Seng, Piseth; Savini, Hélène; Pinelli, Pierre-Olivier; Simon, Fabrice; Stein, Andreas

    2016-08-20

    Pasteurella multocida is a well-recognized zoonotic agent following dog or cat bites or scratches. Nevertheless, prosthetic joint infection caused by P. multocida are rarely reported. We report here a series of six cases of prosthetic joint infection caused by P. multocida managed at a referral centre for the treatment of bone and joint infection in southern France. We also reviewed the 26 cases reported in literature. The mean age of our cases was 74 years [±8.2, range 63-85]. In majority of our cases (5 cases) were associated with knee prostheses and one case with a hip prosthesis. Most of cases occurred after cat or dog scratches or licks or contact. Diagnoses of prosthetic joint infection caused by P. multocida were made by positive cultures of surgical biopsies or needle aspiration. Mean time delay between prosthetic joint implantation and infection onset was 7.6 years (±5.12 years, range 2-17). Local inflammation, which occurred in all six cases, was the most frequent clinical symptom, followed by pain in five cases, fever and swollen joints in four cases, and a fistula with purulent discharge inside the wound in two cases. The mean time of antibiotic therapy was 8 months. Surgical treatment with prosthesis removal was performed in three cases. Six of our cases were in remission without apparent relapse at 3 years after end of treatment. Prosthetic joint infections caused by P. multocida usually occur after animal scratches or bites, but can occasionally occur after a short animal lick. These infections are usually resulting from a contiguous infection and localized in the knee. An early antibiotic therapy after surgical debridement could avoid prosthetic withdrawal, notably in elderly patients. Patients with prosthetic joints should be warned that animals are potential sources of serious infection and urgent medical advice should be sought if they are bitten or scratched.

  6. Capsular Polysaccharide Interferes with Biofilm Formation by Pasteurella multocida Serogroup A

    Directory of Open Access Journals (Sweden)

    Briana Petruzzi

    2017-11-01

    Full Text Available Pasteurella multocida is an important multihost animal and zoonotic pathogen that is capable of causing respiratory and multisystemic diseases, bacteremia, and bite wound infections. The glycosaminoglycan capsule of P. multocida is an essential virulence factor that protects the bacterium from host defenses. However, chronic infections (such as swine atrophic rhinitis and the carrier state in birds and other animals may be associated with biofilm formation, which has not been characterized in P. multocida. Biofilm formation by clinical isolates was inversely related to capsule production and was confirmed with capsule-deficient mutants of highly encapsulated strains. Capsule-deficient mutants formed biofilms with a larger biomass that was thicker and smoother than the biofilm of encapsulated strains. Passage of a highly encapsulated, poor-biofilm-forming strain under conditions that favored biofilm formation resulted in the production of less capsular polysaccharide and a more robust biofilm, as did addition of hyaluronidase to the growth medium of all of the strains tested. The matrix material of the biofilm was composed predominately of a glycogen exopolysaccharide (EPS, as determined by gas chromatography-mass spectrometry, nuclear magnetic resonance, and enzymatic digestion. However, a putative glycogen synthesis locus was not differentially regulated when the bacteria were grown as a biofilm or planktonically, as determined by quantitative reverse transcriptase PCR. Therefore, the negatively charged capsule may interfere with biofilm formation by blocking adherence to a surface or by preventing the EPS matrix from encasing large numbers of bacterial cells. This is the first detailed description of biofilm formation and a glycogen EPS by P. multocida.

  7. Lack of effect of aerial ammonia on atrophic rhinitis and pneumonia induced by Mycoplasma hyopneumoniae and toxigenic Pasteurella multocida

    DEFF Research Database (Denmark)

    Andreasen, Morten; Bækbo, P.; Nielsen, Jens

    2000-01-01

    The objective of this experimental study was to determine the effects of aerial ammonia on disease development and bacterial colonization in weaned pigs inoculated with toxigenic Pasteurella multocida and Mycoplasma hyopneumoniae. Two groups of 10 pigs each were continuously exposed to 50 and 100 p.......p.m ammonia, respectively, and compared to a non-exposed control, group of 20 pigs. Following aerosol inoculation with M. hyopneumoniae at day 9, ail pigs were aerosol-inoculated with toxigenic P. multocida type A at days 28, 42 and 56. Ac day 63 they were euthanized. Clinical signs including coughing...... with inoculations with M. hyopneumoniae and toxigenic P. multocida had no significant effect on disease development, but may have enhanced colonization by toxigenic P. multocida on the nasal turbinates....

  8. Modulating the regioselectivity of a Pasteurella multocida sialyltransferase for biocatalytic production of 3'- and 6'-sialyllactose

    DEFF Research Database (Denmark)

    Guo, Yao; Jers, Carsten; Meyer, Anne S.

    2015-01-01

    Several bacterial sialyltransferases have been reported to be multifunctional also catalysing sialidase and trans-sialidase reactions. In this study, we examined the trans-sialylation efficacy and regioselectivity of mutants of the multifunctional Pasteurella multocida sialyltransferase (Pm...... activity was abolished. Histidine in this position is conserved in α-2,6-sialyltransferases and has been suggested, and recently confirmed, to be the determinant for strict regiospecificity in the sialyltransferase reaction. Our data verified this theorem. In trans-sialidase reactions, the P34H mutant...... displayed a distinct preference for 6'-sialyllactose synthesis but low levels of 3'-sialyllactose were also produced. The sialyllactose yield was however lower than when using PmSTWT under optimal conditions for 6'-sialyllactose formation. The discrepancy in regiospecificity between the two reactions could...

  9. Structure and function of C-terminal catalytic region of pasteurella multocida toxin

    International Nuclear Information System (INIS)

    Kitadokoro, Kengo; Kamitami, Shigeki; Horiguchi, Yasuhiko

    2008-01-01

    Pasteurella multocida toxin (PMT) is one of virulence factors responsible for the pathogenesis in some Pasteurellosis. We determined the crystal structure of the C-terminal region of PMT (C-PMT), which carries an intracellularly active moiety. The overall structure of C-PMT displays three different domains designated C1, C2 and C3. We found in the C3 domain the Cys-His-Asp catalytic triad that is organized only when the Cys is released from a disulfide bond. The steric alignment of the triad corresponded well to that of papain or other enzymes carrying the Cys-His-Asp triad. Our results demonstrate that PMT is an enzymatic toxin carrying the cysteine-protease like catalytic triad, which is organized only under reducing conditions. (author)

  10. Phenotypic and genotypic characters of isolates of Pasteurella multocida obtained from back-yard poultry and from two outbreaks of avian cholera in avifauna in Denmark

    DEFF Research Database (Denmark)

    Christensen, J.P.; Dietz, Hans-Henrik; Bisgaard, M.

    1998-01-01

    Two outbreaks of fowl cholera in the avifauna in Denmark, affecting primarily elders but also cormorants, gulls and oyster-catchers were shown to be caused by the same clone of Pasteurella multocida ssp, multocida by restriction enzyme analysis (REA) and ribotyping, using the enzymes HpaII and Hha...

  11. Serotypes and DNA fingerprint profiles of Pasteurella multocida isolated from raptors

    Science.gov (United States)

    Wilson, M.A.; Duncan, R.M.; Nordholm, G.E.; Berlowski, B.M.

    1995-01-01

    Pasteurella multocida isolates from 21 raptors were examined by DNA fingerprint profile and serotyping methods. Isolates were obtained from noncaptive birds of prey found in 11 states from November 28, 1979, through February 10, 1993. Nine isolates were from bald eagles, and the remaining isolates were from hawks, falcons, and owls. Seven isolates were members of capsule group A, and 14 were nonencapsulated. One isolate was identified as somatic type 3, and another was type 3,4,7; both had unique HhaI DNA fingerprint profiles. Nineteen isolates expressed somatic type 1 antigen; HhaI profiles of all type 1 isolates were identical to each other and to the HhaI profile of the reference somatic type 1, strain X-73. The 19 type 1 isolates were differentiated by sequential digestion of DNA with HpaII; four HpaII fingerprint profiles were obtained. The HpaII profile of one isolate was identical to the HpaII profile of strain X-73. Incidence of P. multocida somatic type 1 in raptors suggests that this type may be prevalent in other wildlife or wildlife environments.

  12. Field study of pneumonia in vaccinated cattle associated with incorrect vaccination and Pasteurella multocida infection.

    Science.gov (United States)

    Crawshaw, W M; Caldow, G L

    2015-04-25

    This field study used data on the vaccine courses against bovine respiratory disease sold by one pharmaceutical company in conjunction with pharmacovigilance data to explore reported suspected lack of expected efficacy and the reasons for this. The study ran from May 1, 2007, to April 30, 2010, and covered vaccines sold in Scotland and part of Northumberland. In total, 83 groups of cattle reported suspected lack of expected efficacy, representing 1.6 per cent of the 804,618 vaccine courses sold. It was possible to investigate 45 of these outbreaks in depth using a standard questionnaire and diagnostic protocol. Vaccine usage outwith the specific product characteristics (SPC) occurred in 47 per cent of cases (21/45). The proportion of vaccination courses used where a pathogen contained in the vaccine was detected in the diseased cattle and vaccine use was consistent with the SPC was estimated at 0.12 per cent of the courses sold. Pasteurella multocida was the most common pathogen detected and was found in 21 of the outbreaks. For outbreaks where a pathogen contained in the vaccine was detected, P. multocida was found at a significantly greater frequency (P=0.03) where vaccine use was compliant with the SPC (five of six outbreaks) compared with outbreaks where vaccine use had not been compliant with the SPC (one of seven outbreaks). The limitations of the study, including the diagnostic tests employed and definition of vaccination outwith the SPC, are discussed. British Veterinary Association.

  13. Ultrastructural Comparison of the Nasal Epithelia of Healthy and Naturally Affected Rabbits with Pasteurella multocida A

    Directory of Open Access Journals (Sweden)

    Paula Esquinas

    2013-01-01

    Full Text Available An ultrastructural comparison between the nasal cavities of healthy rabbits and those suffering from two forms of spontaneous infection with Pasteurella multocida was undertaken. Twelve commercially produced rabbits of different ages and respiratory health status were divided into four groups: healthy from 0 to 21 days (G1, n=2; healthy from 23 to 49 days (G2, n=2; healthy from 51 to 69 days (G3, n=2; diseased rabbits with septicemia and the rhinitic form of P. multocida infection (G4, n=3. The main ultrastructural changes observed were a widening of the interepithelial spaces, increased activity and number of goblet cells, the formation of two types of vacuoles in epithelial cells, the degranulation and migration of heterophils between the epithelial cells, and the association of this migration with some of the other changes. No bacteria were observed adhering to the epithelium, and very few were observed free in the mucus. Scant inter-epithelial spaces were found in healthy rabbits, but they were not as large and numerous as those found in diseased animals. We discuss the origin and meaning of these changes but, we focus on the significance of the inter-epithelial spaces and goblet cells for the defense of the upper respiratory airways against the bacterium and its lipopolysaccharide.

  14. Efficacy of a novel Pasteurella multocida vaccine against progressive atrophic rhinitis of swine

    Science.gov (United States)

    Hsuan, Shih-Ling; Liao, Chih-Ming; Huang, Chienjin; Winton, James R.; Chen, Zeng-Weng; Lee, Wei-Cheng; Liao, Jiunn-Wang; Chen, Ter-Hsin; Chiou, Chwei-Jang; Yeh, Kuang-Sheng; Chien, Maw-Sheng

    2009-01-01

    The efficacy of a novel vaccine composed of three short recombinant subunit Pasteurella multocida toxin (PMT) proteins in combination with a bi-valent P. multocida whole-cell bacterin (rsPMT–PM) was evaluated in field studies for prevention and control of progressive atrophic rhinitis (PAR) of swine at 15 conventional farrow-to-finish farms. Experimental piglets that were immunized twice with the rsPMT–PM vaccine developed detectable titers of neutralizing antibodies (greater than 1:8) that prevented the growth retardation and pathological lesions typically observed following challenge with authentic PMT. A total of 542 sows were vaccinated once or twice prior to parturition and serum neutralizing antibody titers were evaluated. Both single and double vaccination protocols induced neutralizing antibody titers of 1:16 or higher in 62% and 74% of sows, respectively. Notably, neither sows nor piglets at a farm experiencing a severe outbreak of PAR at the time of the vaccination trial had detectable antibody titers, but antibody titers increased significantly to 1:16 or higher in 40% of sows following double vaccination. During the year after vaccination, clinical signs of PAR decreased in fattening pigs and growth performance improved sufficiently to reduce the rearing period until marketing by 2 weeks. Collectively, these results indicate that the rsPMT–PM vaccine could be used to provide protective immunity for controlling the prevalence and severity of PAR among farm-raised swine.

  15. Isolation and Identification of Pasteurella multocida from Sheep & Goat in Iran

    Directory of Open Access Journals (Sweden)

    Valadan, M.,

    2014-05-01

    Full Text Available This study has been carried out with the objective of isolation and identification of agent(s of pasteurella pneumonia in sheep and goat in Iran using bacteriological and biochemical assays to be identified in the pursuant researches to be used in pasteurellosis vaccine production. To accomplish this objective, samples were gathered from areas suspicious to pasteurellosis infection and industrial abbatoirs according to clinical and autopsy symptoms from eight provinces of Bushehr, Esfahan, Kerman, Kohgilooyeh & Boyr Ahmad, Fars, Qom, Tehran and Qazvin in a period from spring 2008 to spring 2011. Samples were different in sort due to the existent condition but generally were comprised of palatine tonsil swabs or blood samples taken from jugular vein in live animals and lungs or upper respiratory tract lymph glands in dead or slaughtered animals. Totally, 1454 samples (1120 samples of sheep, 334 samples of goat composed if 1084 samples of live animals and 370 samples of dead or slaughterd animals were tested. Considering results obtained from assays, only 54 samples (3.71% were assessed as being pasteurella, genus of which was totally identified as multocida.

  16. Genotyping of Pasteurella multocida ovine and bovine isolates from Iran based on PCR-RFLP of ompH gene

    Directory of Open Access Journals (Sweden)

    A. Ghanizadeh

    2015-10-01

    Full Text Available Pasteurella multocida (P. multocida, A Gram-negative facultative anaerobic bacterium, is a causative animal pathogen in porcine atrophic rhinitis and avian fowl cholera. The outer membrane of Gram-negative bacteria contains of many different protein in very high copy numbers. One of the major outer membrane, the H proteins have functional as high immunogenicity and antigenicity. In this study to increase information about epidemiology of ovine and bovine P. multocida, the 24 isolates from sheep and nine isolates from cattle were investigated by PCR-RFLP analysis of the ompH gene. In all 33 isolates, digestion of the amplified fragment of ompH gene by using EcoRI, cfoI and HindIII produced 3, 5 and 3 different restriction patterns respectively. Sixteen RFLP patterns were found among 33 investigated P.multocida isolates. This study showed that, the PCR RFLP based on ompH gene is potentially a useful method for typing of P. multocida isolates from sheep and cattle. The RFLP patterns of this gene exhibited extensive restriction site heterogeneity, which may be particularly suitable for fingerprinting of P. multocida isolates.Considering ompH protein as a protective immunogenic moiety of P.ultocida, the results of this study showed a heterogenic bacteria and this means the possibility to produce a multivalent vaccine to be protective against diseases caused by this organism in sheep and cattle in Iran.

  17. Isolation, characterization, virulence and immunogenicity testing of field isolates of Pasteurella multocida, Staphylococcus aureus, and Streptococcus agalactiae in laboratory settings.

    Science.gov (United States)

    Qudratullah; Muhammad, G; Saqib, M; Bilal, M Qamar

    2017-08-01

    The present study was designed to investigate isolation, characterization, virulence and immunogenicity testing of field isolates of Pasteurella multocida, Staphylococcus aureus, and Streptococcus agalactiae in rabbits and mice. Isolates of P. multocida, S. aureus and Str. agalactiae recovered from field cases of Hemorragic septicemia and mastitis were scrutinized for virulence/pathogenicity and immunogenicity. Mouse LD 50 of P. multocida showed that P. multocida isolate No.1 was more virulent than isolates No. 2 and 3. Virulence of isolate No.1S. aureus and Str. agalactiae revealed that 100, 80% rabbits died within 18h of inoculation. Seven-digit numerical profiles of these 4 isolates with API ® Staph test strips isolates, No.1 (6736153) showed good identification (S. aureus id=90.3%). Indirect ELISA-based serum antibody titers to P. multocida isolate No.1, S. aureus No.1, Str. agalactiae, isolate No.1 elicited high antibody titers 1.9, 1.23, 1.12 respectively. All the pathogens of Isolate No. 1 (P. multocida, S. aureus Str. agalactiae), were high antibody than others isolates. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Mutant prevention concentration and PK-PD relationships of enrofloxacin for Pasteurella multocida in buffalo calves.

    Science.gov (United States)

    Balaje, R M; Sidhu, P K; Kaur, G; Rampal, S

    2013-12-01

    This study validated the use of mutant prevention concentration (MPC) and pharmacokinetic and pharmacodynamic (PK-PD) modeling approach for optimization of dose regimen of enrofloxacin to contain the emergence of Pasteurella multocida resistance. The PK and PD characteristics of enrofloxacin were investigated in buffalo calves after intramuscular administration at a dose rate of 12 mg/kg. The concentration of enrofloxacin and ciprofloxacin in serum were determined by high-performance liquid chromatography. The serum peak concentration (Cmax), terminal half-life (t1/2K10), volume of distribution (Vd(area)/F) and mean residence time (MRT) of enrofloxacin were 1.89 ± 0.35 μg/ml, 5.14 ± 0.66 h, 5.59 ± 0.99 l/kg/h and 8.52 ± 1.29 h, respectively. The percent metabolite conversion ratio of ciprofloxacin to enrofloxacin was 79. The binding of enrofloxacin to plasma proteins was 11%. The MIC, MBC and MPC for enrofloxacin against P. multocida were 0.05, 0.06 μg/ml and 1.50 μg/ml.In vitro and ex-vivo bactericidal activity of enrofloxacin was concentration dependent. Modeling of ex-vivo growth inhibition data to the sigmoid Emax equation provided AUC24h/MIC values to produce bacteriostatic (19 h), bactericidal (43 h) and bacterial eradication (64 h). PK-PD data in conjunction with MPC and MIC90 data predicted dosage schedules for enrofloxacin that may achieve optimum efficacy in respect of bacteriological and clinical cure and minimize the risk of emergence of resistance. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. The capsule is a virulence determinant in the pathogenesis of Pasteurella multocida M1404 (B:2).

    Science.gov (United States)

    Boyce, J D; Adler, B

    2000-06-01

    Capsules from a range of pathogenic bacteria are key virulence determinants, and the capsule has been implicated in virulence in Pasteurella multocida. We have previously identified and determined the nucleotide sequence of the P. multocida M1404 (B:2) capsule biosynthetic locus (J. D. Boyce, J. Y. Chung, and B. Adler, Vet. Microbiol. 72:121-134, 2000). The cap locus consists of 15 genes, which can be grouped into three functional regions. Regions 1 and 3 contain genes proposed to encode proteins involved in capsule export, and region 2 contains genes proposed to encode proteins involved in polysaccharide biosynthesis. In order to construct a mutant impaired in capsule export, the final gene of region 1, cexA, was disrupted by insertion of a tetracycline resistance cassette by allelic replacement. The genotype of the tet(M) OmegacexA mutant was confirmed by Southern hybridization and PCR. The acapsular phenotype was confirmed by immunofluorescence, and the strain could be complemented and returned to capsule production by the presence of a cloned uninterrupted copy of cexA. Wild-type, mutant, and complemented strains were tested for virulence by intraperitoneal challenge of mice; the presence of the capsule was shown to be a crucial virulence determinant. Following intraperitoneal challenge of mice, the acapsular bacteria were removed efficiently from the blood, spleen, and liver, while wild-type bacteria multiplied rapidly. Acapsular bacteria were readily taken up by murine peritoneal macrophages, but wild-type bacteria were significantly resistant to phagocytosis. Both wild-type and acapsular bacteria were resistant to complement in bovine and murine serum.

  20. Ducks as a potential reservoir for Pasteurella multocida infection detected using a new rOmpH-based ELISA.

    Science.gov (United States)

    Liu, Rongchang; Chen, Cuiteng; Cheng, Longfei; Lu, Ronghui; Fu, Guanghua; Shi, Shaohua; Chen, Hongmei; Wan, Chunhe; Lin, Jiansheng; Fu, Qiuling; Huang, Yu

    2017-07-28

    Pasteurella multocida is an important pathogen of numerous domestic poultry and wild animals and is associated with a variety of diseases including fowl cholera. The aim of this study was to develop an indirect enzyme-linked immunosorbent assay (ELISA) based on recombinant outer-membrane protein H (rOmpH) for detection of anti-P. multocida antibodies in serum to determine their prevalence in Chinese ducks. The P. multocida ompH gene was cloned into pET32a, and rOmpH was expressed in Escherichia coli BL21 (DE3). Western blotting revealed that purified rOmpH was recognized by duck antisera against P. multocida, and an indirect ELISA was established. During analysis of serum samples (n=115) from ducks, the rOmpH ELISA showed 95.0% specificity, 100% sensitivity and a 92.0% κ coefficient (95% confidence interval 0.844-0.997) as compared with a microtiter agglutination test. Among 165 randomly selected serum samples, which were collected in 2015 and originated from six duck farms across Fujian Province, China, anti-P. multocida antibodies were detected in 22.42% of apparently healthy ducks, including 25 of 90 sheldrakes (27.8%), eight of 50 Peking ducks (16.0%) and four of 25 Muscovy ducks (16%). Overall, the data suggest that rOmpH is a suitable candidate antigen for the development of an indirect ELISA for detection of P. multocida in ducks; moreover, our results showed that ducks could serve as a potential reservoir for P. multocida infection.

  1. Surveillance of antimicrobial resistance in clinical isolates of Pasteurella multocida and Streptococcus suis from Ontario swine

    Science.gov (United States)

    Glass-Kaastra, Shiona K.; Pearl, David L.; Reid-Smith, Richard J.; McEwen, Beverly; Slavic, Durda; Fairles, Jim; McEwen, Scott A.

    2014-01-01

    Susceptibility results for Pasteurella multocida and Streptococcus suis isolated from swine clinical samples were obtained from January 1998 to October 2010 from the Animal Health Laboratory at the University of Guelph, Guelph, Ontario, and used to describe variation in antimicrobial resistance (AMR) to 4 drugs of importance in the Ontario swine industry: ampicillin, tetracycline, tiamulin, and trimethoprim–sulfamethoxazole. Four temporal data-analysis options were used: visualization of trends in 12-month rolling averages, logistic-regression modeling, temporal-scan statistics, and a scan with the “What’s strange about recent events?” (WSARE) algorithm. The AMR trends varied among the antimicrobial drugs for a single pathogen and between pathogens for a single antimicrobial, suggesting that pathogen-specific AMR surveillance may be preferable to indicator data. The 4 methods provided complementary and, at times, redundant results. The most appropriate combination of analysis methods for surveillance using these data included temporal-scan statistics with a visualization method (rolling-average or predicted-probability plots following logistic-regression models). The WSARE algorithm provided interesting results for quality control and has the potential to detect new resistance patterns; however, missing data created problems for displaying the results in a way that would be meaningful to all surveillance stakeholders. PMID:25355992

  2. ESTUDIOS DE AISLAMIENTO Y FRACCIONAMIENTO DE UN COMPLEJO GLICOPROTEICO DE PASTEURELLA MULTOCIDA

    Directory of Open Access Journals (Sweden)

    Yolanda de Navarro

    2010-07-01

    Full Text Available Mediante la extracción con solución de NaCl 2.5% (p/v a 47' C, se obtuvo un complejo glicoproteíco de Pasteurella multocida que fue parcialmente purificado mediante filtración por gel usando Sephacryl S-200. Las fracciones 1, 2 y 3 presentaron líneas de precipitinas en imnunodifusión contra sueros hiperimnunes de conejos inoculados con extracto salino 2.5% (P/V a 47" C y 66' C. Por electroforesis SDS-PAGE. se determinaron bandas de proteínas con pesos moleculares entre 98.800 y 17.700 daltons. Lafracción lyel extracto salino crudo a 47" C se utilizaron como antígenos adsorbidos en gel de Al(OHj y con ellos se efectuaron ensayos de protección en ratones, teniendo como referencia la vacuna comercial contra Septicemia Hemorrágica producida por VECOL S.A. Mediante el método estadístico de Reed Muench se estableció el índice de protección y se encontró que todos los antígenos fueron considerados prolectores, siendo la fracción 1 la de mayor índice de protección con una dosis inferior.

  3. Comparison of standardised versus non-standardised methods for testing the in vitro potency of oxytetracycline against mannheimia haemolytica and pasteurella multocida

    OpenAIRE

    Lees, P; Illambas, J; Pelligand, L; Toutain, P L

    2016-01-01

    The in vitro pharmacodynamics of oxytetracycline was established for six isolates of each of the calf pneumonia pathogens Mannheimia haemolytica and Pasteurella multocida. Minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and bacterial time-kill curves were determined in two matrices, Mueller Hinton broth (MHB) and calf serum. Geometric mean MIC ratios, serum:MHB, were 25.2:1 (M. haemolytica) and 27.4:1 (P. multocida). The degree of binding of oxytetracycline to...

  4. Oral exposure to culture material extract containing fumonisins predisposes swine to the development of pneumonitis caused by Pasteurella multocida

    International Nuclear Information System (INIS)

    Halloy, David J.; Gustin, Pascal G.; Bouhet, Sandrine; Oswald, Isabelle P.

    2005-01-01

    Fumonisin B 1 (FB 1 ) is a mycotoxin produced by Fusarium verticillioides and F. proliferatum that commonly occurs in maize. In swine, consumption of contaminated feed induces liver damage and pulmonary edema. Pasteurella multocida is a secondary pathogen, which can generate a respiratory disorder in predisposed pigs. In this study, we examined the effect of oral exposure to fumonisin-containing culture material on lung inflammation caused by P. multocida. Piglets received by gavage a crude extract of fumonisin, 0.5 mg FB 1 /kg body weight/day, for 7 days. One day later, the animals were instilled intratracheally with a non toxin producing type A strain of P. multocida and followed up for 13 additional days. Pig weight and cough frequency were measured throughout the experiment. Lung lesions, bronchoalveolar lavage fluid (BALF) cell composition and the expression of inflammatory cytokines were evaluated at the autopsy. Ingestion of fumonisin culture material or infection with P. multocida did not affect weight gain, induced no clinical sign or lung lesion, and only had minimal effect on BALF cell composition. Ingestion of mycotoxin extract increased the expression of IL-8, IL-18 and IFN-γ mRNA compared with P. multocida infection that increased the expression of TNF-α. The combined treatment with fumonisin culture material and P. multocida delayed growth, induced cough, and increased BALF total cells, macrophages and lymphocytes. Lung lesions were significantly enhanced in these animals and consisted of subacute interstitial pneumonia. TNF-α, IFN-γ and IL-18 mRNA expression was also increased. Taken together, our data showed that fumonisin culture material is a predisposing factor to lung inflammation. These results may have implications for humans and animals consuming FB 1 contaminated food or feed

  5. Oral exposure to culture material extract containing fumonisins predisposes swine to the development of pneumonitis caused by Pasteurella multocida

    Energy Technology Data Exchange (ETDEWEB)

    Halloy, David J [Department of Functional Sciences, Unit of Pharmacology, Pharmacotherapy and Toxicology, Faculty of Veterinary Medicine, University of Liege, Liege (Belgium); Gustin, Pascal G [Department of Functional Sciences, Unit of Pharmacology, Pharmacotherapy and Toxicology, Faculty of Veterinary Medicine, University of Liege, Liege (Belgium); Bouhet, Sandrine [INRA, UR66, Laboratory of Pharmacology and Toxicology, 180 Chemin de Tournefeuille, BP3, 31931 Toulouse (France); Oswald, Isabelle P [INRA, UR66, Laboratory of Pharmacology and Toxicology, 180 Chemin de Tournefeuille, BP3, 31931 Toulouse (France)

    2005-09-15

    Fumonisin B{sub 1} (FB{sub 1}) is a mycotoxin produced by Fusarium verticillioides and F. proliferatum that commonly occurs in maize. In swine, consumption of contaminated feed induces liver damage and pulmonary edema. Pasteurella multocida is a secondary pathogen, which can generate a respiratory disorder in predisposed pigs. In this study, we examined the effect of oral exposure to fumonisin-containing culture material on lung inflammation caused by P. multocida. Piglets received by gavage a crude extract of fumonisin, 0.5 mg FB{sub 1}/kg body weight/day, for 7 days. One day later, the animals were instilled intratracheally with a non toxin producing type A strain of P. multocida and followed up for 13 additional days. Pig weight and cough frequency were measured throughout the experiment. Lung lesions, bronchoalveolar lavage fluid (BALF) cell composition and the expression of inflammatory cytokines were evaluated at the autopsy. Ingestion of fumonisin culture material or infection with P. multocida did not affect weight gain, induced no clinical sign or lung lesion, and only had minimal effect on BALF cell composition. Ingestion of mycotoxin extract increased the expression of IL-8, IL-18 and IFN-{gamma} mRNA compared with P. multocida infection that increased the expression of TNF-{alpha}. The combined treatment with fumonisin culture material and P. multocida delayed growth, induced cough, and increased BALF total cells, macrophages and lymphocytes. Lung lesions were significantly enhanced in these animals and consisted of subacute interstitial pneumonia. TNF-{alpha}, IFN-{gamma} and IL-18 mRNA expression was also increased. Taken together, our data showed that fumonisin culture material is a predisposing factor to lung inflammation. These results may have implications for humans and animals consuming FB{sub 1} contaminated food or feed.

  6. Multiorgan Failure and Refractory Lactic Acidosis due to Pasteurella multocida Septicemia in a Patient with No Animal Exposure

    Directory of Open Access Journals (Sweden)

    Damaris Pena

    2018-01-01

    Full Text Available Introduction. Pasteurella multocida is a gram-negative coccobacillus pathogenic to animals. It can cause infection in humans by a bite, scratch, or lick from a cat or dog. P. multocida can cause a variety of infections in humans, including cellulitis, osteomyelitis, endocarditis, peritonitis, and septic shock. Case Presentation. A 56-year-old male presented to our hospital with a 2-day history of fever, abdominal pain, nausea, and vomiting. He denied exposure to cats, dogs or other pets. He had severe respiratory distress requiring ventilator support, profound septic shock requiring multiple vasopressors, severe lactic acidosis, and renal failure requiring emergent hemodialysis. Blood cultures confirmed the presence of P. multocida. The patient subsequently died of cardiopulmonary arrest due to multiorgan failure with refractory shock. Conclusion. P. multocida septicemia can lead to septic shock. Early identification of this organism may decrease mortality. Although our patient had no known cat or dog exposure, physicians should enquire about a history of animal exposure when a patient presents with an infection with no obvious cause.

  7. [Effect of lead microparticles introduced into the respiratory system of the sensitivity of mice to Pasteurella multocida infection via aerosol].

    Science.gov (United States)

    Bouley, G; Dubreuil, A; Arsac, F; Boudène, C

    1977-12-19

    Lead microparticles, resulting from the pyrolysis of organic lead used as an anti-knock agent in gasoline, were introduced into the lungs of Mice, during a short single exposure. When 6 microgram of lead were retained in the lungs (mean value per Mouse), the phagocytic ability of the pulmonary alveolar macrophages harvested 6 and 18 hrs. later, was significantly reduced. It was observed, in the same conditions, that the resistance of Mice to experimental infection by aerosolized Pasteurella multocida, was significantly reduced. When 3 microgram of lead were retained in the lungs, there was no significant difference between control and intoxicated Mice.

  8. Antimicrobial susceptibility, serotypes and genotypes of Pasteurella multocida isolates associated with swine pneumonia in Taiwan.

    Science.gov (United States)

    Yeh, Jih-Ching; Lo, Dan-Yuan; Chang, Shao-Kuang; Chou, Chi-Chung; Kuo, Hung-Chih

    2017-09-21

    Pasteurella multocida (PM) can cause progressive atrophic rhinitis and suppurative bronchopneumonia in pigs. The present study performed antimicrobial susceptibility testing and serotype and genotype identification on the 62 PM strains isolated from the lungs of diseased pigs with respiratory symptoms. Antimicrobial susceptibility testing examined 13 antimicrobial agents (amoxicillin, cefazolin, doxycycline, flumequine, enrofloxacin, florfenicol, kanamycin, lincomycin, Linco-Spectin (lincomycin and spectinomycin), erythromycin, tylosin, tilmicosin and tiamulin). Antimicrobial resistance ratios were over 40% in all of the antimicrobial agents except for cefazolin. The highest levels of resistance (100%) were found for kanamycin, erythromycin and tylosin. The majority of isolated strains was serotype D:L6 (n=35) followed by A:L3 (n=17). Comparison of the antimicrobial resistance levels between the two serotypes showed that the antimicrobial resistance rates were higher in D:L6 than in A:L3 for all the tested antimicrobials except for tylosin and tilmicosin. For PM with erm (B), erm (T) or erm (42), the results showed no significant difference compared with non-resistance gene strains in phenotype. Pulsed-field gel electrophoresis genotyping using Apa I restriction digestion of the genomic DNA demonstrated that there were 17 distinct clusters with a similarity of 85% or more, and the genotyping result was similar to that of serotyping. The results of the present study demonstrated that the PM isolated from diseased pigs in Taiwan was resistant to multiple antimicrobials, and the distribution of antimicrobial resistance was associated with pulsotype and serotype. © British Veterinary Association (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  9. Time-course investigation of infection with a low virulent Pasteurella multocida strain in normal and immune-suppressed 12-week-old free-range chickens

    DEFF Research Database (Denmark)

    Mbuthia, P.G.; Njagi, L.W.; Nyaga, P.N.

    2011-01-01

    Twelve-week-old indigenous chickens, either immune-suppressed using dexamethasone (IS) or non-immune-suppressed (NIS), were challenged with a low virulent strain, Pasteurella multocida strain NCTC 10322(T), and developed clinical signs and pathological lesions typical of chronic fowl cholera. NIS...

  10. Analysis of the polymerization initiation and activity of Pasteurella multocida heparosan synthase PmHS2, an enzyme with glycosyltransferase and UDP-sugar hydrolase activity

    NARCIS (Netherlands)

    Chavaroche, A.A.E.; Broek, van den L.A.M.; Springer, J.; Boeriu, C.; Eggink, G.

    2011-01-01

    Heparosan synthase catalyzes the polymerization of heparosan [-4GlcUAß1-4GlcNAca1-]n by transferring alternatively the monosaccharide units from UDP-GlcUA and UDP-GlcNAc to an acceptor molecule. Details on the heparosan chain initiation by Pasteurella multocida heparosan synthase PmHS2 and its

  11. Bronchoalveolar lavage is an ideal tool in evaluation of local immune response of pigs vaccinated with Pasteurella multocida bacterin vaccine

    Directory of Open Access Journals (Sweden)

    Shiney George

    2015-04-01

    Full Text Available Aim: The aim was to study the bronchoalveolar lavage (BAL technique in evaluating the local immune response of pig immunized with Pasteurella multocida bacterin vaccine. Materials and Methods: Weaned piglets were immunized with formalin-inactivated P52 strain of P. multocida bacterin and evaluated for pulmonary immune response in BAL fluid. BAL was performed before vaccination and at different post vaccination days. The BAL fluid was assayed using enzyme-linked immunosorbent assay to study the development of P. multocida specific antibody isotypes and also evaluated for different cell populations using standard protocol. Results: The average recovery percentage of BAL fluid varies from 58.33 to 61.33 in vaccinated and control group of piglets. The BAL fluid of vaccinated pigs showed increase in antibody titer up to 60th days post vaccination (8.98±0.33, IgG being the predominant isotype reached maximum titer of 6.12±0.20 on 45th days post vaccination, followed by IgM and a meager concentration of IgA could be detected. An increased concentration of the lymphocyte population and induction of plasma cells was detected in the BAL fluid of vaccinated pigs. Conclusion: Though intranasal vaccination with P. multocida plain bacterin vaccine could not provoke a strong immune response, but is promising as lymphocyte population was increased and plasma cells were detected. BAL can be performed repeatedly up to 3/4 months of age in pigs to study pulmonary immune response without affecting their health.

  12. Pharmacokinetic/pharmacodynamic integration and modelling of oxytetracycline for the porcine pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida.

    Science.gov (United States)

    Dorey, L; Pelligand, L; Cheng, Z; Lees, P

    2017-10-01

    Pharmacokinetic-pharmacodynamic (PK/PD) integration and modelling were used to predict dosage schedules of oxytetracycline for two pig pneumonia pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Minimum inhibitory concentration (MIC) and mutant prevention concentration (MPC) were determined in broth and porcine serum. PK/PD integration established ratios of average concentration over 48 h (C av0-48 h )/MIC of 5.87 and 0.27 μg/mL (P. multocida) and 0.70 and 0.85 μg/mL (A. pleuropneumoniae) for broth and serum MICs, respectively. PK/PD modelling of in vitro time-kill curves established broth and serum breakpoint values for area under curve (AUC 0-24 h )/MIC for three levels of inhibition of growth, bacteriostasis and 3 and 4 log 10 reductions in bacterial count. Doses were then predicted for each pathogen, based on Monte Carlo simulations, for: (i) bacteriostatic and bactericidal levels of kill; (ii) 50% and 90% target attainment rates (TAR); and (iii) single dosing and daily dosing at steady-state. For 90% TAR, predicted daily doses at steady-state for bactericidal actions were 1123 mg/kg (P. multocida) and 43 mg/kg (A. pleuropneumoniae) based on serum MICs. Lower TARs were predicted from broth MIC data; corresponding dose estimates were 95 mg/kg (P. multocida) and 34 mg/kg (A. pleuropneumoniae). © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

  13. Occurrence Of Virulence Factors And Antimicrobial Resistance In Pasteurella Multocida Strains Isolated From Slaughter Cattle In Iran

    Directory of Open Access Journals (Sweden)

    Faham eKhamesipour

    2014-10-01

    Full Text Available A total of 30 Pasteurella multocida strains isolated from 333 pneumonic and apparently health slaughter cattle were examined for capsule biosynthesis genes and 23 virulence associated genes by polymerase chain reaction. The disc diffusion technique was used to determine antimicrobial resistance profiles among the isolates. Of the isolates, 23 belonged to capsular type A, 5 to capsular type D and two isolates were untypeable. The distribution of the capsular types in pneumonic lungs and in apparently health lungs was statistically similar. All virulence genes tested were detected among the isolates derived from pneumonic lungs; whereas isolates derived from apparently health lungs carried 16 of the 23 genes. The frequently detected genes among isolates from pneumonic lungs were exbD, hgbA, hgbB, ompA, ompH, oma87 and sodC; whereas tadD, toxA and pmHAS genes occurred less frequently. Most of the adhesins and superoxide dismutases; and all of the iron acquisition and protectin proteins occurred at significantly (p≤0.05 higher frequencies in isolates from pneumonic lungs. Isolates from apparently healthy lungs didn’t carry the following genes; hsf-1, hsf-2, tadD, toxA, nanB, nanH and pmHAS. One adhesion (hsf-1 and two iron acquisition (exbD and tonB genes occurred at significantly (p≤0.05 higher frequencies among capA isolates. All the P. multocida isolates were susceptible to ciprofloxacin, co-trimoxazole, doxycycline, enrofloxacin, nitrofurantoin and tetracyclines. Different proportions of the isolates were however resistant to ampicillin, amoxicillin, erythromycin, lincomycin, penicillin, rifampin, streptomycin and florfenicol. Our results reveal presence of virulence factors in P. multocida strains isolated from symptomatic and asymptomatic bovids. A higher frequency of the factors among isolates from symptomatic study animals may suggest their role in pathogenesis of P. multocida-associated bovine respiratory disease. The results further

  14. Why your housecat's trite little bite could cause you quite a fright: a study of domestic felines on the occurrence and antibiotic susceptibility of Pasteurella multocida.

    Science.gov (United States)

    Freshwater, A

    2008-10-01

    Approximately four to five million animal bite wounds are reported in the USA each year. Domestic companion animals inflict the majority of these wounds. Although canine bites far outnumber feline bites, unlike the dog, the cat's bite is worse than its bark; 20-80% of all cat bites will become infected, compared with only 3-18% of dog bite wounds. Pasteurella multocida is the most commonly cultured bacterium from infected cat bite wounds. Anyone seeking medical attention for a cat-inflicted bite wound is given prophylactic/empiric penicillin or a derivative to prevent Pasteurella infection (provided they are not allergic to penicillins). In an effort to establish a carriage rate of P. multocida in the domestic feline, bacterial samples from the gingival margins of domestic northern Ohio cats (n=409) were cultured. Isolates were tested for antibiotic sensitivity as prophylactic/empiric use of penicillin and its derivatives could potentially give rise to antibiotic resistance in P. multocida. The high carriage rate (approximately 90%) of P. multocida observed was found to be independent of physiological and behavioural variables including age, breed, food type, gingival scale, lifestyle and sex. High antibiotic susceptibility percentages were observed for benzylpenicillin, amoxicillin-clavulanate, cefazolin, and azithromycin (100%, 100%, 98.37% and 94.02%, respectively) in P. multocida isolates. The high prevalence of P. multocida in the feline oral cavity indicates that prophylactic/empiric antibiotic therapy is still an appropriate response to cat bite wounds. Additionally, the susceptibility of P. multocida to penicillin and its derivatives indicates that they remain reliable choices for preventing and treating P. multocida infections.

  15. Serological evidence of avian encephalomyelitis virus and Pasteurella multocida infections in free-range indigenous chickens in Southern Mozambique.

    Science.gov (United States)

    Taunde, Paula; Timbe, Palmira; Lucas, Ana Felicidade; Tchamo, Cesaltina; Chilundo, Abel; Dos Anjos, Filomena; Costa, Rosa; Bila, Custodio Gabriel

    2017-06-01

    A total of 398 serum samples from free-range indigenous chickens originating from four villages in Southern Mozambique were tested for the presence of avian encephalomyelitis virus (AEV) and Pasteurella multocida (PM) antibodies through commercial enzyme-linked immunosorbent assay (ELISA) kits. AEV and PM antibodies were detected in all villages surveyed. The proportion of positive samples was very high: 59.5% (95% confidence interval (CI) 51.7-67.7%) for AEV and 71.5% (95% CI 67.7-77.3%) for PM. Our findings revealed that these pathogens are widespread among free-range indigenous chickens in the studied villages and may represent a threat in the transmission of AEV and PM to wild, broiler or layer chickens in the region. Further research is warranted on epidemiology of circulating strains and impact of infection on the poultry industry.

  16. Molecular analysis of Pasteurella multocida strains isolated from fowl cholera infection in backyard chickens

    Directory of Open Access Journals (Sweden)

    Mohamed-Wael Abdelazeem Mohamed

    2014-01-01

    Conclusion: Based on the previous findings, there are three spreading clusters that may indicate the association of a small number of P. multocida variants with the majority of cases suggesting that certain clones of P. multocida are able to colonize the examined backyard chickens. Also, the ease and rapidity of RAPD-PCR support the use of this technique as alternative to the more labour-intensive SDS-PAGE system for strain differentiation and epidemiological studies of avian P. multocida. Further application of RAPD technology to the examination of avian cholera outbreaks in commercially available flocks may facilitate more effective management of this disease by providing the potential to investigate correlations of P. multocida genotypes, to identify affiliations between bird types and bacterial genotypes, and to elucidate the role of specific bird species in disease transmission.

  17. Serological patterns of Actinobacillus pleuropneumoniae, Mycoplasma hyopneumoniae, Pasteurella multocida and Streptococcus suis in pig herds affected by pleuritis.

    Science.gov (United States)

    Wallgren, Per; Nörregård, Erik; Molander, Benedicta; Persson, Maria; Ehlorsson, Carl-Johan

    2016-10-04

    Respiratory illness is traditionally regarded as the disease of the growing pig, and has historically mainly been associated to bacterial infections with focus on Mycoplasma hyopneumoniae and Actinobacillus pleuropneumoniae. These bacteria still are of great importance, but continuously increasing herd sizes have complicated the scenario and the influence of secondary invaders may have been increased. The aim of this study was to evaluate the presence of A. pleuropneumoniae and M. hyopneumoniae, as well as that of the secondary invaders Pasteurella multocida and Streptococcus suis by serology in four pig herds (A-D) using age segregated rearing systems with high incidences of pleuritic lesions at slaughter. Pleuritic lesions registered at slaughter ranged from 20.5 to 33.1 % in the four herds. In herd A, the levels of serum antibodies to A. pleuropneumoniae exceeded A 450  > 1.5, but not to any other microbe searched for. The seroconversion took place early during the fattening period. Similar levels of serum antibodies to A. pleuropneumoniae were also recorded in herd B, with a subsequent increase in levels of antibodies to P. multocida. Pigs seroconverted to both agents during the early phase of the fattening period. In herd C, pigs seroconverted to P. multocida during the early phase of the fattening period and thereafter to A. pleuropneumoniae. In herd D, the levels of antibodies to P. multocida exceeded A 450  > 1.0 in absence (A 450  hyopneumoniae and to S. suis remained below A 450  hyopneumoniae late during the rearing period (herd B-D), or not at all (herd A). Different serological patterns were found in the four herds with high levels of serum antibodies to A. pleuropneumoniae and P. multocida, either alone or in combination with each other. Seroconversion to M. hyopneumoniae late during the rearing period or not at all, confirmed the positive effect of age segregated rearing in preventing or delaying infections with M

  18. Mucoadhesive and pH-sensitive thiolated Eudragit microspheres for oral delivery of Pasteurella multocida antigens containing dermonecrotoxin.

    Science.gov (United States)

    Islam, Mohammad Ariful; Jiang, Hu-Lin; Quan, Ji-Shan; Arote, Rohidas B; Kang, Mi-Lan; Yoo, Han-Sang; Yun, Cheol-Heui; Choi, Yun-Jaie; Cho, Chong-Su

    2011-05-01

    In this study, cysteine was conjugated to the Eudragit to have mucoadhesive and pH-sensitive properties. Pasteurella multocida dermonecrotoxin (PMT) is a major virulence factor as a causative agent of atrophic rhinitis (AR) in swine and, therefore, inactivated P. multocida was used as a candidate vaccine in the current study. PMT-loaded thiolated Eudragit microspheres (TEMS) prepared using W/O/W emulsion-solvent evaporation method were characterized to assess their efficacy in oral vaccination. PMT-loaded TEMS were observed as spherical shapes with smooth surfaces and average particle sizes were 5.2 +/- 0.55 microm. The loading efficiency of PMT in the TEMS was about 75.3%. A significantly higher percentage of PMT from PMT-loaded TEMS was released at pH 7.4 than at pH 1.5. Murine macrophage stimulated with PMT-loaded TEMS facilitated a gradual secretion of tumor necrosis factor-alpha and nitric oxide as immune stimulatory mediators in a time dependent manner, suggesting that the released PMT from PMT-loaded TEMS had immune stimulating activity of AR vaccine in vitro.

  19. Pharmacokinetic/pharmacodynamic integration and modelling of florfenicol for the pig pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida.

    Directory of Open Access Journals (Sweden)

    Lucy Dorey

    Full Text Available Pharmacokinetic-pharmacodynamic (PK/PD integration and modelling were used to predict dosage schedules for florfenicol for two pig pneumonia pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Pharmacokinetic data were pooled for two bioequivalent products, pioneer and generic formulations, administered intramuscularly to pigs at a dose rate of 15 mg/kg. Antibacterial potency was determined in vitro as minimum inhibitory concentration (MIC and Mutant Prevention Concentration in broth and pig serum, for six isolates of each organism. For both organisms and for both serum and broth MICs, average concentration:MIC ratios over 48 h were similar and exceeded 2.5:1 and times greater than MIC exceeded 35 h. From in vitro time-kill curves, PK/PD modelling established serum breakpoint values for the index AUC24h/MIC for three levels of inhibition of growth, bacteriostasis and 3 and 4log10 reductions in bacterial count; means were 25.7, 40.2 and 47.0 h, respectively, for P. multocida and 24.6, 43.8 and 58.6 h for A. pleuropneumoniae. Using these PK and PD data, together with literature MIC distributions, doses for each pathogen were predicted for: (1 bacteriostatic and bactericidal levels of kill; (2 for 50 and 90% target attainment rates (TAR; and (3 for single dosing and daily dosing at steady state. Monte Carlo simulations for 90% TAR predicted single doses to achieve bacteriostatic and bactericidal actions over 48 h of 14.4 and 22.2 mg/kg (P. multocida and 44.7 and 86.6 mg/kg (A. pleuropneumoniae. For daily doses at steady state, and 90% TAR bacteriostatic and bactericidal actions, dosages of 6.2 and 9.6 mg/kg (P. multocida and 18.2 and 35.2 mg/kg (A. pleuropneumoniae were required. PK/PD integration and modelling approaches to dose determination indicate the possibility of tailoring dose to a range of end-points.

  20. Rapid diagnosis of virulent Pasteurella multocida isolated from farm animals with clinical manifestation of pneumonia respiratory infection using 16S rDNA and KMT1 gene

    Directory of Open Access Journals (Sweden)

    Gamal Mohamedin Hassan

    2016-01-01

    Full Text Available Objective: To characterize intra-isolates variation between clinical isolates of Pasteurella multocida (P. multocida isolated from sheep, cattle and buffalo at molecular level to check the distribution of pneumonia and hemorrhagic septicemia in some regions of Fayoum, Egypt. Methods: These isolates were obtained from various locations in the Fayoum Governorate, Egypt and they were identified by amplifying 16S rDNA and KMT1 genes using their DNA as a template in PCR reaction. Results: The results demonstrated that the five selective isolates of P. multocida had similar size of PCR products that generated one band of 16S rDNA having 1 471 bp and KMT1 gene having 460 bp. The phylogenetic tree and similarity of the five selective isolates of P. multocida which were collected from GenBank database were calculated and analyzed for the nucleotide sequence of 16S rDNA and KMT1 genes. The sequencing result of 16S rRNA gene product (1 471 bp for the five selective isolates of P. multocida showed that the isolates of sheep (FUP2 shared 94.08%, 88.10% homology with the buffalo isolate (FUP8 and cattle isolate (FUP9 respectively, whereas, the buffalo isolate (FUP5 shared 98.18% and 94.40% homology with the cattle isolates (FUP12 and FUP9. Conclusions: The results indicated the relationships of P. multocida isolated from buffalo and cattle rather than the close relationships between P. multocida isolated from cattle and sheep. Diagnosis of P. multocida by 16S rDNA and KMT1 gene sequences was important to determine the antigen that is responsible for protective cover within the same group of animals and to help for the production of new vaccines for the control of microbial infection for domestic animals.

  1. Development of fowl cholera vaccine: I. Protection of Pasteurella multocida local isolate vaccine against challenge of homologous and heterologous strains.

    Directory of Open Access Journals (Sweden)

    Supar

    2001-03-01

    Full Text Available Pasteurella multocida locally isolated from chicken and ducks (BCC 299, BCC 2331, DY1, DY2, 12TG, 15TG andimported strains (BCC 1359, 1362; HEDDLESTON group 1 and 6 respectively had been tested for its pathogenicity in theprevious study. The aims of this experiment were to study the preparation of local isolate pasteurellosis vaccines and to determine the protective effect of that vaccines in chicken against the highly pathogenic local isolates of P. multocida. Killed monovalent, bivalent and polyvalent pasteurellosis vaccines were prepared and each was adjunvanted with aluminum hydroxide gel at a final concentration of 1.5% and the cell concentration was equal to the No 10 of MacFarland tube standard. Each of the vaccine prepared was used to vaccinated on a group of six week old of layer chicken (8 per group. Each chicken was subcutaneously injected with 0.2 ml of vaccine, four weeks later each was boostered with similar vaccine with the same dose. Two weeks after giving the boostered vaccine each group of chicken were challenged, half with life bacterium of P. Multocida BCC 2331 and other with DY2. Any chick which survive after challenge was designated as protected by vaccination. Before vaccination 1 ml of blood was drawn from each of chicken and then two weeks apart up to challenge. Serum from each sample was separated and kept in deep freeze until tested by enzyme-linked immunosorbent assay (ELISA. Chicken vaccinated with killed whole cell P. multocida vaccines of monovalent (BCC 2331 or DY2 and bivalent (BCC 2331 + DY2 were protected against challenge with live bacterium of either BCC 2331 or DY2 at rate 67-100%. There was no protection in chicken vaccinated with either BCC 299, DY1, 12TG, 15TG, BCC 1359, or 1362 killed vaccine. Similarly no protection of chicken vaccinated with either DY1 + BCC299, 12TG + 15TG or BCC 1359 + BCC 1362 bivalent vaccines. The protection rate of the polyvalent local isolate vaccine was at average 50-75%. All

  2. Isolation and molecular detection of Pasteurella multocida Type A from naturally infected chickens, and their histopathological evaluation in artificially infected chickens in Bangladesh

    Directory of Open Access Journals (Sweden)

    Sayedun Nahar Panna

    2015-09-01

    Full Text Available Pasteurella multocida type A is the etiologic agent of fowl cholera, a highly contagious and fatal disease of chickens. The present research work was performed for the isolation, identification and molecular detection of P. multocida Type A from chickens. Liver, heart and spleen of suspected dead chicken (n=35 were collected from Gazipur and Pabna districts in Bangladesh. The targeted bacteria from the samples were isolated, identified and characterized based on their morphology, staining, cultural, biochemical characters, pathogenicity test, histopathological study and Polymerase Chain Reaction (PCR. The P. multocida organism was isolated from 11.42% (n=4/35 samples. The organisms were gram negative, non-spore forming rod, non-motile, occurring singly or pairs in Gram staining, whereas in Leishman's stain, bipolar shaped organisms were observed. All the isolates were found positive for oxidase and catalase tests, produced indole, and fermented glucose, mannitol and sucrose. Necrotic foci in liver and congestion with hemorrhages in heart were found on necropsy. After pathogenicity test, the pathological changes were reconfirmed by histopathology depicting congestion, hemorrhage and lymphocyte infiltration in heart, liver and spleen tissues. In type specific PCR reaction, the organisms were confirmed as P. multocida Type A. In conclusion, P. multocida type A is prevalent among poultry in the studied regions; thus, care must be taken to control of the disease. [J Adv Vet Anim Res 2015; 2(3.000: 338-345

  3. What is the true in vitro potency of oxytetracycline for the pig pneumonia pathogens Actinobacillus pleuropneumoniae and Pasteurella multocida?

    Science.gov (United States)

    Dorey, L; Hobson, S; Lees, P

    2017-10-01

    The pharmacodynamics of oxytetracycline was determined for pig respiratory tract pathogens, Actinobacillus pleuropneumoniae and Pasteurella multocida. Indices of potency were determined for the following: (i) two matrices, broth and pig serum; (ii) five overlapping sets of twofold dilutions; and (iii) a high strength starting culture. For A. pleuropneumoniae, minimum inhibitory concentration (MIC) was similar for the two matrices, but for P. multocida, differences were marked and significantly different. MIC and minimum bactericidal concentration (MBC) serum: broth ratios for A. pleuropneumoniae were 0.83:1 and 1.22:1, respectively, and corresponding values for P. multocida were 22.0:1 and 7.34:1. For mutant prevention concentration (MPC) serum: broth ratios were 0.79:1 (A. pleuropneumoniae) and 20.9:1 (P. multocida). These ratios were corrected for serum protein binding to yield fraction unbound (fu) serum: broth MIC ratios of 0.24:1 (A. pleuropneumoniae) and 6.30:1 (P. multocida). Corresponding fu serum: broth ratios for MPC were almost identical, 0.23:1 and 6.08:1. These corrections for protein binding did not account for potency differences between serum and broth for either species; based on fu serum MICs, potency in serum was approximately fourfold greater than predicted for A. pleuropneumoniae and sixfold smaller than predicted for P. multocida. For both broth and serum and both bacterial species, MICs were also dependent on initial inoculum strength. The killing action of oxytetracycline had the characteristics of codependency for both A. pleuropneumoniae and P. multocida in both growth media. The in vitro potency of oxytetracycline in pig serum is likely to be closer to the in vivo plasma/serum concentration required for efficacy than potency estimated in broths. © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

  4. Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

    Directory of Open Access Journals (Sweden)

    Stefan Carle

    2017-01-01

    Full Text Available The AB-type protein toxin from Pasteurella multocida (PMT contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases.

  5. Cellular defense of the avian respiratory system: effects of Pasteurella multocida on respiratory burst activity of avian respiratory tract phagocytes.

    Science.gov (United States)

    Ochs, D L; Toth, T E; Pyle, R H; Siegel, P B

    1988-12-01

    The respiratory tract of healthy chickens contain few free-residing phagocytic cells. Intratracheal inoculation with Pasteurella multocida stimulated a significant (P less than 0.05) migration of cells to the lungs and air sacs of White Rock chickens within 2 hours after inoculation. We found the maximal number of avian respiratory tract phagocytes (22.9 +/- 14.0 x 10(6] at 8 hours after inoculation. Flow cytometric analysis of these cells revealed 2 populations on the basis of cell-size and cellular granularity. One of these was similar in size and granularity to those of blood heterophils. Only this population was capable of generating oxidative metabolites in response to phorbol myristate acetate. The ability of the heterophils to produce hydrogen peroxide, measured as the oxidation of intracellularly loaded 2',7'-dichlorofluorescein, decreased with time after inoculation. These results suggest that the migration of heterophils, which are capable of high levels of oxidative metabolism, to the lungs and air sacs may be an important defense mechanism of poultry against bacterial infections of the respiratory tract.

  6. Establishment of a Pathogenicity Index for One-day-old Broilers to Pasteurella multocida Strains Isolated from Clinical Cases in Poultry and Swine

    Directory of Open Access Journals (Sweden)

    RM Pilatti

    Full Text Available ABSTRACT Although Pasteurella multocida is a member of the respiratory microbiota, under some circumstances, it is a primary agent of diseases , such as fowl cholera (FC, that cause significant economic losses. Experimental inoculations can be employed to evaluate the pathogenicity of strains, but the results are usually subjective and knowledge on the pathogenesis of this agent is still limited. The objective of this study was to establish a new methodology for classifying the pathogenicity of P. multocida by formulating a standard index. Strains isolated from FC cases and from swine with respiratory problems were selected. One hundred mL of a bacterial culture of each strain, containing 106 CFU, was inoculated in 10 one-day-old broilers. Mortality after inoculation, time of death (TD, and the presence of six macroscopic lesions were evaluated over a period of seven days post-inoculation (dpi. A Pathogenicity Index Per Bird (IPI, ranging 0 to 10, was calculated. Liver and heart fragments were collected to reisolate the bacteria. Blood was collected from the surviving birds, and an ELISA test was carried out to detect specific antibodies. The median of the pathogenicity indices, the number of lesions and the rate of bacteria reisolation were significantly different (p<0.05 among the origins of the isolates (p<0.05. The pathogenicity index developed in this study allows the classification of Pasteurella multocida pathogenicity and may be an alternative to the pathogenicity models currently used for screening.

  7. The origin of Pasteurella multocida impacts pathology and inflammation when assessed in a mouse model

    DEFF Research Database (Denmark)

    Pors, Susanne E.; Chadfield, Mark S.; Sorensen, Dorte B.

    2016-01-01

    dose dependent and consisted of exudative bronchopneumonia, abscess formation in liver and a lower bacterial load in lung and liver. Both isolates caused increased expression of MMP9 and TIMP1. In conclusion, evaluation and comparison of pathogenicity and host-pathogen interaction of P. multocida......) of an isolate from porcine pneumonia or fowl cholera showed marked differences between the two isolates. The avian isolate was highly pathogenic with severe signs of necrotizing pneumonia, liver necrosis and high bacterial load in lung and liver. Clinical signs and pathology related to the porcine isolate were...

  8. Pasteurella multocida from outbreaks of avian cholera in wild and captive birds in Denmark

    DEFF Research Database (Denmark)

    Pedersen, Karl; Dietz, Hans-Henrik; Jørgensen, J.C.

    2003-01-01

    An outbreak of avian cholera was observed among wild birds in a few localities in Denmark in 2001. The highest mortalities were among breeding ciders (Somateria mollissima) and gulls (Larus spp.). Pulsed-field gel electrophoresis (PFGE) was conducted using ApaI and SmaI as restriction enzymes...... the outbreak strain. Among 68 isolates from wild birds, only one PFGE and one REA pattern were demonstrated, whereas among 23 isolates from domestic poultry, 14 different SmaI, 12 different ApaI, and 10 different HpaII patterns were found. The results suggest that a P. multocida strain has survived during...

  9. Evaluación de dos técnicas de subtipificación molecular para el estudio de Pasteurella multocida Evaluation of two techniques of molecular subtyping to study Pasteurella multocida

    Directory of Open Access Journals (Sweden)

    G. A. Leotta

    2006-12-01

    Full Text Available Se determinó la tipibilidad, la reproducibilidad y el poder discriminatorio de ERIC-PCR y ApaI-PFGE para establecer la relación genética de cepas de Pasteurella multocida. Se estudiaron 49 cepas de diferente origen, subespecie, biotipo, grupo capsular, serotipo somático y perfil de resistencia antimicrobiana. Por ERIC-PCR se establecieron 31 patrones, los que presentaron entre 10 y 14 bandas en un rango comprendido entre 0,2 y 1,2 kb. Por ApaI-PFGE se detectaron 37 patrones de restricción, los cuales presentaron entre 7 y 15 bandas bien definidas de 34 a 450 kb. La tipibilidad de ERIC-PCR fue del 100% (T=1 y la de ApaI-PFGE del 94% (T=0,94. La reproducibilidad de ambas técnicas fue del 100% (R=1; sin embargo, el poder discriminatorio de ERIC-PCR fue 93% (D=0,93 y el de ApaI-PFGE 98% (D=0,98. Mediante ambas técnicas fue posible agrupar las cepas con relación epidemiológica y diferenciar claramente las cepas no relacionadas. Se demostró el valor de ERIC-PCR y ApaI-PFGE para complementar estudios epidemiológicos, principalmente si las cepas en estudio son analizadas por ambas técnicas.Typeability, reproducibility, and discriminatory power of ERIC-PCR and ApaI-PFGE to establish the genetic relation of P. multocida strains were determined. Forty-nine strains of different source, biotype, capsular group, somatic serotype, and resistance to antimicrobials were studied. By ERIC-PCR, 31 patterns were defined with 10 to 14 bands in a rank of 0.2 and 1.2 kb. By ApaI-PFGE, 37 restriction patterns were established with 7 to 15 bands of 34 to 450 kb. Typeability was 100% (T=1 for ERIC-PCR, and 94% (T=0.94 for ApaI-PFGE. Reproducibility of both techniques was 100% (R=1. Discriminatory power was 93% (D=0.93 for ERIC-PCR, and 98% (D=0.98 for ApaI-PFGE. By using both techniques, epidemiologically related strains were grouped, and unrelated strains were clearly differentiated. The value of ERIC-PCR and ApaI-PFGE as complements to epidemiologic studies

  10. Susceptibilidade in vitro a antimicrobianos da Mannheimia haemolytica e da Pasteurella multocida isoladas de ovinos sadios e com doenças respiratórias

    Directory of Open Access Journals (Sweden)

    Leomar Viana

    2007-12-01

    Full Text Available Pasteurella multocida e Mannheimia haemolytica (P. haemolytica estão associadas a enfermidades no sistema respiratório de ovinos. Com o objetivo de avaliar a susceptibilidade in vitro destes microrganismos frente aos antimicrobianos, foram colhidas amostras de nasofaringe (n=180 e orofaringe (n=82 de ovinos com e sem enfermidade respiratória. Dentre os antimicrobianos testados, a sensibilidade foi maior para enrofloxacina (100% e florfenicol (100%, considerando-se ambas as espécies bacterianas. Observou-se resistência de M. haemolytica e P. multocida à tetraciclina (15,64% e 17,65%, respectivamente e penicilina (1.82% e 4.2%, respectivamente.

  11. Hematology of layers chickens vaccinated with fowl cholera vaccine and experimentally inoculated with virulent Pasteurella multocida serotypes in Zaria, Nigeria

    Directory of Open Access Journals (Sweden)

    Yusuf Madaki Lekko

    2017-09-01

    Conclusion The PCV significantly decrease P≤0.05 in layers vaccinated and inoculated with P. multocida but increase in unvaccinated layers inoculated P. multocida. The mean serum ALP concentration significantly increase P≤0.05 in unvaccinated layers inoculated with P. multocida when compared to layers vaccinated and inoculated with P. multocida. [J Adv Vet Anim Res 2017; 4(3.000: 234-240

  12. Arf6-Dependent Intracellular Trafficking of Pasteurella multocida Toxin and pH-Dependent Translocation from Late Endosomes

    Directory of Open Access Journals (Sweden)

    Tracy P. M. Chong

    2011-03-01

    Full Text Available The potent mitogenic toxin from Pasteurella multocida (PMT is the major virulence factor associated with a number of epizootic and zoonotic diseases caused by infection with this respiratory pathogen. PMT is a glutamine-specific protein deamidase that acts on its intracellular G-protein targets to increase intracellular calcium, cytoskeletal, and mitogenic signaling. PMT enters cells through receptor-mediated endocytosis and then translocates into the cytosol through a pH-dependent process that is inhibited by NH4Cl or bafilomycin A1. However, the detailed mechanisms that govern cellular entry, trafficking, and translocation of PMT remain unclear. Co-localization studies described herein revealed that while PMT shares an initial entry pathway with transferrin (Tfn and cholera toxin (CT, the trafficking pathways of Tfn, CT, and PMT subsequently diverge, as Tfn is trafficked to recycling endosomes, CT is trafficked retrograde to the ER, and PMT is trafficked to late endosomes. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of PMT. Translocation of PMT from the endocytic vesicle occurs through a pH-dependent process that is also dependent on both microtubule and actin dynamics, as evidenced by inhibition of PMT activity in our SRE-based reporter assay, with nocodazole and cytochalasin D, respectively, suggesting that membrane translocation and cytotoxicity of PMT is dependent on its transfer to late endosomal compartments. In contrast, disruption of Golgi-ER trafficking with brefeldin A increased PMT activity, suggesting that inhibiting PMT trafficking to non-productive compartments that do not lead to translocation, while promoting formation of an acidic tubulovesicle system more conducive to translocation, enhances PMT translocation and activity.

  13. Virulence Genotyping of Pasteurella multocida Isolated from Multiple Hosts from India

    Directory of Open Access Journals (Sweden)

    Laxmi Narayan Sarangi

    2014-01-01

    Full Text Available In this study, 108 P. multocida isolates recovered from various host animals such as cattle, buffalo, swine, poultry (chicken, duck, and emu and rabbits were screened for carriage of 8 virulence associated genes. The results revealed some unique information on the prevalence of virulence associated genes among Indian isolates. With the exception of toxA gene, all other virulence associated genes were found to be regularly distributed among host species. Association study between capsule type and virulence genes suggested that pfhA, nanB, and nanH genes were regularly distributed among all serotypes with the exception of CapD, whereas toxA gene was found to be positively associated with CapD and CapA. The frequency of hgbA and nanH genes among swine isolates of Indian origin was found to be less in comparison to its equivalents around the globe. Interestingly, very high prevalence of tbpA gene was observed among poultry, swine, and rabbit isolates. Likewise, very high prevalence of pfhA gene (95.3% was observed among Indian isolates, irrespective of host species origin.

  14. Virulence genotyping of Pasteurella multocida isolated from multiple hosts from India.

    Science.gov (United States)

    Sarangi, Laxmi Narayan; Priyadarshini, Adyasha; Kumar, Santosh; Thomas, Prasad; Gupta, Santosh Kumar; Nagaleekar, Viswas Konasagara; Singh, Vijendra Pal

    2014-01-01

    In this study, 108 P. multocida isolates recovered from various host animals such as cattle, buffalo, swine, poultry (chicken, duck, and emu) and rabbits were screened for carriage of 8 virulence associated genes. The results revealed some unique information on the prevalence of virulence associated genes among Indian isolates. With the exception of toxA gene, all other virulence associated genes were found to be regularly distributed among host species. Association study between capsule type and virulence genes suggested that pfhA, nanB, and nanH genes were regularly distributed among all serotypes with the exception of CapD, whereas toxA gene was found to be positively associated with CapD and CapA. The frequency of hgbA and nanH genes among swine isolates of Indian origin was found to be less in comparison to its equivalents around the globe. Interestingly, very high prevalence of tbpA gene was observed among poultry, swine, and rabbit isolates. Likewise, very high prevalence of pfhA gene (95.3%) was observed among Indian isolates, irrespective of host species origin.

  15. Distribution of the ompA-types among ruminant and swine pneumonic strains of Pasteurella multocida exhibiting various cap-locus and toxA patterns.

    Science.gov (United States)

    Vougidou, C; Sandalakis, V; Psaroulaki, A; Siarkou, V; Petridou, E; Ekateriniadou, L

    2015-05-01

    Pasteurella multocida is an important pathogen in food-producing animals and numerous virulence genes have been identified in an attempt to elucidate the pathogenesis of pasteurellosis. Currently, some of these genes including the capsule biosynthesis genes, the toxA and the OMPs-encoding genes have been suggested as epidemiological markers. However, the number of studies concerning ruminant isolates is limited, while, no attempt has ever been made to investigate the existence of ompA sequence diversity among P. multocida isolates. The aim of the present study was the comparative analysis of 144 P. multocida pneumonic isolates obtained from sheep, goats, cattle and pigs by determining the distribution of the ompA-types in conjunction with the cap-locus and toxA patterns. The ompA genotypes of the isolates were determined using both a PCR-RFLP method and DNA sequence analysis. The most prevalent capsule biosynthesis gene among the isolates was capA (86.1%); a noticeable, however, rate of capD-positive isolates (38.6%) was found among the ovine isolates that had been associated primarily with the capsule type A in the past. Moreover, an unexpectedly high percentage of toxA-positive pneumonic isolates was noticed among small ruminants (93.2% and 85.7% in sheep and goats, respectively), indicating an important epidemiological role of toxigenic P. multocida for these species. Despite their great heterogeneity, certain ompA-genotypes were associated with specific host species, showing evidence of a host preference. The OmpA-based PCR-RFLP method developed proved to be a valuable tool in typing P. multocida strains. Copyright © 2015 Elsevier GmbH. All rights reserved.

  16. Pasteurella multocida in backyard chickens in Upper Egypt: incidence with polymerase chain reaction analysis for capsule type, virulence in chicken embryos and antimicrobial resistance.

    Science.gov (United States)

    Mohamed, Moemen A; Mohamed, Mohamed-Wael A; Ahmed, Ahmed I; Ibrahim, Awad A; Ahmed, Mohamed S

    2012-01-01

    The prevalence of Pasteurella multocida strains among 275 backyard chickens from different regions of Upper Egypt was studied. A total of 21 isolates of P. multocida were recovered in 21 out of 275 chickens tested (7.6%) and were confirmed using phenotypic characterisation. Somatic serotyping of the 21 isolates resulted in 12 isolates being classed as serotype A:1 (57.14%), 4 as serotype A:3 (19.05%) and 5 could not be typed (23.8%). Capsular typing, using multiplex polymerase chain reaction (PCR), demonstrated that 18 strains were capsular type A (85.7%), and 3 were type D (14.3%). The present findings suggest that a multiplex capsular PCR could be valuable for the rapid identification of P. multocida in cases of fowl cholera infection. A total of 5 isolates of P. multocida were selected to study their pathogenicity in embryonated chicken eggs instead of conducting a study in mature chickens. The results showed a variation in pathogenicity between the strains tested, namely: serotype A:1 strains caused 80% mortality, in contrast to 20% mortality by type D strains. Pathological findings included severe congestion of the entire embryo, haemorrhaging of the skin, feather follicles and toe, and ecchymotic haemorrhages on the liver of the inoculated embryos. The observations in this study indicate that P. multocida serogroup A could be highly pathogenic for mature chickens and therefore might be a cause of considerable economic losses in commercial production. A total of 10 isolates were subjected to antimicrobial susceptibility to determine the minimal inhibitory concentration of 7 antimicrobials. All isolates were susceptible to ciprofloxacin, florfenicol, streptomycin and sulphamethoxazol with trimethoprim and with varying degrees of sensitivity to the other agents.

  17. A capsule/lipopolysaccharide/MLST genotype D/L6/ST11 of Pasteurella multocida is likely to be strongly associated with swine respiratory disease in China.

    Science.gov (United States)

    Peng, Zhong; Wang, Haonan; Liang, Wan; Chen, Yibao; Tang, Xibiao; Chen, Huanchun; Wu, Bin

    2018-01-01

    Pasteurella multocida is a leading cause of respiratory disease in pigs worldwide. In this study, we determined the genetic characteristics of 115 P. multocida isolates from the lungs of pigs with respiratory disease in China in 2015 using capsular typing, lipopolysaccharide (LPS) genotyping, and virulence genotyping based on the detection of virulence-associated genes. The results showed that the isolates belonged to three capsular types: A (49.6%), D (46.1%), and nontypable (4.3%); and two LPS genotypes: L3 (22.6%) and L6 (77.4%). When combining the capsular types with the LPS genotypes, a genotype group D: L6 (46.1%) was the most prevalent among the strains. Among the 23 virulence-associated genes detected in this study, a small number of them displayed a certain level of "genotype-preference". We found that pfhA, hgbA, and hgbB had a close association with P. multocida LPS genotypes, while tadD was more associated with P. multocida capsular types. In addition, multilocus sequence typing (MLST) on 40 P. multocida isolates identified four sequence types: ST3, ST10, ST11, and ST16, and the distribution of ST11 was significantly higher than the other MLST genotypes. Interestingly, all of the ST11 isolates detected in this study were genotype D: L6 strains and they were 100% positive for hgbB. Our data suggest that a capsule/LPS/MLST genotype D/L6/ST11 is likely to be strongly associated with respiratory clinical manifestation of the disease in pigs.

  18. Pasteurella multocida in backyard chickens in Upper Egypt: incidence with polymerase chain reaction analysis for capsule type, virulence in chicken embryos and antimicrobial resistance

    Directory of Open Access Journals (Sweden)

    Moemen A. Mohamed

    2012-03-01

    Full Text Available The prevalence of Pasteurella multocida strains among 275 backyard chickens from different regions of Upper Egypt was studied. A total of 21 isolates of P. multocida were recovered in 21 out of 275 chickens tested (7.6% and were confirmed using phenotypic characterisation. Somatic serotyping of the 21 isolates resulted in 12 isolates being classed as serotype A:1 (57.14%, 4 as serotype A:3 (19.05% and 5 could not be typed (23.8%. Capsular typing, using multiplex polymerase chain reaction (PCR, demonstrated that 18 strains were capsular type A (85.7%, and 3 were type D (14.3%. The present findings suggest that a multiplex capsular PCR could be valuable for the rapid identification of P. multocida in cases of fowl cholera infection. A total of 5 isolates of P. multocida were selected to study their pathogenicity in embryonated chicken eggs instead of conducting a study in mature chickens. The results showed a variation in pathogenicity between the strains tested, namely: serotype A:1 strains caused 80% mortality, in contrast to 20% mortality by type D strains. Pathological findings included severe congestion of the entire embryo, haemorrhaging of the skin, feather follicles and toe, and ecchymotic haemorrhages on the liver of the inoculated embryos. The observations in this study indicate that P. multocida serogroup A could be highly pathogenic for mature chickens and therefore might be a cause of considerable economic losses in commercial production. A total of 10 isolates were subjected to antimicrobial susceptibility to determine the minimal inhibitory concentration of 7 antimicrobials. All isolates were susceptible to ciprofloxacin, florfenicol, streptomycin and sulphamethoxazol with trimethoprim and with varying degrees of sensitivity to the other agents.

  19. Isolation, identification, and monitoring of antibiotic resistance in Pasteurella multocida and Mannheimia haemolytica isolated from sheep in East Azerbaijan province, Iran

    Directory of Open Access Journals (Sweden)

    I. Khalili

    2016-09-01

    Full Text Available The present study was carried out in order to isolate, identify, and assess the antimicrobial susceptibility of the causative agent(s of pneumonic pasteurellosis in sheep in East Azerbaijan province, northwest of Iran. Pneumonia was detected in 320 cases, and the affected lungs were sampled in the slaughterhouse. The samples were investigated bacteriologically for the isolation of two microorganisms from the Pasteurellaceae family. Pasteurella multocida was isolated from six (1.87% samples, while none of the lung tissues were positive for Mannheimia haemolytica. After the isolation and detection of microorganisms via cultural and morphological tests, the bacteria were identified on the basis of biochemical criteria and polymerase chain reaction (PCR technique. Antimicrobial susceptibility testing was performed on all P. multocida isolates, using broth microdilution method. Evaluation of the minimum inhibitory concentration (MIC of eight antimicrobial agents against the tested isolates showed that all the organisms were resistant to amoxicillin and relatively susceptible to ceftiofur. In conclusion, P. multocida was introduced as the main cause of ovine pneumonic pasteurellosis in the studied district, and the outbreak frequency significantly varied in different seasons of the year (P

  20. Clinico-pathology, hematology and biochemistry responses in buffaloes towards Pasteurella multocida type B: 2 immunogen lypopolysaccharide via oral and intravenous routes of infection.

    Science.gov (United States)

    Chung, Eric Lim Teik; Abdullah, Faez Firdaus Jesse; Ibrahim, Hayder Hamzah; Marza, Ali Dhiaa; Zamri-Saad, Mohd; Haron, Abdul Wahid; Lila, Mohd Azmi Mohd; Norsidin, Mohd Jefri

    2016-02-01

    Haemorrhagic septicaemia is a disease caused by Pasteurella multocida serotype B: 2 and E: 2. The organism causes acute, highly fatal septicaemic disease with high morbidity and mortality in cattle and more susceptible in buffaloes. Lipopolysaccharide can be found on the outer cell wall of the organism. Lipopolysaccharide is released during multiplication which leads to inflammatory reaction. It represents the endotoxin of P. multocida type B: 2 and responsible for toxicity in haemorrhagic septicaemia which plays an important role in the pathogenesis of the disease. Therefore, the aim of this study was to investigate the clinical signs, blood parameters, gross post mortem lesions and histopathology changes caused by P. multocida type B:2 immunogen lipopolysaccharide infections initiated through intravenous and oral routes of infection. 9 buffalo heifers were divided equally into 3 treatment groups. Group 1 was inoculated orally with 10 ml of phosphate buffer saline (PBS); Group 2 and 3 were inoculated with 10 ml of lipopolysaccharide broth intravenously and orally respectively. For the clinical signs, there were significant differences (p hematology and biochemistry findings, there were significant differences (p 0.05) in the MCHC, leukocytes, band neutrophils, basophils, thrombocytes, plasma protein, icterus index, total protein, globulin and A:G ratio between intravenous and oral group. For Group 2 buffaloes, there were gross lesions in the lung, trachea, heart, liver, spleen, and kidney. In contrast, lesions were only observed in the lung, trachea and liver of Group 3 buffaloes. There were significant differences (p 0.05) in edema lesion between groups. In conclusion, this study is a proof that oral route infection of P. multocida type B:2 immunogen lipopolysaccharide can be used to stimulate host cell responses where oral vaccine through feed could be developed in the near future. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Determination of the minimum inhibitory concentration (MIC and mutant prevention concentration (MPC of selected antimicrobials in bovine and swine Pasteurella multocida, Escherichia coli, and Staphylococcus aureus isolates

    Directory of Open Access Journals (Sweden)

    Kateřina Nedbalcová

    2015-01-01

    Full Text Available We compared the values of the minimum inhibitory concentration (MIC and mutant prevention concentration (MPC values ​​of three antimicrobial agents for 72 bovine isolates of Pasteurella multocida, 80 swine isolates of P. multocida, 80 bovine isolates of Escherichia coli, 80 swine isolates of E. coli, and 80 isolates of Staphylococcus aureus from bovine mastitis. The ratio of MIC90​​/MPC90 which limited mutant selection window (MSW was ≤ 0.12/4 mg/l for enrofloxacin, 0.5/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in bovine P. multocida isolates, ≤ 0.12/2 mg/l for enrofloxacin, 0.5/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in swine P. multocida isolates, 1/16 mg/l for enrofloxacin, 8/≥ 64 mg/l for florfenicol and 8/≥ 128 mg/l for tulathromycin in bovine E. coli isolates, 0.5/16 mg/l for enrofloxacin, ≥ 64/≥ 64 mg/l for florfenicol and 8/≥ 128 mg/l for tulathromycin in swine E. coli isolates, and 0.25/16 mg/l for enrofloxacin, 4/≥ 64 mg/l for florfenicol and 4/≥ 128 mg/l for tulathromycin in S. aureus isolates. These findings indicate that the dosage of antimicrobial agents to achieve serum concentration equal to or higher than MPC could reduce selection of resistant bacterial subpopulation.

  2. Cross protection against fowl cholera disease with the use of recombinant Pasteurella multocida FHAB2 peptides vaccine

    Science.gov (United States)

    It has been demonstrated that fhaB2 (filamentous hemagglutinin) is an important virulence factor for P. multocida in development of fowl cholera disease and that recombinant FHAB2 peptides derived from P. multocida, Pm-1059, protect turkeys against Pm-1059 challenge. To test the hypothesis that rFHA...

  3. Investigation of genetic diversity and epidemiological characteristics of Pasteurella multocida isolates from poultry in southwest China by population structure, multi-locus sequence typing and virulence-associated gene profile analysis.

    Science.gov (United States)

    Li, Zhangcheng; Cheng, Fangjun; Lan, Shimei; Guo, Jianhua; Liu, Wei; Li, Xiaoyan; Luo, Zeli; Zhang, Manli; Wu, Juan; Shi, Yang

    2018-04-25

    Fowl cholera caused by Pasteurella multocida has always been a disease of global importance for poultry production. The aim of this study was to obtain more information about the epidemiology of avian P. multocida infection in southwest China and the genetic characteristics of clinical isolates. P. multocida isolates were characterized by biochemical and molecular-biological methods. The distributions of the capsular serogroups, the phenotypic antimicrobial resistance profiles, lipopolysaccharide (LPS) genotyping and the presence of 19 virulence genes were investigated in 45 isolates of P. multocida that were associated with clinical disease in poultry. The genetic diversity of P. multocida strains was performed by 16S rRNA and rpoB gene sequence analysis as well as multilocus sequence typing (MLST). The results showed that most (80.0%) of the P. multocida isolates in this study represented special P. multocida subspecies, and 71.1% of the isolates showed multiple-drug resistance. 45 isolates belonged to capsular types: A (100%) and two LPS genotypes: L1 (95.6%) and L3 (4.4%). MLST revealed two new alleles (pmi77 and gdh57) and one new sequence type (ST342). ST129 types dominated in 45 P. multocida isolates. Isolates belonging to ST129 were with the genes ompH+plpB+ptfA+tonB, whereas ST342 included isolates with fur+hgbA+tonB genes. Population genetic analysis and the MLST results revealed that at least one new ST genotype was present in the avian P. multocida in China. These findings provide novel insights into the epidemiological characteristics of avian P. multocida isolates in southwest China.

  4. [In vitro activity of 12 antibiotics used in veterinary medicine against Mannheimia haemolytica and Pasteurella multocida isolated from calves in the Netherlands].

    Science.gov (United States)

    Mevius, D J; Hartman, E G

    2000-03-01

    Results of susceptibility tests of clinical isolates of animal pathogens are periodically summarized and reported by the Animal Health Service. However, these results are based upon qualitative test methods. In the present paper results of quantitative susceptibility tests of twelve antibacterial agents against Mannheimia haemolytica (MHA) and Pasteurella multocida (PMU) isolated from Dutch calves in 1996 and 1997 are presented. Minimum inhibitory concentrations of amoxicillin, ceftiofur, tetracycline, trimethoprim-sulphamethoxazole, tilmicosin, neomycin, gentamicin, spectinomycin, flumequine, enrofloxacin, chloramphenicol and florfenicol were determined. No resistance was detected for ceftiofur and florfenicol. Three strains had an intermediate susceptibility to tilmicosin. The resistance percentages of MHA and PMU for neomycin, gentamicin, spectinomycin, flumequine, enrofloxacin, and chloramphenicol varied from 2% to 16%. Higher resistance percentages (16%-53%) were observed for amoxicillin, tetracycline, and trimethoprim-sulphamethoxazole. The MIC breakpoints used to determine whether a strain is susceptible, intermediate, or resistant are arbitrary and discussed in this paper.

  5. Mannan-binding lectin (MBL) in two chicken breeds and the correlation with experimental Pasteurella multocida infection

    DEFF Research Database (Denmark)

    Schou, Torben Wilde; Permin, Anders; Christensen, Jens Peter

    2010-01-01

    of the chickens, suggesting that MBL plays an important role against P. multocida. A statistically significant negative correlation was found between the specific antibody response and the genetic serum MBL concentration for both breeds. This indicates that MBL in chickens is capable of acting as the first line...

  6. Efeito do extrato alcoólico de própolis sobre a Pasteurella multocida “in vitro” e em coelhos - DOI: 10.4025/actascianimsci.v26i1.1952 Effect of alcohol extract of propolis on the Pasteurella multocida in vitro and in the rabbits - DOI: 10.4025/actascianimsci.v26i1.1952

    Directory of Open Access Journals (Sweden)

    Hélio Langoni

    2004-04-01

    Full Text Available O ensaio in vitro objetivou avaliar o efeito do álcool PA e de diferentes concentrações (5%, 10% e 15% no Agar, do Extrato Alcoólico de Própolis (EAP, de três regiões do Estado de São Paulo, sobre a Pasteurella multocida, obtida a partir de swab nasal de coelhos. Por meio de outro ensaio, analisou-se o comportamento dessas bactérias em lavado tráqueo-brônquico de coelhos, alimentados com rações contendo álcool PA e diferentes concentrações de EAP (0,1%; 0,2% e 0,3%. O álcool só foi efetivo na inibição do desenvolvimento bacteriano in vitro na concentração mais elevada, enquanto o EAP demonstrou efetividade em todas as concentrações. As amostras de própolis das três regiões não diferiram entre si. No lavado tráqueo-brônquico, o número de Unidades Formadoras de Colônias por mililitro não diferiu entre os tratamentos, porém houve uma tendência de maior efetividade nos tratamentos com EAP em relação ao álcool, acompanhando a ação in vitro.The essay in vitro aimed to evaluate the effect of alcohol and different concentrations (5, 10 and 15% in the agar, of Alcoholic Extract of Propolis (AEP, from three regions of São Paulo State, Brazil, on Pasteurella multocida, obtained from rabbits’ nasal swabs. In other essay the reaction of this bacteria was observed. In tracheal regions of rabbits, fed on diets with alcohol and AEP in different concentrations (0.1; 0.2 and 0.3%. The alcohol was only effective on the inhibition of the bacteria in vitro on highest concentration, while the AEP was effective in all concentrations. The propolis samples from three regions did not differ. In the other assay, there wasn’t any difference between treatments, but the AEP showed to be more active than alcohol against Pasteurella multocida, in the tracheal region of the rabbits, as to the action in vitro.

  7. Pasteurella multocida isolated from wild birds of North America: a serotype and DNA fingerprint study of isolates from 1978 to 1993

    Science.gov (United States)

    Wilson, M.A.; Duncan, R.M.; Nordholm, G.E.; Berlowski, B.M.

    1995-01-01

    Serotype and DNA fingerprint methods were used to study Pasteurella multocida isolated from 320 wild birds of North America. Isolates were collected during 1978-93. The HhaI profiles of 314 isolates matched the HhaI profile of somatic reference type 1, strain X-73; somatic type 1 antigen was expressed by 310 isolates, and the serotype of four isolates was undetected. Differentiation of the 314 isolates was observed by digestion of DNA with HpaII. None of the HpaII profiles matched the HpaII profile of X-73 (designated HhaI 001/HpaII 001). Three HpaII profiles were recognized among the somatic type 1 isolates: HpaII 002 (n = 18), HpaII 003 (n = 122), and HpaII 004 (n = 174). Profile HpaII 002 was found among isolates collected during 1979-83. Profile HpaII 003 was identified from isolates collected during 1979-89, with the exception of two isolates in 1992. The HpaII 004 profile was identified from isolates collected during 1983-93. Of the six remaining isolates, four expressed somatic type 4 and had HhaI profiles identical to the somatic type 4 reference strain P-1662 profile (designated HhaI 004); these isolates were differentiated by digestion of DNA with HpaII. One isolate was identified as serotype F:11, and another was serotype A:3,4. In the present study, 314 of 316 (99.4%) isolates from wild birds in the Central, Mississippi, and Pacific flyways during 1978-93, were P. multocida somatic type 1.

  8. Characterization of Pasteurella multocida associated with ovine pneumonia using multi-locus sequence typing (MLST) and virulence-associated gene profile analysis and comparison with porcine isolates.

    Science.gov (United States)

    García-Alvarez, Andrés; Vela, Ana Isabel; San Martín, Elvira; Chaves, Fernando; Fernández-Garayzábal, José Francisco; Lucas, Domínguez; Cid, Dolores

    2017-05-01

    Pasteurella multocida is a pathogen causing disease in a wide range of hosts including sheep and pigs. Isolates from ovine pneumonia were characterized by MLST (Multi-host and RIRDC databases) and virulence-associated gene (VAG) typing and compared with porcine isolates. Ovine and porcine isolates did not share any STs as determined by both schemes and exhibited different VAG profiles. With the Multi-host database, sixteen STs were identified among 43 sheep isolates with two STs (ST50 and ST19) comprising 53.5% of the isolates, and seven MLST genotypes (ST3, ST11 and ST62 included 75% of the isolates) among the 48 pig isolates. The most frequent VAG profile among sheep isolates was tbpA+/toxA+ (69.8% of isolates) and pfhA+ (62.5%) and hgbB+ (33.3%) among pig isolates. Representative ovine and porcine isolates of those STs identified by the Multi-host scheme were further typed using the RIRDC scheme. Seven STs were identified among the ovine isolates (ST95 RIRDC , ST131 RIRDC , ST203 RIRDC , ST320 RIRDC , ST324 RIRDC , ST321 RIRDC , and ST323 RIRDC ), with the latter four sequence types being new STs identified in this study, and six STs (ST9 RIRDC , ST13 RIRDC , ST27 RIRDC , ST50 RIRDC , and ST74 RIRDC and a new sequence type ST322 RIRDC ) among the porcine isolates. STs identified among ovine isolates have been detected exclusively in small ruminants, suggesting an adaptation to these hosts, while the genotypes identified among pig isolates have been previously identified in multiple hosts and therefore they are not restricted to pigs. The differences in genotypes and VAG profiles between ovine and pig isolates suggest they could represent different subpopulations of P. multocida. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Identificação de transcritos diferencialmente expressos por Pasteurella multocida em condições de privação de ferro

    Directory of Open Access Journals (Sweden)

    Mayara I.V. Silva

    Full Text Available RESUMO: Ferro (Fe é um elemento essencial e a capacidade de adquiri-lo in vivo têm sido descrita em diversos agentes patogênicos através de fatores de virulência. Análises de transcritos durante a privação de Fe tem sido descritos através da técnica de "microarray", entretanto a técnica de RNA-seq recentemente tem demonstrado resultados superiores. Neste trabalho, o isolado de Pasteurella multocida (Pm 16759 altamente patogênico em suínos foi cultivado em duas condições com diferentes concentrações de Fe (controle e privação com o objetivo de analisar transcritos diferencialmente expressos. O RNA total das duas condições foi extraído e sequenciado através da plataforma de nova geração Ion Torrent. Os dados foram analisados no Software Ion Reporter(tm e processados no programa Rockhopper. Foram obtidas 1.341.615 leituras com tamanho médio de 81pb, com 96% de alinhamento com o genoma de Pasteurella multocida subsp. multocida 3480 e 98,8% de acurácia. No mapeamento das leituras das duas condições, observou-se 2,652 transcritos e destes, 177 (6,7% foram diferencialmente expressos, sendo 93 na condição controle (Fe+ e 84 na condição de privação (Fe-. Na condição de privação de Fe, o perfil de transcritos foram associados a função de transporte celular (fbp ABC, permease de alta afinidade com Fe2+/Pb2+ e proteína periplasmática de alta afinidade com Fe2+ , reguladores transcricionais e proteínas hipotéticas. O perfil na condição controle (Fe+ apresentou transcritos diferencialmente expressos associados ao RNAs anti-sense (asRNA e genes do metabolismo energético (fructose-1,6-bisfosfatase. O estudo comprovou que a restrição de Fe aumenta a expressão de genes envolvidos no transporte celular, reguladores transcricionais, proteínas hipotéticas e desconhecidas e permitiu ainda a identificação de novos genes como a permease de alta afinidade com Fe2+/Pb2+ e proteina periplasmática de alta afinidade

  10. Ocorrência de genes tad associados à formação de biofilme em isolados de Pasteurella multocida de pulmões de suínos com pneumonia

    OpenAIRE

    Moraes, Danny Franciele da S.D.; Brandão, Laila Natasha S.; Pitchenin, Leticia C.; O. Filho, João Xavier; Morés, Nelson; Nakazato, Luciano; Dutra, Valéria

    2014-01-01

    Os atuais sistemas de criação intensiva de suínos aumentam a pressão de seleção microbiana propiciando a disseminação de doenças respiratórias. A bactéria Pasteurella multocida é associada a diversas patologias respiratórias em animais submetidos a esse tipo de criação, causando grandes perdas econômicas. A formação de biofilme foi descrita in vitro em P. multocida e fatores analisados indicaram a facilitação na colonização dos tecidos, aumentando a resistência às defesas do hospedeiro e aos ...

  11. Feeding of waste milk to Holstein calves affects antimicrobial resistance of Escherichia coli and Pasteurella multocida isolated from fecal and nasal swabs.

    Science.gov (United States)

    Maynou, G; Bach, A; Terré, M

    2017-04-01

    The use of milk containing antimicrobial residues in calf feeding programs has been shown to select for resistant fecal Escherichia coli in dairy calves. However, information is scarce about the effects of feeding calves waste milk (WM) on the prevalence of multidrug-resistant bacteria. The objective of this study was to determine the antimicrobial resistance patterns of fecal E. coli and nasal Pasteurella multocida isolates from calves fed either milk replacer (MR) or WM in 8 commercial dairy farms (4 farms per feeding program). Fecal and nasal swabs were collected from 20 ± 5 dairy calves at 42 ± 3.2 d of age, and from 10 of these at approximately 1 yr of age in each study farm to isolate the targeted bacteria. Furthermore, resistance of E. coli isolates from calf-environment and from 5 calves at birth and their dams was also evaluated in each study farm. Resistances were tested against the following antimicrobial agents: amoxicillin-clavulanic acid, ceftiofur, colistin, doxycycline (DO), enrofloxacin (ENR), erythromycin, florfenicol, imipenem, and streptomycin. A greater number of fecal E. coli resistant to ENR, florfenicol, and streptomycin and more multidrug-resistant E. coli phenotypes were isolated in feces of calves fed WM than in those fed MR. However, the prevalence of fecal-resistant E. coli was also influenced by calf age, as it increased from birth to 6 wk of age for ENR and DO and decreased from 6 wk to 1 yr of age for DO regardless of the feeding program. From nasal samples, an increase in the prevalence of colistin-resistant P. multocida was observed in calves fed WM compared with those fed MR. The resistance patterns of E. coli isolates from calves and their dams tended to differ, whereas similar resistance profiles among E. coli isolates from farm environment and calves were observed. The findings of this study suggest that feeding calves WM fosters the presence of resistant bacteria in the lower gut and respiratory tracts of dairy calves

  12. Utilización de lectinas en la inhibición de la adhesión de Pasteurella multocida

    Directory of Open Access Journals (Sweden)

    Magda Patricia Carrillo Lamus

    2013-06-01

    Full Text Available El primer paso de la infección es la adhesión de los organismos patógenos a las células blanco. Esta característica les permite no solo penetrar y desplegar las estrategias ofensivas para iniciar la colonización, sino contribuir a la protección y el resguardo de estos a los mecanismos de defensa tanto inmunológicos como mecánicos del hospedero. Este proceso se lleva a cabo en gran medida por la interacción de lectinas, que son proteínas de origen no inmune con la capacidad de reconocer y aglutinar carbohidratos. Este mecanismo ha sido reportado para muchos microorganismos como virus y bacterias. En el caso particular de la Pasteurella multocida, que es una bacteria gramnegativa, patógena oportunista, que inicia la infección en el epitelio respiratorio de muchos animales, se han descrito sobre su superficie sustancias lectinas como la fimbria tipo IV y carbohidratos como el lipopolisacárido o la cápsula que reconocen carbohidratos y lectinas, respectivamente, sobre la superficie de las células epiteliales del tubo respiratorio, circunstancia que le permite adherirse y resguardarse del efecto mucociliar. Debido a que para la gran mayoría de estos microorganismos —incluida P. multocida— es evidente la disminución de la susceptibilidad a los antibacterianos y a la efectividad de las vacunas, se han buscado nuevas tácticas terapéuticas y profilácticas con el fin de interrumpir la infección de los patógenos por medio del bloqueo por competencia de la unión carbohidratos-lectina, donde se ve disminuida la unión del microorganismo al tejido y, por consiguiente, la infección.

  13. Demonstration that Australian Pasteurella multocida isolates from sporadic outbreaks of porcine pneumonia are non-toxigenic (toxA-) and display heterogeneous DNA restriction endonuclease profiles compared with toxigenic isolates from herds with progressive atrophic rhinitis.

    Science.gov (United States)

    Djordjevic, S P; Eamens, G J; Ha, H; Walker, M J; Chin, J C

    1998-08-01

    Capsular types A and D of Pasteurella multocida cause economic losses in swine because of their association with progressive atrophic rhinitis (PAR) and enzootic pneumonia. There have been no studies comparing whole-cell DNA profiles of isolates associated with these two porcine respiratory diseases. Twenty-two isolates of P. multocida from diseased pigs in different geographic localities within Australia were characterised genotypically by restriction endonuclease analysis (REA) with the enzyme CfoI. Seven of 12 P. multocida isolates from nasal swabs from pigs in herds where PAR was either present or suspected displayed a capsular type D phenotype. These were shown to possess the toxA gene by polymerase chain reaction (PCR) and Southern hybridisation, and further substantiated by production of cytotoxin in vitro. The CfoI profile of one of these seven isolates, which was from the initial outbreak of PAR in Australia (in Western Australia, WA), was identical with profiles of all six other toxigenic isolates from sporadic episodes in New South Wales (NSW). The evidence suggests that the strain involved in the initial outbreak was responsible for the spread of PAR to the eastern states of Australia. Another 10 isolates, representing both capsular types A and D, were isolated exclusively from porcine lung lesions after sporadic outbreaks of enzootic pneumonia in NSW and WA. CfoI restriction endonuclease profiles of these isolates revealed considerable genomic heterogeneity. Furthermore, none of these possessed the toxA gene. This suggests that P. multocida strains with the toxA gene do not have a competitive survival advantage in the lower respiratory tract or that toxin production does not play a role in the pathology of pneumonic lesions, or both. REA with polyacrylamide gel electrophoresis and silver staining was found to be a practical and discriminatory tool for epidemiological tracing of P. multocida outbreaks associated with PAR or pneumonia in pigs.

  14. One-Step Multiplex RT-qPCR Assay for the detection of Peste des petits ruminants virus, Capripoxvirus, Pasteurella multocida and Mycoplasma capricolum subspecies (ssp.) capripneumoniae

    International Nuclear Information System (INIS)

    Settypalli, T.B.K.; Lamien, C.; Spergser, J.; Lelenta, M.; Wade, A.; Gelaye, E.; Loitsch, A.; Minoungou, G.; Thiaucourt, F.; Diallo, A.

    2016-01-01

    Full text: Respiratory infections, although showing common clinical symptoms like pneumonia, are caused by bacterial, viral or parasitic agents. These are often reported in sheep and goats populations and cause huge economic losses to the animal owners in developing countries. Detection of these diseases is routinely done using ELISA or microbiological methods which are being reinforced or replaced by molecular based detection methods including multiplex assays, where detection of different pathogens is carried out in a single reaction. In the present study, a one-step multiplex RT-qPCR assay was developed for simultaneous detection of Capripoxvirus (CaPV), Peste de petits ruminants virus (PPRV), Pasteurella multocida (PM) and Mycoplasma capricolum ssp. capripneumonia (Mccp) in pathological samples collected from small ruminants with respiratory disease symptoms. The test performed efficiently without any cross-amplification. The multiplex PCR efficiency was 98.31%, 95.48%, 102.77% and 91.46% whereas the singleplex efficiency was 93.43%, 98.82%, 102.55% and 92.0% for CaPV, PPRV, PM and Mccp, respectively. The correlation coefficient was greater than 0.99 for all the targets in both multiplex and singleplex. Based on cycle threshold values, intra and inter assay variability, ranged between the limits of 2%–4%, except for lower concentrations of Mccp. The detection limits at 95% confidence interval (CI) were 12, 163, 13 and 23 copies/reaction for CaPV, PPRV, PM and Mccp, respectively. The multiplex assay was able to detect CaPVs from all genotypes, PPRV from the four lineages, PM and Mccp without amplifying the other subspecies of mycoplasmas. The discriminating power of the assay was proven by accurate detection of the targeted pathogen (s) by screening 58 viral and bacterial isolates representing all four targeted pathogens. Furthermore, by screening 81 pathological samples collected from small ruminants showing respiratory disease symptoms, CaPV was detected in

  15. One-Step Multiplex RT-qPCR Assay for the Detection of Peste des petits ruminants virus, Capripoxvirus, Pasteurella multocida and Mycoplasma capricolum subspecies (ssp. capripneumoniae.

    Directory of Open Access Journals (Sweden)

    Tirumala Bharani Kumar Settypalli

    Full Text Available Respiratory infections, although showing common clinical symptoms like pneumonia, are caused by bacterial, viral or parasitic agents. These are often reported in sheep and goats populations and cause huge economic losses to the animal owners in developing countries. Detection of these diseases is routinely done using ELISA or microbiological methods which are being reinforced or replaced by molecular based detection methods including multiplex assays, where detection of different pathogens is carried out in a single reaction. In the present study, a one-step multiplex RT-qPCR assay was developed for simultaneous detection of Capripoxvirus (CaPV, Peste de petits ruminants virus (PPRV, Pasteurella multocida (PM and Mycoplasma capricolum ssp. capripneumonia (Mccp in pathological samples collected from small ruminants with respiratory disease symptoms. The test performed efficiently without any cross-amplification. The multiplex PCR efficiency was 98.31%, 95.48%, 102.77% and 91.46% whereas the singleplex efficiency was 93.43%, 98.82%, 102.55% and 92.0% for CaPV, PPRV, PM and Mccp, respectively. The correlation coefficient was greater than 0.99 for all the targets in both multiplex and singleplex. Based on cycle threshold values, intra and inter assay variability, ranged between the limits of 2%-4%, except for lower concentrations of Mccp. The detection limits at 95% confidence interval (CI were 12, 163, 13 and 23 copies/reaction for CaPV, PPRV, PM and Mccp, respectively. The multiplex assay was able to detect CaPVs from all genotypes, PPRV from the four lineages, PM and Mccp without amplifying the other subspecies of mycoplasmas. The discriminating power of the assay was proven by accurate detection of the targeted pathogen (s by screening 58 viral and bacterial isolates representing all four targeted pathogens. Furthermore, by screening 81 pathological samples collected from small ruminants showing respiratory disease symptoms, CaPV was detected in

  16. Specific detection of Pasteurella multocida in chickens with fowl cholera and in pig lung tissues using fluorescent rRNA in situ hybridization

    DEFF Research Database (Denmark)

    Mbuthia, P.G.; Christensen, H.; Boye, Mette

    2001-01-01

    in formalin-fixed paraffin-embedded lung tissues from experimental fowl cholera in chickens and infections in pigs. In chicken lung tissues P. multocida cells were detected singly, in pairs, as microcolonies, and as massive colonies within air capillaries (septa and lumen), parabronchial septa, and blood...... and fast method for specific detection of P. multocida in histological formalin-fixed tissues. The test was replicable and reproducible and is recommended as a supplementary test for diagnosis and as a tool in pathogenesis studies of fowl cholera and respiratory tract infections in pigs due to P. multocida....

  17. Comparison of gene expression of Toll-like receptors and cytokines between Piau and Commercial line (Landrace×Large White crossbred) pigs vaccinated against Pasteurella multocida type D.

    Science.gov (United States)

    Sousa, Katiene Régia Silva; Ribeiro, André Mauric Frossard; Dantas, Waleska de Melo Ferreira; Oliveira, Leandro Licursi de; Gasparino, Eliane; Guimarães, Simone Eliza Facioni

    2017-10-01

    We aimed to compare Toll-like receptors (TLR) and cytokines expression in local Piau breed and a Commercial line (Landrace×Large White crossbred) pigs in response to vaccination against Pasteurella multocida type D. Seronegative gilts for Pasteurella multocida type D and Mycoplasma hyopneumoniae were used, from which peripheral blood mononuclear cells (PBMC) were collected in four time points (T0, T1, T2 and T3; before and after each vaccination dose). For bronchoalveolar lavage fluid cells (BALF), we set groups of vaccinated and unvaccinated animals for both genetic groups. Gene expression was evaluated on PBMC and BALF. In PBMC, when we analyzed time points within breeds, significant differences in expression for TLRs and cytokines, except TGFβ, were observed for Commercial animals. For the Piau pigs, only TGFβ showed differential expression. Comparing the expression among genetic groups, the Commercial pigs showed higher expression for TLRs after first vaccination dose, while for IL2, IL6, IL12 and IL13, higher expression was also observed in T3 and IL8 and IL10, in T1 and T3. Still comparing the breeds, the crossbred animals showed higher expression for TNFα in T1 and T2, while for TGFβ only in T2. For gene expression in BALF, vaccinated Commercial pigs showed higher expression of TLR6, TLR10, IL6, IL8, IL10, TNFα and TGFβ genes than vaccinated Piau pigs. The Commercial line pigs showed higher sensitivity to vaccination, while in local Piau breed lower responsiveness, which may partly explain genetic variability in immune response and will let us better understand the tolerance/susceptibility for pasteurellosis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. The ability of lipopolysaccharide (LPS) of Pasteurella multocida B:2 to induce clinical and pathological lesions in the nervous system of buffalo calves following experimental inoculation.

    Science.gov (United States)

    Marza, Ali Dhiaa; Jesse Abdullah, Faez Firdaus; Ahmed, Ihsan Muneer; Teik Chung, Eric Lim; Ibrahim, Hayder Hamzah; Zamri-Saad, Mohd; Omar, Abdul Rahman; Abu Bakar, Md Zuki; Saharee, Abdul Aziz; Haron, Abdul Wahid; Alwan, Mohammed Jwaid; Mohd Lila, Mohd Azmi

    2017-03-01

    Lipopolysaccharide (LPS) of P. multocida B:2, a causative agent of haemorrhagic septicaemia (HS) in cattle and buffaloes, is considered as the main virulence factor and contribute in the pathogenesis of the disease. Recent studies provided evidences about the involvement of the nervous system in pathogenesis of HS. However, the role of P. multocida B:2 immunogens, especially the LPS is still uncovered. Therefore, this study was designed to investigate the role of P. multocida B:2 LPS to induce pathological changes in the nervous system. Nine eight-month-old, clinically healthy buffalo calves were used and distributed into three groups. Calves of Group 1 and 2 were inoculated orally and intravenously with 10 ml of LPS broth extract represent 1 × 10 12  cfu/ml of P. multocida B:2, respectively, while calves of Group 3 were inoculated orally with 10 ml of phosphate buffer saline as a control. Significant differences were found in the mean scores for clinical signs, post mortem and histopathological changes especially in Group 2, which mainly affect different anatomic regions of the nervous system, mainly the brain. On the other hand, lower scores have been recorded for clinical signs, gross and histopathological changes in Group 1. These results provide for the first time strong evidence about the ability of P. multocida B:2 LPS to cross the blood brain barrier and induce pathological changes in the nervous system of the affected buffalo calves. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Phenotypic variability among strains of Pasteurella multocida ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-05-02

    May 2, 2008 ... Available online at http://www.academicjournals.org/AJB. ISSN 1684–5315 ... extended phenotypic characterization methods supported by DNA ... septicaemia African (Obudu) strain (E:2) which are currently employed as ...

  20. Combinations of macrolide resistance determinants in field isolates of Mannheimia haemolytica and Pasteurella multocida

    DEFF Research Database (Denmark)

    Desmolaize, Benoit; Rose, Simon; Wilhelm, Cornelia

    2011-01-01

    of these species exhibit resistance to veterinary macrolides with phenotypes that fall into three distinct classes. The first class has type I macrolide, lincosamide, and streptogramin B antibiotic resistance and, consistent with this, the 23S rRNA nucleotide A2058 is monomethylated by the enzyme product......(E) genes within an isogenic Escherichia coli background to assess their individually contributions to resistance. Our findings indicate what types of compounds might have driven the selection for these resistance determinants....

  1. Pasteurella aerogenes as an Asymptomatic Bacteriuria Agent.

    Science.gov (United States)

    Alaygut, Demet; Engin, Aynur

    2018-02-01

    'Asymptomatic bacteriuria' (ASB) is isolation of a specified quantitative count of bacteria in an appropriately collected urine specimen obtained from a person without symptoms or signs referable to urinary infection. Catheterized specimens are less likely to be contaminated compared with voided specimens; therefore, positive cultures of catheterized specimens are more likely to reflect true bladder bacteriuria even with low colony counts. The common pathogens for ASB are Escherichia coli, Klebsiella and Streptococcus spp. Pasteurella spp. was not previously reported as an ASB agent. ASB is important for pregnant women, children, individuals with obstructive uropathy, chronic renal failure and neutropenia, before the urologic procedures and after renal transplantation. Treatment of ASB is required for above situations. We report an 11-year-old-girl with neurogenic bladder who made clean intermittent catheterization and had Pasteurella aerogenes as an ASB agent. © The Author [2017]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  2. 9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

  3. Gamma-Irradiated Mannheimia (Pasteurella) Haemolytica Identified by rRNA Gene Sequencing as a Potential Vaccine in Mice

    International Nuclear Information System (INIS)

    Araby, E.

    2014-01-01

    Pneumonic pasteurellosis is a significant disease in beef production medicine. The most information suggests that this disease is a $700 million dollar per year economic burden in bovine food animal production. The current study was designed to assess the immune efficacy of whole cell killed of M. haemolytica strain from satisfactory cases (infected lung from sheep). The efficacy of gamma- irradiated M. haemolytica vaccine (GIV) was evaluated in mice in comparison to the classical aqueous formalized (AFV) one. The bacteria under study were cultivation on blood agar, purification and genetically identified. Then the bacterial cells were exposed to different doses of gamma radiation (2- 20 kGy) with 2 kGy intervals and the dose response curve of the survivors was plotted and 20 kGy was selected as the dose for the preparation of the vaccine. A total of 30 male mice (two weeks – old) were used for the further experimental investigations. Animals were divided into three equal groups each of 10 animals. The first group (group A) was given GIV . The second group (group B) received AFV. The third group (group C) was injected with sterile saline solution and represents the control. Animals were vaccinated via intraperitoneal (i.p) injection with 1x10 8 CFU per treated mouse. After vaccination, the immuno response was determined by cellular surface antigens-reactive antibodies using a modified protein- electrophoresis procedure. Antibody-antigen hybrids was visualized at molecular weight more than 225 KDa in samples represented M. haemolytica antibodies group (A, B) against both bacterial samples (M. haemolytica and Pasteurella multocida ) , while non-treated bacterial cells in which cells incubated with serum of mice group (C) revealed no hybridization reaction, this results verify that, there is shared cellular surface antigens among the two Pasteurella species. Also, the bacterial distribution with (LD 50 ) 2x10 7 CFU of a live M. heamolytica into vaccinated and non

  4. A Pasteurella multocida sialyltransferase displaying dual trans-sialidase activities for production of 3′-sialyl and 6′-sialyl glycans

    DEFF Research Database (Denmark)

    Guo, Yao; Jers, Carsten; Meyer, Anne S.

    2014-01-01

    /Kmvalue for the enzyme using 3-sialyllactose as the donor for 6-sialyllactose synthesis at pH 5.4 and 40◦Cwas determined to be 23.22 ± 0.7 M−1s−1. Moreover, the enzyme was capable of catalyzing the synthesisof both 3- and 6-sialylated galactooligosaccharides, when galactooligosaccharides served as acceptors....

  5. Una alabarda procedente del valle del Manzanares (Madrid

    Directory of Open Access Journals (Sweden)

    Miguel Ángel de BLAS CORTINA

    2009-12-01

    Full Text Available RESUMEN: Se estudia una alabarda metálica procedente —sin datos precisos de su localización— del valle del Manzanares (Madrid. Posiblemente apareciera con otros materiales (¿puntas Palmela?, pero el hecho no pudo ser comprobado. Fundida en un molde monovalvo que proporciona un acabado homogéneo a una sola de las caras, se integra metalúrgicamente en el grupo E 01 (cobres arsenicales propio de la Península Ibérica durante el Calcolítico y el Bronce Antiguo. Tipológicamente puede ser clasificada como integrante del grupo Carrapatas al que pertenecen un conjunto de alabardas procedentes del N.E. de Portugal (Bragança y Tras os Montes del que se conocen escasos testimonios fuera del área característica. Especialmente significativo es el hallazgo de la finca de la Paloma (Pantoja, Toledo que muestra la asociación entre las alabardas Carrapatas y elementos propios del campaniforme tardío de España y Portugal, circunstancia que permite fechar el tipo entre el 1700-1500 a. de J.C., datación similar a las fechas admitidas para las alabardas irlandesas con las que algunos autores ven posibles relaciones. La existencia de alabardas grabadas en estelas más tardías o en rocas al aire libre plantea el problema de su perduración. No obstante, el carácter simbólico de las armas grabadas puede hacer que sea solamente la imagen representada la que superviva, aunque el arma como tal haya perdido vigencia. La alabarda del Manzanares, junto con las de Pantoja, señala la presencia en la Meseta Sur de elementos metalúrgicos propios del N.W. de la Península en un momento sincrónico con las fases finales del campaniforme.ABSTRACT: We study a metallic halberd found in an indeterminate place in the valley of the river Manzanares (Madrid. It might have appeared with other materials (Palmela Points?, although this fact could not be confirmed. Made in a single-faced mould which allows a homogeneous finish to only one of the sides, it belongs from

  6. Pasteurella haemolytica bacteriophage: identification, partial characterization, and relationship of temperate bacteriophages from isolates of Pasteurella haemolytica (biotype A, serotype 1)

    International Nuclear Information System (INIS)

    Richards, A.B.; Renshaw, H.W.; Sneed, L.W.

    1985-01-01

    Pasteurella haemolytica (biotype A, serotype 1) isolates (n = 15) from the upper respiratory tract of clinically normal cattle, as well as from lung lesions from cases of fatal bovine pasteurellosis, were examined for the presence of bacteriophage after irradiation with UV light. Treatment of all P haemolytica isolates with UV irradiation resulted in lysis of bacteria due to the induction of vegetative development of bacteriophages. The extent of growth inhibition and bacterial lysis in irradiated cultures was UV dose-dependent. Bacterial cultures exposed to UV light for 20 s reached peak culture density between 60 and 70 minutes after irradiation; thereafter, culture density declined rapidly, so that by 120 minutes, it was approximately 60% of the original value. When examined ultrastructurally, lytic cultures from each isolate revealed bacteriophages with an overall length of approximately 200 nm and that appeared to have a head with icosahedral symmetry and a contractile tail. Cell-free filtrate from each noninduced bacterial isolate was inoculated onto the other bacterial isolates in a cross-culture sensitivity assay for the presence of phages lytic for the host bacterial isolates. Zones of lysis (plaques) did not develop when bacterial lawns grown from the different isolates were inoculated with filtrates from the heterologous isolates

  7. Mortalidad por meningitis por Pasteurella canis. Oportunidades de aprendizaje

    Directory of Open Access Journals (Sweden)

    Ana Rosa Ropero Vera

    2016-01-01

    Full Text Available La meningitis bacteriana es una enfermedad importante de distribución mundial, causa mayor y sustancial de mortalidad y morbilidad en países en desarrollo. La Organización Mundial de la Salud (OMS sostiene que la meningitis es una de las diez afecciones principales del ser humano y debe ser considerada como una emergencia infectológica; por eso es fundamental reconocer que esta enfermedad es causa de muerte en niños de todo el mundo, sin distinción de raza, nivel económico o sociocultural. Se realizó una investigación de caso en menor de 53 días de nacido, que cumplía con los criterios clínicos y de laboratorio compatible con meningitis bacteriana, con el propósito de analizar y fortalecer la toma de decisiones en salud pública por parte de la secretaría local de salud del municipio de Valledupar (Colombia. Entre los hallazgos se encontró antecedentes infecciosos en el menor, coloración de Gram y cultivo de LCR, en el que se identificó cocobacilos Gram negativos, que fueron aislados como agente causal Pasteurella canis. Este estudio pretende sensibilizar a los prestadores de salud para que cuenten con personal altamente capacitado para brindar tratamientos adecuados y prevenir complicaciones en la meningitis bacteriana en niños, y así disminuir la posibilidad de secuelas o muerte, tanto en pacientes con compromiso inmunológico o sin este.

  8. [Pasteurella] caballi infection not limited to horses - a closer look at taxon 42 of Bisgaard

    DEFF Research Database (Denmark)

    Christensen, Henrik; Hommez, J.; Olsen, John Elmerdahl

    2006-01-01

    Aim To investigate if taxon 42 of Bisgaard isolated from pigs represents genuine [Pasteurella] caballi which has previously only been isolated from horses. Methods and Results A total of 15 field isolates from horses and pigs from 5 different countries representing three continents were to subjec...

  9. Pasteurella testudinis associated with respiratory disease and septicaemia in leopard (Geochelone pardalis and other tortoises in South Africa

    Directory of Open Access Journals (Sweden)

    M.M. Henton

    2003-07-01

    Full Text Available The first recorded isolates of Pasteurella testudinis from South African tortoises kept in captivity is presented. P. testudinis was found in association with respiratory disease in affected animals.

  10. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  11. Virulencia de cepas de Listeria monocytogenes procedentes de cabras y sus derivados

    OpenAIRE

    Guicela Ramírez Bernal; Alma Virginia Lara Sagahón; Carlos Gerardo García Tovar; Efrén Díaz Aparicio; Víctor Rubén Tenorio Gutiérrez

    2014-01-01

    Se evaluó la virulencia de cepas de Listeria monocytogenes todas de serotipo 4b procedentes de cabras y sus derivados. Se observaron niveles de virulencia variables cuando se comparó la virulencia relativa (porcentaje de letalidad) en ratones BALB/c inoculados vía intravenosa o intragástrica y su capacidad para infectar macrófagos J774A.1, y células epiteliales Caco-2. Dos cepas obtenidas de alimento de cabras produjeron 100 % de letalidad por ambas vías de inoculación y no mostraron diferenc...

  12. Clonal outbreaks of [ Pasteurella] pneumotropica biovar Heyl in two mouse colonies

    DEFF Research Database (Denmark)

    Adhikary, Sadhana; Bisgaard, Magne; Dagnæs-Hansen, Frederik

    2017-01-01

    The aim of this study was to document the pathogenic role of biovar Heyl of [Pasteurella] pneumotropica in mouse colonies. Fifty-three isolates associated with mastitis and orbital, cutaneous and vaginal abscesses as well as isolates from the nose and vagina of healthy mice were investigated...... strains with the same rpoB sequence type, as shown by the PFGE profiles. The investigation documented that members of biovar Heyl of [P.] pneumotropica caused disease outbreaks in mouse colonies since the clonality indicated a primary role of [P.] pneumotropica biovar Heyl in the infections observed....

  13. Efforts towards the development of recombinant Vaccines against ...

    African Journals Online (AJOL)

    Hemorrhagic septicemia is caused by gram-negative bacterium of Pasteurella multocida (P. multocida) strains. Most of the current vaccines against P. multocida have shortcomings. Presently, there is increasing efforts towards construction of recombinant clone for vaccine development against P. multocida. In this review an ...

  14. Efforts Towards The Development Of Recombinant Vaccines Against

    African Journals Online (AJOL)

    ABSTRACT. Hemorrhagic septicemia is caused by gram-negative bacterium of Pasteurella multocida (P. multocida) strains. Most of the current vaccines against P. multocida have shortcomings. Presently, there is increasing efforts towards construction of recombinant clone for vaccine development against P. multocida.

  15. Fatal Pasteurella haemolytica pneumonia in bighorn sheep after direct contact with clinically normal domestic sheep.

    Science.gov (United States)

    Foreyt, W J

    1989-03-01

    Six Rocky Mountain bighorn sheep were raised in captivity from birth (n = 5) or taken from the wild as a lamb (n = 1). After the bighorn sheep were in captivity for over a year, 6 clinically normal domestic sheep were placed on the 2 ha of pasture on which the bighorn sheep were kept. Nasal swab specimens were obtained from all sheep at the time the domestic sheep were introduced. Pasteurella haemolytica was isolated from swab specimens obtained from 4 of 6 domestic sheep, but not from specimens obtained from the bighorn sheep. All 6 bighorn sheep died of acute hemorrhagic pneumonia after exposure to domestic sheep. Death in the bighorn sheep occurred on days 4, 27, 27, 29, 36, or 71 after initial exposure to domestic sheep. Pasteurella haemolytica was isolated from respiratory tract tissue specimens of all bighorn sheep at the time of death. None of the domestic sheep were clinically ill during the study. At the end of the study, 3 of 6 domestic sheep were euthanatized, and at necropsy, P haemolytica was isolated from 2 of them. The most common serotypes in bighorn and domestic sheep were P haemolytica T-3 and A-2. Other serotypes isolated included P haemolytica A-1, A-9, and A-11 in bighorn sheep and A-1 in domestic sheep. On the basis of results of this study and of other reports, domestic sheep and bighorn sheep should not be managed in proximity to each other because of the potential fatal consequences in bighorn sheep.

  16. Fatal pneumonia following inoculation of healthy bighorn sheep with Pasteurella haemolytica from healthy domestic sheep.

    Science.gov (United States)

    Foreyt, W J; Snipes, K P; Kasten, R W

    1994-04-01

    In a series of three experiments, isolates of Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1, from healthy domestic sheep, were inoculated intratracheally into eight bighorn sheep (Ovis canadensis canadensis) and seven domestic sheep with doses of bacteria ranging from 5.3 x 10(8) to 8.6 x 10(11) colony forming units. Seven of eight inoculated bighorn sheep died from acute pneumonia within 48 hr of inoculation, whereas all seven domestic sheep inoculated with comparable or greater doses of bacteria remained healthy. One contact control bighorn sheep also died 6 days after its penmates received P. haemolytica. Three other noncontact control bighorn sheep remained healthy during the experiments. Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1 in the inocula was recovered from one or more tissues from all bighorns that died; whereas, it was not detected in any bighorn sheep before inoculation. Three different ribotypes of P. haemolytica A2 were recovered from bighorn sheep; however, only the ribotype reference WSU-1 in the domestic sheep-origin inoculum was recovered from all dead bighorn sheep, and was not recovered from bighorn sheep that survived the experiments. Thus, a relatively nonpathogenic and common isolate of P. haemolytica from healthy domestic sheep was lethal in bighorn sheep under experimental conditions.

  17. Phenotypic and genotypic characterization of Mannheimia (Pasteurella) haemolytica-like strains isolated from diseased animals in Denmark

    DEFF Research Database (Denmark)

    Angen, Øystein; Ahrens, Peter; Bisgaard, M.

    2002-01-01

    Trehalose-negative strains of the Pasteurella haemolytica complex have recently been transferred to a new genus, Mannheimia. This genus presently consists of five named species: M. haemolytica, M. glucosida, M. granulomatis, M. ruminalis and M. varigena. The purpose of this study was to investigate...

  18. Outbreak of Pasteurella pneumotropica in a closed colony of STOCK-Cd28(tm1Mak) mice

    DEFF Research Database (Denmark)

    Artwohl, J.E.; Flynn, J.C.; Bunte, R.M.

    2000-01-01

    Fifteen mice with Pasteurella pneumotropica orbital abscesses were noted in mice that were homozygous for a targeted Cd28 gene mutation. Only one mouse heterozygous for the Cd28 mutation was affected. According to phenotypic reactions and 16S rDNA sequencing, the isolates were most similar to bio...

  19. 鸭多杀性巴氏杆菌外膜蛋白A基因表达及抗原性鉴定%Cloning and Expression of the omp A Gene of pasteurella multocida

    Institute of Scientific and Technical Information of China (English)

    孙龚; 郭东春; 刘家森; 姜骞; 司昌德; 林欢; 韩凌霞; 崔玉东; 曲连东

    2010-01-01

    根据已发表的Pm 70株的序列(GenBank登录号:AE004439)设计了两对引物,用PCR方法扩增了鸭多杀性巴氏杆菌标准株C48-102的外膜蛋白基因A(omp A),扩增的片段为1 062 bp.将测序结果与GenBank中多杀性巴氏杆菌P52、PM 70、T931317、194289的omp A序列比对结果表明,核苷酸水平上同源性为89.0%~98.9%;在氨基酸水平上同源性为90.7%~99.2%.全omp A序列在大肠杆菌中干扰蛋白的正常表达,因此截断omp A蛋白的信号肽序列,将去信号肽的omp A基因插入到pPRO-EX-Htb载体上,构建了原核表达载体Htb-omp A,转化BL21,并诱导表达,SDS-PAGE结果表明,表达蛋白约为35 kDa,与预期的分子量大小相符.Western-blot结果表明,表达的蛋白具有良好的抗原活性.本研究重组蛋白omp A的获得,为敲除omp A基因多杀性巴氏杆菌突变株的血清学检测奠定基础.

  20. Virulencia de cepas de Listeria monocytogenes procedentes de cabras y sus derivados

    Directory of Open Access Journals (Sweden)

    Guicela Ramírez Bernal

    2014-01-01

    Full Text Available Se evaluó la virulencia de cepas de Listeria monocytogenes todas de serotipo 4b procedentes de cabras y sus derivados. Se observaron niveles de virulencia variables cuando se comparó la virulencia relativa (porcentaje de letalidad en ratones BALB/c inoculados vía intravenosa o intragástrica y su capacidad para infectar macrófagos J774A.1, y células epiteliales Caco-2. Dos cepas obtenidas de alimento de cabras produjeron 100 % de letalidad por ambas vías de inoculación y no mostraron diferencia significativa con la cepa testigo (P>0.05 respecto al porcentaje de invasión y a los parámetros de la cinética de crecimiento cuadrática observada en ambas líneas celulares. Si bien todas las cepas lograron invadir las células Caco-2, solamente algunas consiguieron invadir el bazo después de la inoculación por vía intragástrica. Las dos cepas provenientes de alimento de cabras fueron las más virulentas, representando un riesgo para la salud humana y animal, ya que pueden ser diseminadas en el hato y de este a otras explotaciones o a las instalaciones donde se elaboran alimentos.

  1. Un vaso de alabastro procedente de Adra conservado en el Museo de Almería

    Directory of Open Access Journals (Sweden)

    García Alfonso, Eduardo

    1998-12-01

    Full Text Available A previously unpublished alabaster jar from Adra, a coastal site some 50 km to the west of Almería is yet another example of a numerous class of Egyptian containers of the 8th-7th centuries BC discovered on the southern coast of the Iberian Peninsula. A casual find, the funerary character of this piece suggests that there may have been a cemetery of the Early Phoenician Period in the immediate neighbourhood of the colonial settlement of Abdera.Se estudia un vaso de alabastro inédito procedente de la localidad almeriense de Adra, pieza que se añade a la ya numerosa serie de recipientes de origen egipcio conocida en las costas meridionales de la Península durante los siglos VIII-VII a.C. El principal interés de este hallazgo casual radica en su carácter funerario, siendo indicio de una posible necrópolis de época fenicia arcaica en las inmediaciones del asentamiento colonial de Abdera.

  2. Elimination of Pasteurella pneumotropica from a Mouse Barrier Facility by Using a Modified Enrofloxacin Treatment Regimen

    Science.gov (United States)

    Towne, Justin W; Wagner, April M; Griffin, Kurt J; Buntzman, Adam S; Frelinger, Jeffrey A; Besselsen, David G

    2014-01-01

    Multiple NOD.Cg-Prkdcscid Il2rgtm1WjlTg(HLA-A2.1)Enge/Sz (NSG/A2) transgenic mice maintained in a mouse barrier facility were submitted for necropsy to determine the cause of facial alopecia, tachypnea, dyspnea, and sudden death. Pneumonia and soft-tissue abscesses were observed, and Pasteurella pneumotropica biotype Jawetz was consistently isolated from the upper respiratory tract, lung, and abscesses. Epidemiologic investigation within the facility revealed presence of this pathogen in mice generated or rederived by the intramural Genetically Engineered Mouse Model (GEMM) Core but not in mice procured from several approved commercial vendors. Epidemiologic data suggested the infection originated from female or vasectomized male ND4 mice obtained from a commercial vendor and then comingled by the GEMM Core to induce pseudopregnancy in female mice for embryo implantation. Enrofloxacin delivered in drinking water (85 mg/kg body weight daily) for 14 d was sufficient to clear bacterial infection in normal, breeding, and immune-deficient mice without the need to change the antibiotic water source. This modified treatment regimen was administered to 2400 cages of mice to eradicate Pasteurella pneumotropica from the facility. Follow-up PCR testing for P. pneumotropica biotype Jawetz remained uniformly negative at 2, 6, 12, and 52 wk after treatment in multiple strains of mice that were originally infected. Together, these data indicate that enrofloxacin can eradicate P. pneumotropica from infected mice in a less labor-intensive approach that does not require breeding cessation and that is easily adaptable to the standard biweekly cage change schedule for individually ventilated cages. PMID:25255075

  3. Elimination of Pasteurella pneumotropica from a mouse barrier facility by using a modified enrofloxacin treatment regimen.

    Science.gov (United States)

    Towne, Justin W; Wagner, April M; Griffin, Kurt J; Buntzman, Adam S; Frelinger, Jeffrey A; Besselsen, David G

    2014-09-01

    Multiple NOD. Cg-Prkdc(scid)Il2rg(tm1Wjl)Tg(HLA-A2.1)Enge/Sz (NSG/A2) transgenic mice maintained in a mouse barrier facility were submitted for necropsy to determine the cause of facial alopecia, tachypnea, dyspnea, and sudden death. Pneumonia and soft-tissue abscesses were observed, and Pasteurella pneumotropica biotype Jawetz was consistently isolated from the upper respiratory tract, lung, and abscesses. Epidemiologic investigation within the facility revealed presence of this pathogen in mice generated or rederived by the intramural Genetically Engineered Mouse Model (GEMM) Core but not in mice procured from several approved commercial vendors. Epidemiologic data suggested the infection originated from female or vasectomized male ND4 mice obtained from a commercial vendor and then comingled by the GEMM Core to induce pseudopregnancy in female mice for embryo implantation. Enrofloxacin delivered in drinking water (85 mg/kg body weight daily) for 14 d was sufficient to clear bacterial infection in normal, breeding, and immune-deficient mice without the need to change the antibiotic water source. This modified treatment regimen was administered to 2400 cages of mice to eradicate Pasteurella pneumotropica from the facility. Follow-up PCR testing for P. pneumotropica biotype Jawetz remained uniformly negative at 2, 6, 12, and 52 wk after treatment in multiple strains of mice that were originally infected. Together, these data indicate that enrofloxacin can eradicate P. pneumotropica from infected mice in a less labor-intensive approach that does not require breeding cessation and that is easily adaptable to the standard biweekly cage change schedule for individually ventilated cages.

  4. Toll-like receptor 4-positive macrophages protect mice from Pasteurella pneumotropica-induced pneumonia

    Science.gov (United States)

    Hart, Marcia L.; Mosier, Derek A.; Chapes, Stephen K.

    2003-01-01

    This study investigates Toll-like receptor 4 (TLR4)-positive macrophages in early recognition and clearance of pulmonary bacteria. TLR4 is a trans-membrane receptor that is the primary recognition molecule for lipopolysaccharide of gram-negative bacteria. The TLR4(Lps-del) mouse strains C57BL10/ScN (B10) and STOCK Abb(tm1) TLR4(Lps-del) Slc11a1(s)(B10 x C2D) are susceptible to pulmonary infections and develop pneumonia when naturally or experimentally infected by the opportunistic bacterium Pasteurella pneumotropica. Since these mice have the TLR4(Lps-del) genotype, we hypothesized that reconstitution of mice with TLR4-positive macrophages would provide resistance to this bacterium. A cultured macrophage cell line (C2D macrophages) and bone marrow cells from C2D mice were adoptively transferred to B10 and B10 x C2D mice by intraperitoneal injection. C2D macrophages increased B10 and B10 x C2D mouse resistance to P. pneumotropica. In C2D-recipient mice there was earlier transcription of tumor necrosis factor alpha and chemokines JE and macrophage inflammatory protein 2 (MIP-2) in the lungs of B10 and B10 x C2D mice, and there was earlier transcription of KC and MIP-1alpha in B10 x C2D mice. In addition, the course of inflammation following experimental Pasteurella challenge was altered in C2D recipients. C2D macrophages also protected B10 x C2D mice, which lack CD4(+) T cells. These data indicate that macrophages are critical for pulmonary immunity and can provide host resistance to P. pneumotropica. This study indicates that TLR4-positive macrophages are important for early recognition and clearance of pulmonary bacterial infections.

  5. Comportamiento de la sepsis procedente de la comunidad en la edad pediátrica

    Directory of Open Access Journals (Sweden)

    Beatriz Santos Lorenzo

    2015-11-01

    Full Text Available Se realizó un estudio descriptivo de corte transversal en el Hospital Pediátrico "Mártires de Las Tunas", que incluyó pacientes con diagnóstico de sepsis de la comunidad ingresados en la Unidad de Cuidados Intensivos, durante el período comprendido entre enero de 2009 y diciembre de 2011. Los objetivos del estudio fueron: caracterizar según la edad, lactancia materna, estado nutricional, foco infeccioso y forma clínica de presentación. El universo lo constituyeron los 259 pacientes ingresados con sepsis y la muestra los 109 procedentes de la comunidad. Los datos fueron obtenidos de historias clínicas, almacenados en base de datos Excel, procesados con cálculos totales - porcientos. El resultado fue que el 61% eran menores de un año, seguidos por el grupo de uno a cuatro años (22%; el 65% tenían la lactancia mixta; el 44% eran normopesos y el 37% estaban desnutridos; referido al foco de infección, en el 66% fueron los pulmones; 52% presentaron forma clínica de sepsis en fase inicial. Se concluyó que la sepsis predominó en las primeras edades (menores de cuatro años, en el sexo masculino, en menores que tenían lactancia mixta, normopesos y desnutridos. El foco pulmonar fue el más frecuente y el mayor porciento ingresó en fases iniciales de sepsis.

  6. 21 CFR 520.2218 - Sulfamerazine, sulfamethazine, and sulfaquinoxaline powder.

    Science.gov (United States)

    2010-04-01

    ...) As an aid in the control of acute fowl cholera caused by Pasteurella multocida susceptible to... days. If disease recurs, repeat treatment. (ii) Limitations. Make fresh solution daily. Do not treat... acute fowl cholera caused by Pasteurella multocida susceptible to sulfamerazine, sulfamethazine, and...

  7. Sepsis procedente de la comunidad en cuidados intensivos: Factores de riesgo

    Directory of Open Access Journals (Sweden)

    Pilar Legón Blasco

    2000-03-01

    Full Text Available Se realizó un estudio prospectivo y transversal en pacientes sépticos ingresados en la Unidad de Cuidados Intensivos del hospital "Dr. Ángel Arturo Aballí" con los criterios de sepsis procedente de la comunidad en un período de 18 meses, comprendido desde septiembre de 1996 hasta marzo de 1998, con el objetivo de analizar la frecuencia de factores de riesgo asociados con la infección. Se evaluaron 70 pacientes que cumplían los criterios antes mencionados. Se tomó en la comunidad un grupo control de niños sanos. En los resultados se encontró que los factores asociados con la sepsis fueron: el sexo masculino (p=0,002, RR=2,7, la no lactancia materna (p=0,01, RR=3,3, la malnutrición por defecto (p=0,04, RR=2,1, el hacinamiento (p=0,0008, RR=2,4, el hábito de fumar (p=0,02, RR=2,4 y la mala higiene (p=0,01, RR=1,5.A prospective and crossover study was carried out in patients admitted in Intensive Care Unit (ICU of "Dr. Angel Arturo Aballí" Hospital where criteria of sepsis came from community for a period of 18 months, September 1996 to March 1998, to analyze frequency of risk factors associated with infection. We assessed 70 patients who fulfiled criteria above mentioned. Healthy children were control group. By findings, we found that factors associated with sepsis included: male sex (p=0.002, RR=2.7, non-breast feeding (p=0.01, RR=3.3, malnutrition by defect (p=0.04, RR=2.1, crowding (p=0.0008, RR= 2.4, smoking (p=0.02, RR=2.4, and a poor hygiene (p=0.01, RR=1.5.

  8. Experimental contact transmission of Pasteurella haemolytica from clinically normal domestic sheep causing pneumonia in Rocky Mountain bighorn sheep.

    Science.gov (United States)

    Onderka, D K; Wishart, W D

    1988-10-01

    Two Rocky Mountain bighorn lambs (Ovis canadensis canadensis) were held in captivity for 120 days before being housed with two domestic sheep. The lambs were clinically normal and had no Pasteurella spp. on nasal swab cultures. The domestic sheep were known to carry Pasteurella haemolytica biotype A in the nasal passages. After being in close contact for 19 days. P. haemolytica biotype A was cultured from nasal swabs of one of the bighorn lambs. By 26 days, both bighorn sheep developed coughs, were anorectic and became lethargic and nasal swabs yielded P. haemolytica biotype T, serotype 10. Twenty-nine days after contact, the lambs were necropsied and found to have extensive fibrinous bronchopneumonia. From affected tissues pure cultures of beta-hemolytic P. haemolytica biotype T, serotype 10 were grown. Both domestic sheep remained clinically normal and had no gross or microscopic lesions, but they carried the same P. haemolytica serotype in their tonsils. Behavioural observations gave no indication of stress in the bighorn lambs.

  9. Susceptibility of Dall sheep (Ovis dalli dalli) to pneumonia caused by Pasteurella haemolytica.

    Science.gov (United States)

    Foreyt, W J; Silflow, R M; Lagerquist, J E

    1996-10-01

    We evaluated susceptibility of Dall sheep (Ovis dalli dalli) to bacterial pneumonia induced by two strains of Pasteurella haemolytica of domestic sheep origin by evaluating the sensitivity of blood neutrophils of eight Dall sheep to lysis by cytotoxins of P. haemolytica, and by intratracheal inoculation of three Dall sheep, two bighorn sheep (Ovis canadensis), and two domestic sheep with 3.7 x 10(6) or 2.5 x 10(7) colony forming units of P. haemolytica. Neutrophils from the Dall sheep were more sensitive to lysis by cytotoxins from supernatants of a P. haemolytica, biotype A, serotype 2 (A2), of domestic sheep origin, than were neutrophils from six bighorn sheep. This cytotoxic bacterium was the same isolate that was used for intratracheal inoculation of two Dall sheep and two domestic sheep. Inoculation of this cytotoxic P. haemolytica A2 resulted in fatal fibrinopurulent pleuropneumonia in the first Dall sheep within 24 hr of inoculation, and pneumonic lesions in the second Dall sheep before it was euthanized 52 hr after inoculation. This strain of P. haemolytica A2 did not cause respiratory disease when inoculated into two domestic sheep. A noncytotoxic strain of P. haemolytica; biotype T, serotype 3,4,10 of domestic sheep origin did not result in pneumonia in the third Dall sheep or two bighorn sheep. Prior to inoculation, P. haemolytica, biotype T isolates were obtained from all three Dall sheep, but none of these isolates was cytotoxic. At necropsy, cytotoxic P. haemolytica A2 was isolated from lungs and other tissues of the two pneumonic Dall sheep. Based on these results, we conclude that Dall sheep appear to be at least as sensitive as bighorn sheep to pneumonia caused by P. haemolytica A2 of domestic sheep origin. Because in vitro and in vivo results appear closely correlated in this and other studies, we believe with additional evaluation and standardization, neutrophil cytotoxicity tests may serve as a substitute for live animal challenges in future

  10. Conjunto metálico con puntas de jabalina procedentes del yacimiento de La Pestaña (Badajoz

    Directory of Open Access Journals (Sweden)

    Enríquez Navascués, Juan Javier

    2013-12-01

    Full Text Available This paper presents an unpublished photograph whith metal pieces from La Pestaña (Badajoz, where two Pastora-type javelins stand out. The photo comes from the archive of Aurelio Cabrera (1870-1936, sculptor and archaeologist. Six of the pieces have been located in the Badajoz Provincial Archaeological Museum, three of which have elemental anaylises. The other six pieces are missing, including the Pastora-type javelins among them. The photograph attests to their existence and origin strengthens the southwestern distribution of this type of javelin point.Se amplía la corta serie de puntas tipo Pastora hasta ahora conocidas en la Península Ibérica, gracias a la localización de una fotografía inédita del archivo del escultor y arqueólogo Aurelio Cabrera Gallardo (1870-1936. La fotografía muestra 12 piezas metálicas procedentes de la Dehesa de la Pestaña, en la finca Los Fresnos (Badajoz. Seis de ellas han sido localizadas en el Museo Arqueológico Provincial de Badajoz y tres cuentan con análisis elemental. Otras seis, entre las que están las puntas, están desaparecidas. La fotografía testimonia su existencia y una procedencia que refuerza la distribución suroccidental de este tipo de puntas de jabalina.

  11. Susceptibility of Rocky Mountain bighorn sheep and domestic sheep to pneumonia induced by bighorn and domestic livestock strains of Pasteurella haemolytica.

    OpenAIRE

    Onderka, D K; Rawluk, S A; Wishart, W D

    1988-01-01

    Bighorn sheep were inoculated intratracheally with suspensions of nonhemolytic Pasteurella haemolytica biotype T (10(12) organisms) unique to wild bighorns, with beta-hemolytic P. haemolytica biotype T (10(12) organisms) isolated from clinically normal domestic sheep or intradermally with half a dose of a cattle vaccine containing P. haemolytica biotype A (10(5) organisms). The bighorn strain caused lobar necrotizing bronchopneumonia whereas both domestic livestock strains precipitated fatal ...

  12. Comparative studies on [Pasteurella] testudinis and [P.] testudinis-like bacteria and proposal of Chelonobacter oris gen. nov., sp. nov. as a new member of the family Pasteurellaceae

    DEFF Research Database (Denmark)

    Gregersen, Rikke Heidemann; Neubauer, Claudia; Christensen, Henrik

    2009-01-01

    Abstract A collection of 12 strains isolated from diseased tortoises tentatively identified as [Pasteurella] testudinis-like based on phenotypical characters were compared with three reference strains of [Pasteurella] testudinis. All strains could be separated from the reference strains with resp...

  13. Pasteurella pneumotropica evades the human complement system by acquisition of the complement regulators factor H and C4BP.

    Directory of Open Access Journals (Sweden)

    Alfredo Sahagún-Ruiz

    Full Text Available Pasteurella pneumotropica is an opportunist Gram negative bacterium responsible for rodent pasteurellosis that affects upper respiratory, reproductive and digestive tracts of mammals. In animal care facilities the presence of P. pneumotropica causes severe to lethal infection in immunodeficient mice, being also a potential source for human contamination. Indeed, occupational exposure is one of the main causes of human infection by P. pneumotropica. The clinical presentation of the disease includes subcutaneous abscesses, respiratory tract colonization and systemic infections. Given the ability of P. pneumotropica to fully disseminate in the organism, it is quite relevant to study the role of the complement system to control the infection as well as the possible evasion mechanisms involved in bacterial survival. Here, we show for the first time that P. pneumotropica is able to survive the bactericidal activity of the human complement system. We observed that host regulatory complement C4BP and Factor H bind to the surface of P. pneumotropica, controlling the activation pathways regulating the formation and maintenance of C3-convertases. These results show that P. pneumotropica has evolved mechanisms to evade the human complement system that may increase the efficiency by which this pathogen is able to gain access to and colonize inner tissues where it may cause severe infections.

  14. Modulation of pulmonary defense mechanisms by acute exposures to nitrogen dioxide. [Staphylococcus aureus; Proteus mirabilis; Pasteurella pneumotropica

    Energy Technology Data Exchange (ETDEWEB)

    Jakab, G.J.

    1987-02-01

    The effect of acute exposures to NO/sub 2/ on the antibacterial defenses of the murine lung was assessed following inhalation challenges with Staphylococcus aureus, Proteus mirabilis, and Pasteurella pneumotropica. With S. aureus pulmonary antibacterial defenses were suppressed at NO/sub 2/ levels of 4.0 ppm and greater. Exposure to 10.0 ppm enhanced the intrapulmonary killing of P. mirabilis which correlated with an increase in the phagocytic cell populations lavaged from the lungs; at 20.0 ppm bactericidal activity against P. mirabilis was impaired. Pulmonary antibacterial defenses against P. pneumotropica were impaired at 10.0 ppm which correlated with a decrease in the retrieved phagocytic lung cell population. Reversing the order of treatment (ie., NO/sub 2/ exposure prior to bacterial challenge) raised the threshold concentration for NO/sub 2/-induced impairment of intrapulmonary bacterial killing. With S. aureus the effect was not observed at 5.0 ppm but at 10.0 ppm and with P. mirabilis not at 20.0 ppm but at 30.0 ppm intrapulmonary killing was enhanced. Exposures up to 20.0 ppm of NO/sub 2/ did not effect the physical translocation mechanisms of the lung as quantitated by declines in pulmonary radiotracer activity following aerogenic challenge with /sup 32/P-labeled staphylococci.

  15. Inhibition of protein synthesis on the ribosome by tildipirosin compared with other veterinary macrolides

    DEFF Research Database (Denmark)

    Andersen, Niels Møller; Poehlsgaard, Jacob; Warrass, Ralf

    2012-01-01

    Tildipirosin is a 16-membered-ring macrolide developed to treat bacterial pathogens, including Mannheimia haemolytica and Pasteurella multocida, that cause respiratory tract infections in cattle and swine. Here we evaluated the efficacy of tildipirosin at inhibiting protein synthesis...

  16. Disease: H00306 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available found in the animal's oral cavity. Disseminated Pasteurella infections can lead to serious diseases including septic shock and menin...gitis mostly in infants and pregnant women. Many patients with P. multocida-related

  17. Demonstration of Ornithobacterium rhinotracheale in pheasants (Phasianus colchicus) with pneumonia and airsacculitis

    DEFF Research Database (Denmark)

    Welchman, D. de B.; Ainsworth, H. L.; Jensen, Tim Kåre

    2013-01-01

    type 2, avian coronavirus, Mycoplasma gallisepticum, Mycoplasma synoviae and other Mycoplasma species, Escherichia coli, Pasteurella multocida, other Pasteurellaceae and Syngamus trachea, suggesting synergism with other agents. Exposure to other intercurrent factors, including adverse weather...

  18. 21 CFR 558.586 - Sulfaquinoxaline.

    Science.gov (United States)

    2010-04-01

    ... use. As an aid in the control of acute fowl cholera caused by Pasteurella multocida susceptible to.... Treatment to be started after weaning. Feed continuously for 30 days or feed medicated feed for 2 days out...

  19. The isolation and antibiogram of aerobic nasal bacterial flora of ...

    African Journals Online (AJOL)

    The following microorganisms were identified from the normal flora of the grasscutters, they are; Staphylococcus epidermidis, Staphylococcus aureus, Enterococcus sp, Micrococcus sp, Bacillus cerus , E. coli, Serratia sp, Streptococcus sp, Pasteurella multocida, Streptacoccus, sp., Mannheimia heamolytica, Klebsiella sp., ...

  20. Evaluación ambiental y aplicaciones de áridos procedentes de RCD ligados con cemento en Ingeniería Civil

    OpenAIRE

    Rey Tirado, Isaac del

    2018-01-01

    La presente tesis doctoral se centra en la generación un conocimiento científico original y de calidad, sobre el uso de los áridos reciclados (AR) procedentes de Residuos de la Construcción y Demolición (RCD) para su uso en ingeniería civil, así como realizar una evaluación de la sostenibilidad de estos materiales reciclados. El potencial de los AR supone un acercamiento de la construcción, principal sector en consumo de materias primas y contaminación ambiental, hacia la...

  1. Tipos y producciones en las cerámicas de paredes finas procedentes del "municipium Augusta Bilbilis" (Huérmeda-Calatayud, Zaragoza)

    OpenAIRE

    Mínguez Morales, José Antonio

    2002-01-01

    El presente trabajo supone una aproximación a las cerámicas de "paredes finas" procedentes del municipium Auguata Bilbilis encontradas durante las excavaciones desarrolladas por el equipo de la Universidad de Zaragoza, dirigido por el Dr. Martín-Bueno, entre los años 1972 y 1996. Dicho conjunto aporta un arco cronológico que va desde el periodo tardorrepublicano, o comienzos del principado de Augusto, al siglo 1 d.C. Sus áreas de procedencia pueden agruparse en dos grandes bloques: la penínsu...

  2. Procedimiento de obtención de materailes multifuncionales y renovables a partir del rechazo de pipa procedente de la producción de aceite de girasol

    OpenAIRE

    Martín-Luengo, María Ángeles; Yates Buxcey, Malcolm; Ramos, M.; Sáez Rojo, Eduardo; González Gil, Lorena; Martínez Serrano, Ana María; Martín-Aranda, Rosa María; Sanz Lázaro, Jesús

    2011-01-01

    Procedimiento de obtención de materiales multifuncionales y renovables a partir del rechazo de pipa procedente de la producción de aceite de girasol. La presente invención se refiere al procedimiento de obtención de materiales renovables, a partir de residuos precedentes de la fabricación de aceite de girasol, para su uso como matrices biocompatibles en ingeniería de tejidos, administración controlada de sustancias de interés biológico (drogas, proteínas, genes, etc...

  3. Caracterización del efecto anticanceroso e identificación de dianas moleculares de principios activos procedentes de "Serratia marcescens"

    OpenAIRE

    Soto Cerrato, Vanessa

    2007-01-01

    Este trabajo de tesis presenta la caracterización del efecto anticanceroso y la identificación de dianas moleculares de principios activos procedentes de la bacteria "Serratia marcescens". En particular, se ha evaluado la capacidad anticancerosa "in vitro" y "ex vivo" del ciclodepsipéptido serratamolide (AT514) en varias células cancerosas y no cancerosas de diverso origen tisular, obteniendo una mayor sensibilidad al tratamiento por parte de las células cancerosas. También hemos realizado es...

  4. Aplicación de nuevas tecnologías para el diseño y desarrollo de productos de dorada (Sparus aurata) procedente de acuicultura

    OpenAIRE

    Andrés Bello, María Desamparados

    2012-01-01

    La acuicultura en su conjunto produce hoy en día más de la mitad del pescado consumido en el mundo. El objetivo de la presente tesis doctoral es estudiar la aplicación de diferentes tecnologías para incrementar y diversificar productos procedentes de acuicultura. Concretamente se han analizado las tecnologías de cocción y fritura a vacío, biopreservación y elaboración de texturizados a partir de dorada (Sparus aurata). Para ello en tres capítulos se aborda el estudio de estas tecnologías par...

  5. CARACTERIZACIÓN BROMATOLÓGICA Y MICROBIOLÓGICA DE CARNES PROCEDENTES DE ESPECIES DE ANIMALES REGIONALES DE LA AMAZONIA PERUANA PARA CONSUMO HUMANO

    OpenAIRE

    Lozano, Ronald; Pinedo, Weninger; Inga, Lylyams

    2012-01-01

    La investigación consistió en la caracterización bromatológica y determinación microbiológica de muestras de carnes procedentes de ocho especies de animales silvestres: huangana (Tayassu pecari), majaz o picuro (Agouti paca), sajino (Tayassu tajacu), venado colorado (Mazama americana), tapir (Tapirus terrestris), añuje (Dasyprota fuliginosa), ronsoco (Hydrochaeris hydrochaeris) y armadillo (Dasypus novemcinctus); en las localidades de Puerto Belén-Roya-Utucuro, Santa Rosa de Aguaytía, Santa L...

  6. CARACTERÍSTICAS FÍSICAS DE LA MADERA DE PINO PROCEDENTE DE RALEOS EN EL NOROESTE DE ESPAÑA

    OpenAIRE

    Riesco Muñoz,G; Díaz González,J

    2007-01-01

    Se estudió la densidad, contracción, higroscopicidad y punto de saturación de la pared celular en la madera de ejemplares jóvenes de tres especies importantes en la producción maderera española: Pinus pinaster, Pinus sylvestris y Pinus radiata. Se muestrearon 29 pinos procedentes de raleos efectuados en diferentes masas forestales de Galicia (noroeste de España). El material de ensayo fueron probetas de pequeñas dimensiones sin defectos. La madera de Pinus pinaster resultó semipesada y más in...

  7. Substratos de bronce en objetos férreos procedentes de la Necrópolis de La Hoya (Laguardia, Alava.

    Directory of Open Access Journals (Sweden)

    J. Alonso

    1996-01-01

    Full Text Available Se describe a continuación, brevemente y a modo de avance, un interesante detalle de procedimiento y tecnología aplicada en la elaboración de objetos férreos procedentes de la necrópolis de La Hoya (Laguardia, Alava, puesto en evidencia durante los trabajos de conservación y restauración, y que, por su novedad, sin duda debe abrir nuevas vías tanto en la investigación de las culturas del hierro prerromano, en particular, como en los estudios de arqueometalúrgica, en general.

  8. An ecologic study comparing distribution of Pasteurella trehalosi and Mannheimia haemolytica between Sierra Nevada bighorn sheep, White Mountain bighorn sheep, and domestic sheep.

    Science.gov (United States)

    Tomassini, Letizia; Gonzales, Ben; Weiser, Glen C; Sischo, William

    2009-10-01

    The prevalence and phenotypic variability of Pasteurella and Mannheimia isolates from Sierra Nevada bighorn sheep (Ovis canadensis sierrae), White Mountain bighorn sheep (Ovis canadensis nelsoni), and domestic sheep (Ovis aries) from California, USA, were compared. The White Mountain bighorn sheep population had a recent history of pneumonia-associated mortality, whereas the Sierra Nevada bighorn sheep population had no recent history of pneumonia-associated mortality. The domestic sheep flocks were pastured in areas geographically near both populations but were not known to have direct contact with either bighorn sheep population. Oropharyngeal swab samples were collected from healthy domestic and bighorn sheep and cultured to characterize bacterial species, hemolysis, biogroups, and biovariants. Pasteurella trehalosi and Mannheimia haemolytica were detected in all of the study populations, but the relative proportion of each bacterial species differed among sheep populations. Pasteurella trehalosi was more common than M. haemolytica in the bighorn sheep populations, whereas the opposite was true in domestic sheep. Mannheimia haemolytica was separated into 11 biogroups, and P. trehalosi was characterized into two biogroups. Biogroup distributions for M. haemolytica and P. trehalosi differed among the three populations; however, no difference was detected for the distribution of P. trehalosi biogroups between the Sierra Nevada bighorn sheep and domestic sheep. The prevalence odds ratios (pOR) for the distribution of M. haemolytica biogroups suggested little difference between White Mountain bighorn sheep and domestic sheep compared with Sierra Nevada bighorn sheep and domestic sheep, although these comparisons had relatively large confidence intervals for the point estimates. Hemolytic activity of the isolates was not different among the sheep populations for M. haemolytica but was different for P. trehalosi. No clear evidence of association was found in the

  9. Effect of radiation on bacterial cells pathogenesis

    International Nuclear Information System (INIS)

    Szulc, M.; Tropilo, J.; Zajaczkowska, E.

    1983-01-01

    In order to determine the effect of X rays on the pathogeny of Erysipelothrix rhusiopathiae and Pasteurella multocida 334 mice were infected subcutaneously with the germs exposed to 10 Gy and D 10 . It was found that a single exposition of E. rhusiopathiae and P. multocida to 10 Gy and D 10 did not change pathogenic properties of these cells. P. multocida showed higher sensitivity to X rays: D 10 for that species was 94 Gy and for E. rhusiopathiae - 156 Gy. (author)

  10. Relato de caso de Lagochilascariose humana procedente do Estado do Pará, Brasil Report a case of human lagochilascariasis coming from the Pará State, Brazil

    Directory of Open Access Journals (Sweden)

    Miguel Alípio Vieira

    2000-02-01

    Full Text Available Mais um caso de lagochilascariose em criança procedente do Município de Xinguara PA. No Hospital das Clínicas da UFG, foi feita drenagem do abscesso localizado na região cervical direita, constatando-se a presença de ovos e vermes adultos de Lagochilascaris minor. Instituída terapia com albendazol 400mg/dia (durante 30 dias e antibioticoterapia, houve regressão do quadro clinico.A new case of lagochilascariasis is reported in a child from Xinguara PA, Brazil. The patient had an abscess in the right cervical region, which was drained at the Clinical Hospital of UFG. Eggs and adult stages of Lagochilascaris minor were found in the secretion of the abscess. Treatment with albendazol, at a dosage of 400mg/day for 30 days, associated with antibiotics promoted regression of the lesion.

  11. Un lote de armamento ibérico procedente de la necrópolis del Mas de Barberán (Nogueruelas, Teruel

    Directory of Open Access Journals (Sweden)

    Izquierdo Peraile, Isabel

    1999-12-01

    Full Text Available In this paper we publish an Ibenan set of weapons -swords, lances and dagger essentially-, coming from the cemetery of the settlement so-called Mas de Barberán (Nogueruelas, Teruel. An anthropomorphic stele with an inscription recently studied is associated to the same site. This stele represents an armed with disk-cuirass masculine personage.

    En este trabajo presentamos un lote inédito de armamento ibérico espadas, lanzas y puñal esencialmente procedente de la necrópolis correspondiente al poblado del Mas de Barberán (Nogueruelas, Teruel. Al mismo yacimiento se asocia la estela antropomorfa con inscripción que representa un personaje masculino armado con disco-coraza, recientemente estudiada.

  12. Características mecánicas de hormigones con áridos reciclados procedentes de los rechazos en prefabricación

    Directory of Open Access Journals (Sweden)

    Pérez-Benedicto, J. A.

    2012-03-01

    Full Text Available The need to diminish the final amount of waste produced in construction and demolition processes in plants of concrete prefabricated products, has made us analyze the mechanical behaviour of concrete made with recycled aggregate coming from discarded concrete prefabricated units. The aim was to find a possible use for this recycled aggregate in different proportions in reinforced concrete and prestressed concrete, for prefabricated elements. Two situations using recycled aggregate have been studied: one of them, in natural state and subject to pre-saturation with selfcompacting H40 and H50 concrete, using as the only variable the substitution of the 4/12mm coarse aggregate in the following percentages: 0%, 20%, 50% and 100%. The results of the tests performed indicate that concretes with recycled aggregate coming from discarded prefabricated units can offer an excellent quality as structural concrete for future uses.

    La necesidad de disminuir la cantidad final de residuos de construcción y demolición que se producen en las plantas de prefabricados de hormigón, nos ha llevado a analizar el comportamiento mecánico de un hormigón elaborado con áridos reciclados procedentes de piezas prefabricadas de hormigón, con la finalidad de un posible futuro uso como árido en dosificaciones de hormigón armado y pretensado para piezas prefabricadas. Se ha trabajado con áridos reciclados en dos situaciones: estado natural y sometidos a presaturación, con hormigones H40 y H50 autocompactantes, tomando como única variable la sustitución de fracción gruesa del árido 4/12mm. con los siguientes porcentajes, 0%, 20%, 50% y 100%. Los resultados de los ensayos realizados indican que hormigones elaborados con áridos reciclados procedentes de elementos prefabricados pueden presentar una excelente calidad como hormigón estructural para su futuro uso como autoconsumo.

  13. Pets and Pasteurella Infections

    Science.gov (United States)

    ... present in some children, including an infection of the joints ( arthritis ), bones (osteomyelitis), and tendons (tenosynovitis). Less frequently, youngsters may have pneumonia , urinary tract ...

  14. Manifestaciones hidrológicas e hidroquímicas de flujos subterráneos procedentes de formaciones poco permeables del terciario en el Somontano de Huesca

    Directory of Open Access Journals (Sweden)

    de Miguel Cabeza, J. L.

    1988-12-01

    Full Text Available Presence of groundwater flow in the «somontano Oscense» area, proceeding from low permeability detritic tertiary rocks, is considered. It's given a grounwater flow model for these tertiary rocks. This model explains both water flow through them and water chemical characteristics. Groundwater flow has clear surface manifestations: it causes wet-areas (which are called «paules» in the area with sodic waters; it makes appear saline, sodic or alkaline soils; and it modifies, too, water chemical composition of rivers in Somontano.Se considera la presencia en el Somontano Oscense de flujos de agua subterránea procedentes de materiales detríticos terciarios de baja permeabilidad. Se da un modelo de flujo de las aguas subterráneas en estos materiales que permite explicar tanto su fluencia hacia la superficie como sus características físico-químicas. Estos flujos se manifiestan en superficie, dando lugar a zonas húmedas naturales, paules, con aguas de composición sódica que provocan la formación de suelos salinos, sódicos o alcalinos; también se manifiestan modificando la composición química de las aguas de los ríos que atraviesan el Somontano.

  15. Resistencia antimicrobiana de cepas de Bartonella bacilliformis procedentes de regiones endémicas de la Enfermedad de Carrión en EL Perú

    Directory of Open Access Journals (Sweden)

    Giovanna Mendoza-Mujica

    Full Text Available Objetivos. Evaluar la susceptibilidad antimicrobiana in vitro a cloranfenicol (CHL y ciprofloxacino (CIP de cepas de Bartonella bacilliformis procedentes de áreas endémicas de la enfermedad de Carrión (EC en el Perú, mediante tres métodos de laboratorio. Materiales y métodos. Se evaluó la susceptibilidad antimicrobiana a CHL y CIP de 100 cepas de Bartonella bacilliformis, los aislamientos procedieron de pacientes de los departamentos de Ancash, Cusco, Cajamarca, Lima y La Libertad; las cepas se evaluaron mediante: disco difusión, E-Test y dilución en agar. Resultados. El 26% de las cepas de Bartonella bacilliformis evaluadas, presentaron resistencia a CIP y 1% a CHL. Se obtuvieron patrones similares de sensibilidad/resistencia antimicrobiana en los tres métodos utilizados. Conclusiones. Las cepas de Bartonella bacilliformis circulantes en el Perú, presentan elevados niveles de resistencia in vitro a CIP, por lo que se recomienda ampliar la investigación sobre la utilización del fármaco en los esquemas de tratamiento de la EC. Los métodos de E-test y disco difusión resultaron más convenientes para la evaluación de la susceptibilidad antimicrobiana in vitro del microorganismo

  16. Estudio de la resistencia a compresión simple del adobe elaborado con suelos procedentes de Crescencio Valdés, Villa Clara, Cuba

    Directory of Open Access Journals (Sweden)

    Barroso, I. J.

    2008-09-01

    Full Text Available In this article we study the resistance to simple compression of the adobe bricks with building purposes. The study was carried out with various clay soils from Crescencio Valdés village, municipality of Camajuaní, Villa Clara, Cuba. In order to select the best soils to construction we have considered 1 MPa (10 kg/cm2 as minimum resistance to simple compression. So the soils that do not verify that requirement have been improved only by adding sand.En este artículo se estudia la resistencia a compresión simple que presenta el adobe elaborado con diferentes suelos procedentes del pueblo de Crescencio Valdés, situado en el municipio de Camajuaní, Villa Clara, Cuba. Se valora la idoneidad de la utilización de cada suelo estudiado bajo la premisa de alcanzar con el adobe elaborado una resistencia a compresión simple de 1 MPa (10 kg/cm2, ya que dicho adobe será utilizado posteriormente para edificación en dicho pueblo

  17. Aislamiento e identificación de Vibrio parahaemolyticus O3: K6 en pescados y moluscos bivalvos procedentes de un mercado pesquero de Lima, Perú

    Directory of Open Access Journals (Sweden)

    Rocío Aliaga

    2010-07-01

    Full Text Available Objetivo: Determinar la presencia de Vibrio parahaemolyticus serotipo O3:K6 en pescados y moluscos bivalvos procedentes de un mercado pesquero de Lima. Material y Métodos: Se analizaron 254 muestras entre pescados y moluscos bivalvos siguiendo la técnica descrita por Yukiko Harakudo et al, que consta de un paso de enriquecimiento, siembra en medio cromogénico, evaluación de fermentación de glucosa y la prueba de tolerancia a sales. Las cepas identificadas como Vibrio parahaemolyticus fueron serotipificadas usando anticuerpos monoclonales y evaluadas en su potencial patogénico en medio de Wagatsuma. Resultados: Se aislaron 15 cepas de V. parahaemolyticus, 9(7,5% en pescados y 6(4,5% en moluscos bivalvos. Tres (20% presentaron fenómeno de Kanagawa positivo indicando la producción de la hemolisina termoestable directa (TDH. Una cepa TDH-positiva aislada en una muestra pescado fue serotipo O3:K6. Conclusiones: Vibrio parahaemolyticus se encuentra distribuido en los recursos hidrobiológicos estudiados con mayor frecuencia en pescados, a partir de los cuales se encontró el serovar O3:K6. Este es el primer reporte de la cepa pandémica O3:K6 de Vibrio parahaemolyticus aislada de fuente no humana en el Perú. (Rev Med Hered 2010;21:139-145.

  18. Estudios sobre leishmaniasis tegumentaria en el Perú. I. Infección experimental de perros con cepas de leishmanias procedentes de casos de Uta

    Directory of Open Access Journals (Sweden)

    Arístides Herrer

    1951-01-01

    Full Text Available Se han inoculado varias series de perros con cepas de leishmanias procedentes de la forma clínica de la leishmaniasis tegumentaria conocida en el Perú con el nombre de uta, usando con tal objeto material tomado directamente de las lesiones utosas así como también cultivos del parásito. Los principales resultados obtenidos en tales inoculaciones son los siguientes: 1. Ha sido imposible infectar al perro con cultivos mantenidos solamente in vitro por espacio de cinco a ocho años, no obstante de haberse ensayado en tres series distintas de inoculaciones. 2. Se ha conseguido infecciones experimentales en el 87 por ciento de los perros que fueron inoculados con cultivos de reciente aislamiento. Aunque las inoculaciones fueran hechas bajo las mismas circunstancias en el dorso del hocico y la cara interna de una de las orejas, la infección se ha obtenido principalmente en el hocico. 3. También se ha logrado infectar perros inoculándoles material tomado directamente de las lesiones leishmaniásicas, ya sea de casos de uta o de lesiones producidas experimentalmente en otros perros.

  19. Degradación microbiana de cianuro procedente de plantas de beneficio de oro mediante una cepa nativa de P. fluorecens

    Directory of Open Access Journals (Sweden)

    OSCAR JAIME RESTREPO

    2006-01-01

    Full Text Available El cianuro es el compuesto lixiviante más utilizado en la industria metalúrgica de metales preciosos. El cianuro presenta efectos nocivos, entre los que se destacan su alta toxicidad y su efecto inhibitorio en la respiración celular. En este trabajo se probó la alternativa biotecnológica de degradar cianuro empleando una cepa nativa de P. fluorescens, aislada a partir de muestras de arenas procedentes de plantas de beneficio de oro que utilizan la cianuración ubicadas en municipio de Segovia, Colombia. En la mayor parte de las plantas de tratamiento no se controlan técnicamente los procesos, lo cual lleva a la utilización de cantidades de NaCN por encima de las necesarias, generando altas descargas del exceso tanto en solución como en las arenas descartadas. Las pruebas de toxicidad realizadas con D. pulex indican que una concentración de cianuro mayor o igual a 54 ppm es suficiente para intoxicar e inhibir su sobrevivencia. Los tratamientos convencionales para degradación de cianuro, suelen ser muy comunes y eficientes, sin embargo presentan desventajas por el alto costo que conlleva la compra de los reactivos necesarios. El tratamiento microbiano por su parte, demuestra eliminar grandes cantidades de cianuro de una manera eficiente y económica.

  20. Molecular diagnosis of Haemorrhagic Septicaemia - A Review

    Directory of Open Access Journals (Sweden)

    Ranjan Rajeev

    2011-08-01

    Full Text Available Pasteurella multocida is associated with hemorrhagic septicaemia in cattle and buffaloes, pneumonic pasteurellosis in sheep and goats, fowl cholera in poultry, atrophic rhinitis in pigs and snuffles in rabbits. Haemorrhagic septicaemia is caused by Pasteurella multocida type B:2, B:2,5 and B:5 in Asian countries and type E:2 in African countries. Pasteurella multocida have five types of capsular serotype i.e. type A, B, D, E and F. Diagnosis of the disease is mainly based on the clinical sign and symptom, post mortem findings. Confirmatory diagnosis is done by isolation and identification of causative agent. A variety of laboratory diagnostic techniques have been developed over the years for pasteurellosis and used routinely in the laboratory. Among these techniques molecular techniques of diagnosis is most important. This technique not only gives diagnosis but it also provides information regarding capsular type of Pasteurella multocida. Techniques which are used for molecular diagnosis of haemorrhagic septicaemia are PCR based diagnosis, Restriction endonuclease analysis (REA, Ribotyping, Colony hybridization assay, Filled alternation gel electrophoresis (FAGE, Detection of Pasteurella multocida by Real Time PCR. Among these techniques real time PCR is most sensitive and specific. [Vet. World 2011; 4(4.000: 189-192

  1. Determinación de la resistencia a insecticidas en Aedes aegypti, Anopheles albimanus y Lutzomyia peruensis procedentes del Norte Peruano

    Directory of Open Access Journals (Sweden)

    Franklin Vargas V

    2006-10-01

    Full Text Available Objetivo: Determinar los niveles de resistencia a temephos y deltametrina en cinco poblaciones naturales de Aedes aegypti del norte de Perú (La Libertad y Piura, dos cepas de Anopheles albimanus (Sullana y Tambogrande y una cepa de Lutzomyía spp (Santiago de Chuco, La Libertad. Materiales y métodos: Se realizaron bioensayos en larvas y adultos siguiendo la metodología de la Organización Mundial de la Salud. La visualización de bandas de B-esterasas se hizo por electroforesis en gel de poliacrilamida en larvas de cuarto estadio. Resultados: Las poblaciones de Ae. aegypti de Sullana y Tambogrande (Piura presentaron factores de resistencia (FR a temephos de 6,84 con un KDT50 = 160,42 minutos y 70% de mortalidad a las 24 horas; en tanto en la población de Tambogrande se observó un FR de 5,60, KDT50 = 107,20 y 80% de mortalidad, a diferencia de las cepas de La Esperanza, El Porvenir y Florencia de Mora (La Libertad que fueron susceptibles. Se identificó resistencia en las poblaciones de Ae. aegypti y A. albimanus procedentes de Piura (Tambogrande y Sullana para deltametrina, a diferencia de las poblaciones de Ae.aegypti y Lutzomyia spp de La Libertad que fueron susceptibles. Se identificó la esterasa B2 con un Rf de 0,23 en la población de Ae. aegypti de Sullana. Conclusiones: Dada la susceptibilidad de la población de La Libertad al insecticida temephos, puede seguir siendo usado en el control vectorial de Aedes aegypti; por lo contrario, dada la resistencia observada en poblaciones de Anopheles en Sullana y Tambogrande se debe evaluar el uso de la deltametrina en estas poblaciones. Finalmente, la población de Lutzomyia spp. no presentó resistencia a deltametrina.

  2. CARACTERIZACIÓN BROMATOLÓGICA Y MICROBIOLÓGICA DE CARNES PROCEDENTES DE ESPECIES DE ANIMALES REGIONALES DE LA AMAZONIA PERUANA PARA CONSUMO HUMANO

    Directory of Open Access Journals (Sweden)

    Ronald Lozano

    2012-12-01

    Full Text Available La investigación consistió en la caracterización bromatológica y determinación microbiológica de muestras de carnes procedentes de ocho especies de animales silvestres: huangana (Tayassu pecari, majaz o picuro (Agouti paca, sajino (Tayassu tajacu, venado colorado (Mazama americana, tapir (Tapirus terrestris, añuje (Dasyprota fuliginosa, ronsoco (Hydrochaeris hydrochaeris y armadillo (Dasypus novemcinctus; en las localidades de Puerto Belén-Roya-Utucuro, Santa Rosa de Aguaytía, Santa Luz de Abujao, Tacshitea–Sector Parinari en dos ocasiones, ubicadas en las márgenes del río Ucayali y sus afluentes, que fueron analizarlas por la empresa Servicios de Asesoramiento Técnico S.A.C. en Lima.  La caracterización bromatológica indicó que el añuje (Dasyprota fuliginosa mostró el mayor contenido en Proteína cruda seguido de la huangana (Tayassu pecari; en el contenido de grasa destacaron las especies  armadillo (Dasypus novemcinctus y la sachavaca (Tapirus terrestris así también en su contenido calórico.  La especie venado colorado (Mazama americana mostró un mayor valor en cenizas y en carbohidratos la especie huangana (Tayassu pecari.  La determinación microbiológica indicó que todas las muestras presentaron niveles de contaminación dentro de los límites permitidos para aerobios mesófilos viables y niveles de contaminación por coliformes totales, coliformes fecales, algunos muy elevados y también de mohos y levaduras.  Todos presentaron ausencia de Salmonella.

  3. Susceptibility of Rocky Mountain bighorn sheep and domestic sheep to pneumonia induced by bighorn and domestic livestock strains of Pasteurella haemolytica.

    Science.gov (United States)

    Onderka, D K; Rawluk, S A; Wishart, W D

    1988-10-01

    Bighorn sheep were inoculated intratracheally with suspensions of nonhemolytic Pasteurella haemolytica biotype T (10(12) organisms) unique to wild bighorns, with beta-hemolytic P. haemolytica biotype T (10(12) organisms) isolated from clinically normal domestic sheep or intradermally with half a dose of a cattle vaccine containing P. haemolytica biotype A (10(5) organisms). The bighorn strain caused lobar necrotizing bronchopneumonia whereas both domestic livestock strains precipitated fatal septicemia and fibrinous bronchopneumonia. The serotypes given were T3, T4, T15 and A1 and these were recovered from lung lesions and other organs. In three trials, domestic sheep were inoculated intratracheally with suspensions of bighorn sheep pneumonic lungs, and two concentrations of the P. haemolytica bighorn strain (10(4) and 10(12) organisms). One of these sheep was inoculated intrabronchially. The domestic sheep experienced a transient fever and elevated white blood cell counts. After six days, none of the sheep had lung lesions and inoculated organisms could not be recovered. It is suggested that bighorn sheep are very susceptible to P. haemolytica from domestic livestock and should not be allowed in contact with sheep or cattle.

  4. The importance of subcutaneous abscess infection by Pasteurella spp. and Staphylococcus aureus as a cause of meat condemnation in slaughtered commercial rabbits

    Directory of Open Access Journals (Sweden)

    A. Ferreira

    2014-12-01

    Full Text Available Subcutaneous abscesses are lesions frequently reported in commercial rabbits. Both at farm and slaughterhouse level, these lesions are responsible for economic losses and a potential decrease in meat quality. The present study was devised to identify the main causes of meat condemnation in slaughtered commercial rabbits and assess the importance of abscess lesions in this domain. For these purposes, 281423 rabbits were evaluated during meat inspection at the slaughterhouse. The results achieved showed that subcutaneous abscesses were the major cause of condemnation, being responsible for the rejection of 1355 (0.48% rabbit carcasses. The main affected area was the hind limbs (31.37%, followed by the cervical area (23.10%. Microbiological analyses of 27 abscess samples indicated Pasteurella spp. as the bacteria mostly isolated (59.3%, followed by Staphylococcus aureus (25.9%. These results enable us to advise the industry on the significance of abscesses as an important cause of economic losses, due to meat condemnation during post mortem inspection, and highlight the importance of implementing monitoring plans as a way to control this pathological problem.

  5. Exhaust Air Dust Monitoring is Superior to Soiled Bedding Sentinels for the Detection of Pasteurella pneumotropica in Individually Ventilated Cage Systems.

    Science.gov (United States)

    Miller, Manuel; Ritter, Brbel; Zorn, Julia; Brielmeier, Markus

    2016-11-01

    Reliable detection of unwanted organisms is essential for meaningful health monitoring in experimental animal facilities. Currently, most rodents are housed in IVC systems, which prevent the aerogenic transmission of pathogens between cages. Typically soiled-bedding sentinels (SBS) exposed to soiled bedding collected from a population of animals within an IVC rack are tested as representatives, but infectious agents often go undetected due to inefficient transmission. Pasteurellaceae are among the most prevalent bacterial pathogens isolated from experimental mice, and the failure of SBS to detect these bacteria is well established. In this study, we investigated whether analysis of exhaust air dust (EAD) samples by using a sensitive and specific real-time PCR assay is superior to conventional SBS monitoring for the detection of Pasteurella pneumotropica (Pp) infections. In a rack with a known prevalence of Pp-positive mice, weekly EAD sampling was compared with the classic SBS method over 3 mo. In 6 rounds of testing, with a prevalence of 5 infected mice in each of 7 cages in a rack of 63 cages, EAD PCR detected Pp at every weekly time point; SBS failed to detect Pp in all cases. The minimal prevalence of Pp-infected mice required to obtain a reliable positive result by EAD PCR testing was determined to be 1 in 63 cages. Reliable detection of Pp was achieved after only 1 wk of exposure. Analysis of EAD samples by real-time PCR assay provides a sensitive, simple, and reliable approach for Pp identification in laboratory mice.

  6. Caracterización de escorias metalúrgicas procedentes de yacimientos arqueológicos de Navarra (Siglos II a.C.- IV d.C.

    Directory of Open Access Journals (Sweden)

    Ros-Latienda, L.

    2013-12-01

    Full Text Available The Archaeology Section of the Government of Navarre put forward a proposal to undertake research in the characterization of a set of pieces from 2nd century B.C. to 4th century A.D. retrieved from excavations in different archaeological sites in this province, to obtain data related to the manufacturing process of the investigated artefacts and to compare the level of technical skills in different times and places, so as to achieve a better understanding of technological abilities and material culture. The finds discussed in this paper are of interest from an archaeometallurgical point of view, and they consist mainly of metallurgical slags, remains of manufactured pieces, and minerals residues used to obtain various metals. In addition to carrying out their chemical analyses by inductively coupled plasma (ICP, the study of six samples was performed by optical and scanning electron microscopy and energy-dispersive X-ray microanalysis (EDX which revealed the composition of large areas of the slags, and the study was finally completed by the determination of the phases present by X rays diffraction.Desde la Sección de Arqueología del Gobierno de Navarra llegó la propuesta de caracterizar una serie de piezas comprendidas entre el siglo II a.C. y el siglo IV d.C. procedentes de yacimientos arqueológicos de esta provincia con objeto de obtener datos relacionados con la tecnología que las produjo y poder comparar el grado de desarrollo técnico de diferentes épocas y lugares. Interesaba el estudio de estas piezas desde el punto de vista metalúrgico, habiendo entre ellas mayoritariamente escorias metalúrgicas, restos de piezas fabricadas y restos minerales utilizados en la obtención de diversos metales. Además de proceder a su análisis químico mediante técnica de plasma acoplado inductivamente (ICP, se estudiaron seis muestras mediante microscopía óptica, electrónica de barrido y microanálisis por energía dispersiva de rayos X (EDAX

  7. Detecção do vírus Epstein-Barr (EBV) em adenocarcinomas gástricos procedentes dos estados do Ceará e de São Paulo

    OpenAIRE

    Lima,Marcos Antonio Pereira de; Ferreira,Márcia Valéria Pitombeira; Barros,Marcos Aurélio Pessoa; Pardini,Maria Inês de Moura Campos; Ferrasi,Adriana Camargo; Rabenhorst,Silvia Helena Barem

    2011-01-01

    INTRODUÇÃO: O vírus Epstein-Barr (EBV) está associado a cerca de 10% dos adenocarcinomas gástricos, representando mais de 50 mil casos por ano no mundo. Apesar dos estudos realizados em várias partes do mundo, alguns aspectos clinicopatológicos permanecem controversos. OBJETIVOS: O presente estudo teve como objetivo analisar as características clinicopatológicas de casos de adenocarcinomas gástricos procedentes dos estados de São Paulo e Ceará, correlacionando-os com a detecção de EBV. MATERI...

  8. Creación de material didáctico para nivel A2 de ELE, a partir de conversaciones procedentes del Corpus Corinéi (Corpus oral de interlengua español/italiano)

    OpenAIRE

    Martín Sánchez, M. Teresa; Pascual Escagedo, Consuelo; Rodríguez, María Paz

    2017-01-01

    En el presente trabajo proponemos la utilización de material auténtico procedente de las conversaciones del corpus CORINÉI, que parte de un trabajo colaborativo cuyo objetivo es la interacción entre un hablante nativo y un hablante no nativo dentro del ámbito universitario. El objetivo se enfocará hacia la creación de materiales que ayuden al discente a reflexionar y consolidar la propia competencia interactiva, de manera que afiance la capacidad conversacional, tanto fuera como dentro del au...

  9. Catálogo de los Reptiles procedentes de la Comunidad de Madrid (España que se conservan en el Museo Nacional de Ciencias Naturales

    Directory of Open Access Journals (Sweden)

    González Fernández, J. E.

    2006-05-01

    Full Text Available A complete catalogue of reptiles found in Comunidad de Madrid (Spain is provided in this paper. The catalogue is taxonomically indexed and listed in alphabetical order including all basic data. It includes all information available in card files and old collection books of the MNCN. We have confirmed which reptiles in the current collection appear as being collected in Madrid, in old records, catalogue books and collection cards in the collection of amphibians and reptiles of the MNCN. The information of these old databases has been verified and mistakes corrected. As a consequence of this revision, the existence of 2237 specimens of reptiles originating in the above-indicated area and exisincluded in 1039 computer records, has been confirmed as of 30 November 2005. Among the oldest specimens included in the collection are some collected by the founding father of Spanish herpetology (Eduardo Boscá y Casanoves or by a member of the Pacific Scientific Commission (Francisco de P. Martínez y Sáez and deposited in the MNCN more than 140 years ago. These specimens and their data are preserved at the MNCN as part of our common National Heritage, for future generations of researchers as witnesses of the past and present biodiversity. Distribution areas for several species have been extended.

    En el presente trabajo, se proporciona un catálogo actualizado de los reptiles de la Comunidad de Madrid (España elaborado gracias a la información disponible en los ficheros y libros de colección del MNCN. Se han confirmado los datos que figuraban en los antiguos libros de registro, catálogo y fichas de colección referentes a los reptiles procedentes de Madrid existentes en la colección de anfibios y reptiles del MNCN, comprobándose que ejemplares se conservan en la actualidad. También se ha actualizado y comprobado que la información disponible en las bases de datos del MNCN era correcta y acorde con los datos existentes en los ejemplares. Los

  10. Qualidades organolépticas de purês de batatinhas procedentes de culturas tratadas com inseticidas Application of insecticides and their influence on the potato puree flavor

    Directory of Open Access Journals (Sweden)

    Ruth dos Santos Garruti

    1961-01-01

    Full Text Available Resultados significativos foram obtidos na análise do sabor de amostras de purês preparados com batatinhas procedentes de ensaios de aplicação de vários inseticidas no solo, na folhagem e em batatas-semente. Em 1959, dos inseticidas aplicados no solo (BHC, Heptaclor, Aldrin, Parathion e Lindane apenas o BHC imprimiu sabor estranho bastante pronunciado semelhante a môfo, diferindo da testemunha ao nível de 1%.Para Heptaclor e Aldrin não foram verificadas alterações de sabor; Lindane e Parathion apresentaram leves odores estranhos, semelhantes a medicamento. Disyston, aplicado nas batatas-semente, e Metasystox, na folhagem, imprimiram ao purê sabor ardido e odor a remédio, mostrando-se inferiores, respectivamente, aos níveis de 5 e 1%. tanto à testemunha, tratada com carvão, como ao item sem qualquer tratamento. Parathion, aplicado na folhagem, comparado com as mesmas testemunhas, não apresentou diferenças significativas. Em 1960, dos inseticidas aplicados no solo, apenas Lindane, em dose normal e dobrada, diferiu da testemunha ao nível estatístico de 1%, apresentando sabor estranho, semelhante a môfo. Heptaclor, Aldrin e Toxafeno. em doses normal e dobrada, não diferiram da testemunha. classificando-se o sabor do primeiro como regular e dos dois últimos como bom.Organoleptic tests were carried out in 1959 and 1960 to determine the possible occurrence of off-flavor in potato tubers, caused by the application of insecticides to the soil where the plants were grown, on the seed, and on the plant leaves. In 1959 the treated samples were compared against the control by the triangular test; in 1960, in a lattice square 3x3 with four replications. The insecticides applied to the soil in 1959 were as fallows: BHC (gamma-isomer, Heptaclor, Aldrin, Parathion, and Lindane. BHC induced a very strong mold-like «rmusty» off-flavor, significant in relation to the control at the 1% level. Parathion and Lindane induced an unidentified off

  11. In vitro activity of flumequine in comparison with several other antimicrobial agents against five pathogens isolated in calves in The Netherlands.

    Science.gov (United States)

    Mevius, D J; Breukink, H J; van Miert, A S

    1990-10-01

    The in vitro activity of flumequine in comparison with several other drugs was tested against 17 P. multocida, 16 P. haemolytica, 21 S. dublin, 21 S. typhimurium and 21 E. coli strains, isolated in (veal) calves in the Netherlands. The MIC50 of flumequine for the respective pasteurellas was 0.25 and 1 microgram/ml, for the salmonellas and E. coli 0.5 micrograms/ml. In comparison with flumequine, enrofloxacin and ciprofloxacin showed higher in vitro activity, with MIC50 less than or equal to 0.008 micrograms/ml for ciprofloxacin. Decreased susceptibility of the pasteurellas was found for kanamycin, neomycin, streptomycin, gentamicin, oxytetracycline and doxycycline. The MIC50 of minocycline for P. multocida was 0.5 micrograms/ml and there was no cross resistance with the other tetracyclines. P. multocida was very susceptible to ampicillin (MIC50 less than or equal to 0.03 micrograms/ml), P. haemolytica, however, was 100% resistant to this drug. Both pasteurellas were susceptible to cephalothin and approximately 50% of the strains of both bacteria were resistant to chloramphenicol. The MIC50 of either spiramycin or tylosin was greater than or equal to their respective breakpoint-MIC values. Both pasteurellas were susceptible to the combination of trimethoprim and sulphamethoxazole. However, for P. multocida, the addition of sulphamethoxazole to trimethoprim had no synergistic effect on its MIC. In comparison with trimethorpim, aditoprim was less potent. Therefore only P. multocida was susceptible to aditoprim.

  12. Caracterización arqueométrica de pigmentos y soportes procedentes de pinturas murales góticas (S. XIII-XV

    Directory of Open Access Journals (Sweden)

    Kriznar, A.

    2007-04-01

    ípica para pintura italiana gótica: fresco buono sobre varias capas de mortero, con empleo de polvo de mármol para hacerlo más liso y blanco. Los resultados obtenidos han permitido caracterizar e identificar los morteros y pigmentos inorgánicos empleados y que son apropiados para pinturas murales. A título de ejemplo, se han empleado óxidos de hierro para amarillo, naranja, rojo y verde, pero no se ha encontrado malaquita ni existen indicios de compuestos de cobre para el color verde. En capas más antiguas se ha encontrado cinabrio para el color rojo, típico de Italia. Las pinturas fueron realizadas sin emplear otro aglutinante que la propia cal procedente del mortero. Estas características y el empleo de cinabrio, sitúan las pinturas del 1400-1410 en la corriente artística italiana del Trecento. La segunda manera es típica del norte de Europa: técnica de una o dos capas de mortero, con una capa fina de cal superpuesta para dar mayor fuerza a la cal del mortero como aglutinante. Teniendo en cuenta los resultados obtenidos en este estudio sobre los dos tipos de muestras estudiadas, se concluye que las corrientes italiana y norteeuropea se encontraron en territorio esloveno, lo que se aprecia tanto desde el punto de vista estilístico como científicamente. Investigaciones en esta temática ayudan a conocer mejor tanto el Arte de Europa Central y el de Eslovenia con la zona adriática, como el mapa general del Arte Europeo en el tiempo de la Edad Media.

  13. Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

    OpenAIRE

    Ramos Zapana, Rubén; Arias Arroyo, Gladys

    2014-01-01

    Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

  14. 75 FR 1274 - Implantation or Injectable Dosage Form New Animal Drugs; Florfenicol and Flunixin

    Science.gov (United States)

    2010-01-11

    ... flunixin meglumine), a combination injectable solution, for treatment of bovine respiratory disease (BRD... treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida... female dairy cattle 20 months of age or older. Use of florfenicol in this class of cattle may cause milk...

  15. 21 CFR 522.955 - Florfenicol.

    Science.gov (United States)

    2010-04-01

    ... treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida... cause milk residues. A withdrawal period has not been established in preruminating calves. Do not use in... use. For control of respiratory disease in cattle at high risk of developing BRD associated with...

  16. 21 CFR 522.2471 - Tilmicosin.

    Science.gov (United States)

    2010-04-01

    ...) Indications for use. For the treatment of bovine respiratory disease (BRD) associated with Mannheimia haemolytica, Pasteurella multocida, and Histophilus somni. For the control of respiratory disease in cattle at... dairy cattle 20 months of age or older. Use of this antibiotic in this class of cattle may cause milk...

  17. Fulminant infection by uncommon organisms in animal bite wounds.

    Science.gov (United States)

    Dutta, J K

    1998-10-01

    In 1995 and 1996, 215 patients exposed to different species of animals were treated at the Amarnath Polyclinic, Balasore, in India. Among them were two children infected by uncommon organisms, i.e., Capnocytophaga canimorsus and Pasteurella multocida; the patients recovered with appropriate antibiotic therapy.

  18. Fulminant infection by uncommon organisms in animal bite wounds.

    OpenAIRE

    Dutta, J. K.

    1998-01-01

    In 1995 and 1996, 215 patients exposed to different species of animals were treated at the Amarnath Polyclinic, Balasore, in India. Among them were two children infected by uncommon organisms, i.e., Capnocytophaga canimorsus and Pasteurella multocida; the patients recovered with appropriate antibiotic therapy.

  19. 21 CFR 558.630 - Tylosin and sulfamethazine.

    Science.gov (United States)

    2010-04-01

    ... grams sulfamethazine. (2) Indications for use-(i) Maintaining weight gains and feed efficiency in the presence of atrophic rhinitis; lowering the incidence and severity of Bordetella bronchiseptica rhinitis... (Pasteurella multocida and/or Corynebacterium pyogenes); for reducing the incidence of cervical lymphadenitis...

  20. Quantification and characterization of enzymatically produced hyaluronan with fluorophore-assisted carbohydrate electrophoresis

    NARCIS (Netherlands)

    Kooy, F.K.; Muyuan Ma,; Beeftink, H.H.; Eggink, G.; Tramper, J.; Boeriu, C.G.

    2009-01-01

    Hyaluronan (HA) is a polysaccharide with high-potential medical applications, depending on the chain length and the chain length distribution. Special interest goes to homogeneous HA oligosaccharides, which can be enzymatically produced using Pasteurella multocida hyaluronan synthase (PmHAS). We

  1. (PCR) for the identification of Mycoplasma capricolum subsp.

    African Journals Online (AJOL)

    ajl yemi

    2011-10-07

    Oct 7, 2011 ... lactalbumin hydrolysate, 1% MEM, 20% decomplemented horse serum, 5% fresh yeast extract, 1% thallium acetate and 0.4% sodium pyruvate) in a high security laboratory. The DNA of. Pasteurella multocida and Mannheimia haemolytica was maintained in the State Key Laboratory of Veterinary Etiological ...

  2. 21 CFR 520.2260b - Sulfamethazine sustained-release boluses.

    Science.gov (United States)

    2010-04-01

    ... pneumonia caused or complicated by Pasteurella multocida; as an aid in the treatment of foot rot, mastitis... sulfamethazine-sensitive organisms as follows: bacterial pneumonia and bovine respiratory disease complex... mastitis and acute metritis caused by Streptococcus spp.)1 (iii) Limitations. After 72 hours, all animals...

  3. Forekomst af resistente bakterier og forbrug af antibiotika til hunde

    DEFF Research Database (Denmark)

    Pedersen, Karl; Pedersen, Kristina; Jensen, Helene

    2007-01-01

    ), Pasteurella multocida (n=25), Bordetella bronchiseptica (n=14), Proteus spp. (n=29), og E. coli (n=449). I undersøgelsen anvendtes data fra VetStat databasen. Størstedelen af de antibiotika, der bruges til hunde er bredspektrede. Penicilliner med udvidet spektrum, cephalosporiner samt sulphonamider...

  4. Management of common animal bites in the emergency centre

    African Journals Online (AJOL)

    Professor Engelbrecht's current fields of interest are bites, stings and poisonous plants. Correspondence to: ... Cross War Memorial Children's Hospital in. Cape Town ... infections. Wound infection with Pasteurella multocida usually occurs early (within 12 ..... Dog bite prevention: an assessment of child knowledge. J Pediatr ...

  5. Aproximación al estudio del vidrio prerromano: los materiales procedentes de la necrópolis ibérica de El Cigarralejo (Mula, Murcia. Composición química de varias cuentas de collar

    Directory of Open Access Journals (Sweden)

    Ruano Ruiz, Encarnación

    1995-06-01

    Full Text Available For the first time, all the glass materials found in the excavations of the Iberian cemetery of El Cigarralejo (Mula, Murcia are studied together including those from the published and the unpublished tombs. The small number of glass items in the grave goods found in this Murcian cemetery let us consider them as prestigious adornments, sometimes with prophylactic purposes. As an hypothesis, we can consider that there was a glass workshop near the studied area. The chemical composition of some necklace beads is presented.

    El texto agrupa por primera vez todos los materiales de vidrio procedentes de las excavaciones de la necrópolis ibérica de El Cigarralejo (Mula, Murcia, tanto de las tumbas publicadas, como inéditas. El escaso número de objetos de vidrio en los ajuares de la necrópolis murciana permite considerarlos como adornos de prestigio y en algún caso con fines profilácticos. Sólo como hipótesis debemos considerar la existencia de un taller cercano al área estudiada. Se presenta la composición química de algunas cuentas de collar.

  6. Caracterización y estado de conservación de vidrios tardorromanos del Museo Arqueológico Regional de Madrid procedentes de las necrópolis de Cubas de la Sagra

    Directory of Open Access Journals (Sweden)

    Fernando Agua

    2015-03-01

    Full Text Available Se ha caracterizado un conjunto de vidrios tardorromanos hallado en las necrópolis de Cubas de la Sagra y depositado actualmente en el Museo Arqueológico Regional de Alcalá de Henares (Madrid. Dicho conjunto procede del yacimiento de Camino de Santa Juana, localizado en el Sur de la Comunidad de Madrid. Los objetivos consistieron en determinar, por un lado, la composición química y los cromóforos responsables de la tonalidad de los vidrios; y por otro lado, evaluar su estado de conservación para seleccionar la estrategia de conservación preventiva más adecuada para su depósito o exposición en el museo. En el primer caso se analizaron un total de 14 muestras procedentes de ambas necrópolis; y para evaluar su estado de conservación se analizaron muestras de restos del sedimento que circundaba los vidrios para determinar su pH, sus fases mineralógicas y su influencia en el grado de deterioro de los vidrios. El estudio se ha llevado a cabo mediante técnicas convencionales: lupa binocular, espectrometría de fluorescencia de rayos X, difracción de rayos X, microscopía electrónica de barrido de emisión de campo con microanálisis de dispersión de energía de rayos X y espectrofotometría visible. Los resultados han servido para contextualizar arqueométricamente los vidrios en el conjunto de vidrios tardorromanos de la Península Ibérica analizados hasta el momento.

  7. Cobre para los muertos. Estudio arqueométrico del material metálico procedente del monumento megalítico prehistórico de Castillejo del Bonete (Terrinches, Ciudad Real

    Directory of Open Access Journals (Sweden)

    Ignacio MONTERO RUIZ

    2014-06-01

    Full Text Available Castillejo del Bonete es una cueva que fue utilizada y adaptada como monumento funerario durante la Prehistoria reciente. Abundantes piezas metálicas en óptimo estado de conservación se han recuperado de los túmulos construidos encima de la cueva, tanto en el interior de tumbas como fuera de ellas. El objetivo de este trabajo es presentar la colección metálica del yacimiento recuperada hasta finales de 2012. También el estudio arqueometalúrgico de varias de las piezas y una interpretación del conjunto en relación a su ámbito cultural y territorial. La investigación además incorpora datos inéditos de El Acequión, Albacete, para proporcionar una perspectiva comparativa sobre la procedencia del metal en la Edad del Bronce con los datos disponibles del área argárica. Las piezas metálicas son explicadas en sus respectivos contextos arqueológicos antes de ser analizadas por diferentes métodos y técnicas: isótopos de plomo, espectrometría por fluorescencia de rayos X, microscopía electrónica de barrido con microanálisis por espectrometría de dispersión de energías de rayos X, metalografía y análisis de microdureza. Los resultados revelan tipos y procesos metalúrgicos característicos del Calcolítico y fases antiguas de la Edad del Bronce. En general son piezas sin estaño pero con alto contenido en arsénico, procedentes en buena parte del área de Linares.

  8. Avian cholera

    Science.gov (United States)

    Friend, Milton

    1999-01-01

    Avian cholera is a contagious disease resulting from infection by the bacterium Pasteurella multocida. Several subspecies of bacteria have been proposed for P. multocida, and at least 16 different P. multocida serotypes or characteristics of antigens in bacterial cells that differentiate bacterial variants from each other have been recognized. The serotypes are further differentiated by other methods, including DNA fingerprinting. These evaluations are useful for studying the ecology of avian cholera (Fig. 7.1), because different serotypes are generally found in poultry and free-ranging migratory birds. These evaluations also show that different P. multocida serotypes are found in wild birds in the eastern United States than those that are found in the birds in the rest of the Nation (Fig. 7.2).

  9. Nueva estela procedente de Libia (La Rioja

    Directory of Open Access Journals (Sweden)

    Beltrán Lloris, Francisco

    2005-12-01

    Full Text Available Note on a decorated stela from the so called 'Herramélluri workshop' (La Rioja in Libia bearing a Latin inscription with a Celtic name (Gustuna not attested until now.Nota sobre una nueva inscripción latina realizada sobre una estela decorada del llamado "taller de Herramélluri" (La Rioja, la antigua Libia, con un nombre céltico no atestiguado hasta ahora: Gustuna.

  10. Evaluación de la concentración de mercurio en arroz (Oryza sativa crudo y cocido procedente del municipio de San Marcos- Sucre y zona aurífera del municipio de Ayapel - Córdoba

    Directory of Open Access Journals (Sweden)

    Marcela P. Argumedo G.

    2015-08-01

    Full Text Available Introducción: Los metales se encuentran en todos los alimentos, siendo de mayor preocupación la presencia de metales tóxicos como el mercurio, debido a los efectos adversos que causa en la salud del hombre, lo que lo ha convertido en un grave problema de salud pública. Objetivo: Evaluar la concentración de mercurio en arroz (Oryza sativa crudo y cocido procedente del municipio de San Marcos - Sucre y zona aurífera del municipio de Ayapel - Córdoba. Metodología: El presente estudio es de tipo exploratorio y experimental. La toma de muestras fue realizada en tiempo de recolección del arroz (septiembre y se tomaron tres repeticiones de cada tipo o variedad de arroz (Fedearroz 2000 - LD 473. La cocción del alimento fue realizada en el laboratorio en condiciones similares a las utilizadas por habitantes de las comunidades donde fueron recolectadas las muestras. Para los análisis de relación estadística entre los tratamientos de cocción y la concentración de mercurio total en muestras, fue realizado un análisis de correlación simple. La determinación de diferencias estadísticamente significativas entre las muestras de arroz crudo y cocido fue realizada mediante un t-test y Anova. Resultados: Se presentaron concentraciones bajas de mercurio total y metilmercurio en las muestras de arroz crudo y cocido. Además, fue detectado que el proceso de cocción del alimento disminuye las concentraciones de HgT, en los diferentes tratamientos de tiempo de cocción. Conclusiones: Los habitantes de los municipios en estudio están expuestos a concentraciones mínimas de mercurio que podrían ser perjudiciales para su salud, debido a la alta ingesta de este cereal en la dieta de las comunidades.

  11. Análisis iconográfico preliminar de fragmentos de las vasijas estilo códice procedentes de Calakmul A preliminary iconographic analysis of codex style vessels from Calakmul

    Directory of Open Access Journals (Sweden)

    Ana García Barrios

    2011-01-01

    Full Text Available Las cerámicas estilo códice fueron elaboradas durante la segunda mitad del siglo VII y principios del VIII d.C. en un área de la Cuenca del Mirador que abarca ciudades como Nakbé, Tintal, Pacaya y otras como Calakmul. En este último lugar se han recuperado en los últimos años más de 700 fragmentos cerámicos que tienen un gran parecido estilístico con muchas de las temáticas de las vasijas que se encuentran en colecciones privadas y museos, todas ellas procedentes del saqueo masivo de la década de los setenta. Entre los temas reconocidos en los fragmentos de Calakmul se encuentran diferentes episodios del mito del Dios del Maíz, así como el lanzamiento del Bebé Jaguar y otros episodios donde participa el Dios Viejo, así como el título ampliamente empleado en estas cerámicas que designa a un grupo de poder conocido como chatan winik.The codex style vessels were elaborated during second half of 7th century and the beginning of 8th century A.C., in the area of "Cuenca del Mirador" that includes cities like Nakbé, Tintal, Pacaya and Calakmul. In this city, in the past last years, there has been a recovery of more than 700 ceramic fragments, which have a great stylistic similarity with many of the thematic ceramics which are in private collections and museums, all of them coming from the massive sacking during 70's years. Between the subjects recognized in the fragments of Calakmul, it can be found different episodes from the myth of God of maíz, as well as the launching of "baby jaguar" or Unen B'ahlam, along with other subjects where the Old God participates, and the title widely used in these vessels designates a group of power known as chatan winik.

  12. Caracterización físico - química de las fibras obtenidas del pseudotallo de la planta de banano (Musa paradisiaca, procedente del cantón El Guabo de la provincia de El Oro

    Directory of Open Access Journals (Sweden)

    Linda Maldonado

    2016-06-01

    Full Text Available Los residuos de plantaciones bananeras a nivel mundial, representan en la actualidad una alternativa más viable en la elaboración de materia prima para la industria textil, construcción y la elaboración de artesanías en general. En este trabajo, se presentan los resultados preliminares de la Caracterización fisico - químicas de las fibras obtenidas del pseudotallo de banano (Musa paradisiaca. Se trabajó con pseudotallos de la variedad Filipino, procedente de la Bananera "Yesi", ubicada en la parroquia El Retiro, del cantón El Guabo, provincia de El Oro - Ecuador. Se empleó métodos electrométricos para la determinación del pR, y 10 descrito por la AOAC para el porcentaje de fibras, celulosa y densidad aparente. Los resultados se obtuvieron por triplicado para su posterior análisis estadístico con el programa InfoStat 2010, en la determinación de la medias y los índices de confianza de los datos obtenidos. El pseudotallo presentó un 16.28 % de fibras; 9.53% de densidad aparente; y un 30.1 % de celulosa, resultados que le confieren a este residuo, una aceptable condición de porosidad y muy buen porcentaje de celulosa, que favorece la compactación del material en el proceso de fabricación de aglomerados. Considerando que el 67% del volumen total de producción bananera 10 constituyen sus desechos (pseudotallo, hojas y raquis, este estudio promete ser un plus en los ingresos de los campesinos del sector, con la finalidad de otorgar valor agregado y ecológico a estos residuos.

  13. ¿La Apoteosis de Heracles o una escena de Apobates? A propósito de una cratera de campana procedente de La Loma del Escorial de Los Nietos (Cartagena, Murcia

    Directory of Open Access Journals (Sweden)

    Rodríguez Pérez, Diana

    2014-12-01

    Full Text Available The aim of this article is to assess the traditional iconographic identification of the obverse of a 4th century Greek bell crater from the Iberian site of La Loma del Escorial de Los Nietos (Cartagena, Murcia. The scene has been identified as an apotheosis of Heracles. Nevertheless, a detailed analysis of its iconography and of a feature neglected in the previous study of the vase by its excavators —the remains of a shield— make it possible to argue in favor of an apobates race instead —the only scene of this type attested in the Iberian Peninsula. I present here an analysis of both iconographic motifs —the apotheosis of Heracles and the apobates race— that will reveal interesting findings on the ways in which images and iconographic types acquire meaning. It also sheds light on the kind of images favored by the receptors of these vases in the Peninsula — the Iberians. An up-to-date catalogue of Attic vases depicting each theme is included.En el presente artículo se revisa la identificación iconográ- fica de la cara A de una cratera griega fragmentaria del siglo IV a.C. procedente del yacimiento ibérico de La Loma del Escorial de Los Nietos (Cartagena, Murcia. La escena se ha identificado tradicionalmente como la apoteosis de Heracles, no obstante, tras un análisis detallado de la misma, en particular del resto de un escudo previamente inadvertido que porta el personaje principal, creemos que la iconografía se corresponde con la del apobates victorioso, un unicum en la Península Ibérica. Presentamos un análisis de ambos motivos iconográficos que revelará interesantes conclusiones sobre el funcionamiento de los tipos iconográficos y mecanismos de creación de significado en la pintura de vasos de la época, así como sobre el tipo de imágenes estimadas por los receptores de esas piezas en la Península Ibérica, los íberos. Se incluye también un catálogo actualizado de los vasos áticos que portan ambos temas.

  14. Potencial productivo de esquejes de boniato (Ipomoea batatas (L. Lam. procedentes de una nueva tecnología de producción de semilla agámica.

    Directory of Open Access Journals (Sweden)

    Roberto Díaz Hernández

    2012-01-01

    Full Text Available RESUMEN El trabajo se realizó en el Instituto de Investigaciones en Viandas Tropicales durante el periodo de septiembre del 2008 a abril 2009, con los objetivos de determinar la cantidad de esquejes que proporciona el vivero y la frecuencia de corte, así como comparar el potencial productivo de cada corte. El Experimento consistió en el montaje de cámaras de aproximadamente 1m de ancho y 15m de largo, se utilizaron raíces tuberosas del clon comercial INIVIT B2-2005 como material de plantación. Se comprobó que durante la fase del vivero este proporcionó un total de nueve cortes tanto en la época frío como en primavera con un total de 764 y 1390 esquejes respectivamente. Después de cortados los esquejes fueron llevados al campo donde se realizó un estudio para determinar los rendimientos correspondientes a cada tratamiento (número de cortes. Se utilizó un diseño de bloques al azar con cuatros réplicas. Los resultados mostraron que en pequeñas áreas de viveros se puede obtener un número significativo de esquejes y de muy buena calidad productiva además de que los esquejes procedentes de diferentes momentos de cortes presentan igual comportamiento en cuanto al rendimiento. Productive potential of sweetpotato (Ipomoea batatas (L. Lam cuttings from a new technology for agamic seed production. ABSTRACT The work was conducted at the Research Institute of Tropical Root and Tuber Crops from September 2008 to April 2009 with the objectives of determining the amount of cuts provided by the nursery and cut frequency, as well as, to compare the productive potential of each cut. The experiment consisted of mounting chambers about 1m wide and 15m long. Tuberous roots from the commercial clone INIVIT B2-2005 were used as planting seeds. During the nursery stage, nine cuts were provided in the winter and rainy seasons with a total of 764 and 1390 cuttings respectively. Cuttings were transferred to field conditions to determine corresponding

  15. Efecto de la temperatura y tiempo de tostado en los caracteres sensoriales y en las propiedades químicas de granos de cacao (Theobroma cacao L.) procedente de Uchiza, San Martín – Perú para la obtención de NIBS

    OpenAIRE

    Aldave Palacios, Gladis Josefina

    2016-01-01

    Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...

  16. Qualidade fisiológica e tratamentos de sementes de cedrela fissilis procedentes do sul do Brasil Physiological quality seeds and treatments of cedrela fissilis seeds from south of Brazil

    Directory of Open Access Journals (Sweden)

    Marília Lazarotto

    2013-04-01

    Full Text Available Os objetivos deste trabalho foram: avaliar a qualidade fisiológica de sementes de cedro (Cedrela fissilis, procedentes de localidades do sul do Brasil, através de testes de vigor e avaliar diferentes tratamentos nas sementes para controle de patógenos e para promoção da germinação da espécie. Para tanto, foram utilizadas seis amostras com procedências dos Estados do Rio Grande do Sul, Santa Catarina e Paraná, as quais foram submetidas à determinação de teor de água, teste de germinação e primeira contagem, envelhecimento acelerado (testando períodos de exposição às condições de envelhecimento, emergência em viveiro e tratamento de sementes. Os tratamentos utilizados para controle de patógenos foram: testemunha (T0; físico com calor seco a 70°C±3°C por 48 horas (T1; extrato aquoso de alho (Allium sativum (T2; biológico à base de Trichoderma spp. - Agrotich Plus® (T3; e químico com fungicida protetor Captan (T4. A germinação variou de 56 a 87%; o período de 48 h sob temperatura de 41 °C foi o mais eficiente para estratificar as amostras em níveis de vigor; a emergência variou de 51 a 88% e as variáveis de desempenho de plântulas analisadas conseguiram estratificar as amostras em níveis de vigor. Quanto ao tratamento de sementes, o calor seco e o tratamento à base de extrato de alho se mostram eficientes no controle de microrganismos em semente de cedro, sem prejuízos ao vigor destas.The objectives of this study were to evaluate the physiological quality of Cedrela fissilis seeds, from different origins, using different vigor tests and evaluating different seeds treatments for control of pathogens and to promote the germination of the species. Therefore, six samples from different places in states of Rio Grande do Sul, Santa Catarina and Paraná were used, which were subjected to determination of water content, germination and first count of germination, accelerated aging (testing different periods

  17. Analysis of the generation of electric energy through the use of biogas obtained from sanitary fillings in Mexico; Analisis de la generacion de energia electrica a traves de biogas procedente de rellenos sanitarios en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Cerda Sauvage, Tania Kalinka [Facultad de Ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2004-06-15

    tecnologia en nuestro pais. En la parte introductoria de este trabajo se plantean algunas causas que han favorecido el desarrollo de tecnologias como la aqui planteada. En la primera parte se expone que es el biogas y que condiciones son necesarias para su produccion lo cual explica la produccion de biogas en los rellenos sanitarios, ademas se describe la distribucion de los residuos solidos que dan origen a la situacion actual de los rellenos sanitarios y el proceso de produccion de biogas en estos. El trabajo continua con una descripcion del proceso de generacion de energia electrica a traves del biogas procedente de rellenos sanitarios indicandose las condiciones necesarias para que el relleno cumpla sus funciones basicas; siguiendo nuestro proceso hasta la obtencion del producto final, energia electrica. Para la descripcion del proceso y analizar algunos factores que intervienen me ha parecido conveniente incluir los principales aspectos de una planta ubicada en Monterrey, que ocupa esta tecnologia. Este proyecto muestra de una forma tangible las barreras a las que esta tecnologia se enfrenta, asi como sus principales ventajas y desventajas. Se exponen las limitantes de esta tecnologia en los aspectos tecnologicos, economicos, politicos y sociales, las barreras que pueden y deben vencerse asi como las razones que justifican el esfuerzo para vencerlas. Finalmente se presentan las conclusiones a que conduce asi como los comentarios y sugerencias con respecto al tema.

  18. Intoxicação experimental em coelhos por Mascagnia sp (Malpighiaceae procedente do Estado de Santa Catarina Experimental poisoning in rabbits by Mascagnia sp (Malpighiaceae collected in the State of Santa Catarina, southern Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1998-04-01

    Full Text Available As folhas novas ou a brotação e as folhas maduras de Mascagnia sp, arbusto escandente da família Malpighiaceae, procedente de Santa Catarina, planta comprovadamente tóxica a bovinos, foram administradas sob forma de pó suspenso em água por sonda gástrica, até poucas semanas após a sua colheita, a 45 coelhos adultos. A planta colhida em três municípios do Estado de Santa Catarina, dessecada na sombra a temperatura ambiente, demonstrou possuir toxidez também para essa espécie animal. Porém a sua toxidez para coelhos foi muito variável. Os experimentos realizados não permitem concluir que a procedência da planta, o seu estado de evolução ou a época do ano da colheita, sejam fatores que influenciam a sua toxidez. Já em relação ao quadro clínico, os achados de necropsia e histopatológicos, a planta teve um comportamento muito constante. Os coelhos mostraram os primeiros sintomas de intoxicação entre 3 horas e 24h49min após o começo da administração da planta. A evolução do quadro clínico foi de 1 a 4 minutos. Os sintomas consistiram sempre em que o animal subitamente começava a fazer movimentos desordenados, geralmente violentos; finalmente ficava caído, tinha respiração dispnéica com movimentos respiratórios cada vez mais espaçados, dava alguns gritos e logo morria. Os achados de necropsia se resumiram em congestão hepática e esplenomegalia; o fígado ao corte tinha a lobulação nítida, às vezes com o centro dos lóbulos mais claro. Os exames histopatológicos revelaram alterações regressivas e circulatórias no fígado, rim e baço. A planta moída guardada em vidros hermeticamente fechados com tampa plástica e à temperatura ambiente, submetida a experimentos em outros 22 coelhos 1 ano ou mais após sua colheita, demonstrou ter perdido variavelmente em toxidez.Freshly dried and ground young leaves or sprouts and mature leaves of Mascagnia sp, a creeping shrub of the Malpighiaceae family from Santa

  19. In vitro screening of methanol plant extracts for their antibacterial activity

    International Nuclear Information System (INIS)

    Hussain, T.; Arshad, M.; Khan, S.; Sattar, H.

    2011-01-01

    The purpose of this study was to observe the antibacterial activity of aqueous methanolic extracts of 10 plants against 2-gram negative bacteria (Pasteurella multocida, Escherichia coli) and 3-gram positive bacteria (Bacillus cereus, Staphylococcus aureus, Corynebacterium bovis) by using disc diffusion method. The minimum inhibitory concentration (MIC) was determined by agar well diffusion method and agar dilution method. All the bacteria were susceptible to different plant extracts. Lawsonia inermis, Embellia ribes and Santalum album showed antibacterial activity against all the tested bacteria. The extract of Santalum album showed maximum antibacterial activity of the 10 plant extracts used. Bacillus cereus and Pasteurella multocida were the most sensitive bacteria against most of the plant extracts. It is clear from the results of the present studies that the plant extracts have great potential as antimicrobial compounds against bacteria. However, there is a need of further research to isolate the active ingredients for further pharmacological evaluation. (author)

  20. Bacteremia and Peritonitis in a Patient With Cirrhosis: A Life-Threatening Case From a Prick of a Cactus

    Directory of Open Access Journals (Sweden)

    Jodi-Anne Wallace MD

    2017-08-01

    Full Text Available A 58-year-old male with nonalcoholic steatohepatitis cirrhosis presents with right lower extremity cellulitis, abdominal tenderness, and severe sepsis after sustaining puncture injury from a cactus on a property with feral cats. Blood cultures and diagnostic paracentesis were consistent with spontaneous bacterial peritonitis due to Pasteurella multocida , a gram-negative coccobacillus found in the respiratory tract of domestic animals. The patient received timely antibiotic coverage with resolution of spontaneous bacterial peritonitis and sepsis after 14-day treatment. This case emphasizes the life-threatening nature of systemic Pasteurella multocida infection as well as an indirect way of acquiring a zoonotic infection in a patient with end-stage liver disease.

  1. Avian cholera causes marine bird mortality in the Bering Sea of Alaska

    Science.gov (United States)

    Bodenstein, Barbara L.; Kimberlee Beckmen,; Gay Sheffield,; Kathy Kuletz,; Van Hemert, Caroline R.; Berlowski-Zier, Brenda M.; Shearn-Bochsler, Valerie I.

    2015-01-01

    The first known avian cholera outbreak among wild birds in Alaska occurred during November 2013. Liver, intestinal, and splenic necrosis consistent with avian cholera was noted, and Pasteurella multocida serotype 1 was isolated from liver and lung or spleen in Crested Auklets (Aethia cristatella), Thick-billed Murres (Uria lomvia), Common Eider (Somateria mollissima), Northern Fulmars (Fulmarus glacialis), and Glaucous-winged Gulls (Larus glaucescens).

  2. Birds in Human Modified Environments and Bird Damage Control: Social, Economic, and Health Implications

    Science.gov (United States)

    1989-12-01

    Paratyphoid (Salmonella typhimurium) x x x + + .+ + + . + + + + Pasteurellasis (Fowl cholera ) (Pasteurella multocida) x x...enteritis (Clostridlum colinum) x 0 0 Vibriosis ( Vibrio fetu) x 30 Table 4 (ContWd Carriers r. .14 0 C c to to z ca -W V 0 4 w .,.4 ". Ca 0 3d ca DI .C...endemic vector of EEE in North America (Reeves et al. 1958, Howard and Wallis 1974). This species breeds in freshwater swamps from the Gulf of Mexico

  3. Occurrence of antimicrobial resistance in bacteria from diagnostic samples from dogs

    DEFF Research Database (Denmark)

    Pedersen, Karl; Pedersen, Kristina; Jensen, Helene

    2007-01-01

    Pseudomonas aeruginosa, 25 Pasteurella multocida, 29 Proteus spp. and 449 Escherichia coli isolates from clinical submissions from dogs were determined by a broth-dilution method for determination of minimal inhibitory concentration. Data for consumption of antimicrobials were retrieved from Vet....... intermedius and Proteus isolates. Conclusions: This investigation provided data on occurrence of antimicrobial resistance in important pathogenic bacteria from dogs, which may be useful for the small animal practitioner. Resistance was low to the compounds that were most often used, but unfortunately...

  4. Isolation of obligate and facultative anaerobic bacteria from feline subcutaneous abscesses.

    Science.gov (United States)

    Hoshuyama, S; Kanoe, M; Amimoto, A

    1996-03-01

    A total of 113 specimens collected from purulent skin lesions of household cats was examined bacteriologically. Ninety seven isolates obtained from 74 specimens (65.5%). Of these, 11 specimens (9.7%) contained obligate anaerobes only, 18 specimens (15.9%) yielded both obligate and facultative anaerobes. In the obligate anaerobes detected, genus Fusobacterium was the most frequently observed and F. nucleatum was most common species. Pasteurella multocida was the facultative anaerobe which was most frequently detected.

  5. Aspectos patológicos e microbiológicos das doenças respiratórias em suínos de terminação no Brasil

    Directory of Open Access Journals (Sweden)

    Marcos A.Z. Morés

    2015-08-01

    Full Text Available Resumo: Para avaliação dos aspectos patológicos e microbiológicos de casos clínicos de doenças respiratórias em suínos de terminação foram analisados 75 suínos doentes oriundos de 36 lotes. Suínos que apresentavam sinais clínicos respiratórios evidentes foram necropsiados para avaliação macroscópica e colheita de amostras para análise histopatológica e microbiológica. Foram realizados testes de isolamento bacteriano para as principais bactérias do sistema respiratório dos suínos, PCR para Mycoplasma hyorhinis, imuno-histoquímica para Influenza A, Circovirus suíno tipo 2 e Mycoplasma hyopneumoniae. A sensibilidade antimicrobiana de 24 amostras de Pasteurella multocida tipo A foi avaliada por testes de concentração inibitória mínima para os principais antimicrobianos utilizados em suinocultura. Mycoplasma hyopneumoniae e Pasteurella multocida tipo A foram os agentes infecciosos mais prevalentes. Broncopneumonia supurativa e pleurite foram as principais lesões respiratórias encontradas. Pasteurella multocida tipo A, quando presente, aumentou a extensão das lesões pulmonares. Todas as amostras de Pasteurella multocida testadas foram sensíveis aos antimicrobianos Doxiciclina, Enrofloxacina e Tilmicosina. Em 58% das amostras foi identificado mais de um agente infeccioso, evidenciando a alta prevalência da associação de agentes nas doenças respiratórias de suínos em terminação.

  6. Application of Enrofloxacin and Orbifloxacin Disks Approved in Japan for Susceptibility Testing of Representative Veterinary Respiratory Pathogens

    Science.gov (United States)

    HARADA, Kazuki; USUI, Masaru; ASAI, Tetsuo

    2014-01-01

    ABSTRACT In this study, susceptibilities of Pasteurella multocida, Mannheimia haemolytica and Actinobacillus pleuropneumoniae to enrofloxacin and orbifloxacin were tested using an agar diffusion method with the commercial disks and a broth microdilution method. Good correlation between the 2 methods for enrofloxacin and orbifloxacin was observed for P. multocida (r = −0.743 and −0.818, respectively), M. haemolytica (r = −0.739 and −0.800, respectively) and A. pleuropneumoniae (r = −0.785 and −0.809, respectively). Based on the Clinical and Laboratory Standards Institute interpretive criteria for enrofloxacin, high-level categorical agreement between the 2 methods was found for P. multocida (97.9%), M. haemolytica (93.8%) and A. pleuropneumoniae (92.0%). Our findings indicate that the tested commercial disks can be applied for susceptibility testing of veterinary respiratory pathogens. PMID:25008965

  7. Primer registro de cráneos asignados a Palaeospheniscus (Aves, Spheniscidae procedentes de la Formación Bahía Inglesa (Mioceno Medio-tardío, Chile First record of skulls assigned to Palaeospheniscus (Aves, Spheniscidae from the Bahía Inglesa formation (middle-late Miocene, Chile

    Directory of Open Access Journals (Sweden)

    CAROLINA ACOSTA HOSPITALECHE

    2005-09-01

    Full Text Available Los cráneos de los Spheniscidae (como los de todas las aves, aunque escasos en el registro paleontológico, muestran importantes caracteres a nivel taxonómico. Hasta el momento se conocían solo seis cráneos en todo el mundo: Paraptenodytes antarctica y una nueva especie de Spheniscidae procedentes de las formaciones Gaiman (Mioceno temprano y Puerto Madryn (Mioceno tardío de Argentina, respectivamente; Spheniscus megaramphus y 3S. urbinai de la formación Pisco (Mioceno tardío de Perú, Marplesornis novaezealandiae del Plioceno de Nueva Zelanda y un resto de Sphenicidae cf Spheniscus procedente de la formación Bahía Inglesa (Mioceno medio-tardío. De esta última unidad provienen cinco restos craneanos recientemente descubiertos en la localidad de Caldera (Región de Atacama, Chile, los cuales fueron descritos y asignados preliminarmente a Palaeospheniscus. Estos materiales constituyen el primer registro de cráneos para la especie y significan un importante aporte al conocimiento de la avifauna fósil de Chile y en particular de la formación Bahía InglesaAlthough the skulls of the Spheniscidae are unusual in the paleontologic record, they show important features useful in the systematics of the group, as well as in the rest of the birds. Until now, fossil occurrences were restricted to six skulls: Paraptenodytes antarctica and one new species from the Gaiman formation (Early Miocene and Puerto Madryn formation (late Miocene of Argentina, respectively; Spheniscus megaramphus and S. urbinai from the Pisco Formation (Late Miocene, Perú; Marplesornis novaezealandiae from New Zealand (Pliocene; and Spheniscidae cf. Spheniscus from the Bahía Inglesa Formation (Middle-Late Miocene, Chile. Five new materials have been exhumed from this last unit. These skulls, which come from the Caldera locality (Region of Atacama, Chile, have been preliminarily assigned to Palaeospheniscus (Aves, Spheniscidae, constituting the first skulls described for

  8. VILLA ROMANA DE EL SAUCEDO (TALAVERA LA NUEVA, TOLEDO. ANÁLISIS ARQUEOMÉTRICO DE LAS TESELAS PROCEDENTES DE LOS PAVIMENTOS MUSIVARIOS DEL ESPACIO CONVIVIAL (The Roman Villa of El Saucedo, Talavera la Nueva, Toledo: Archaeometric Analysis of the Tessellae from the Mosaic Pavements of a Convivial Space

    Directory of Open Access Journals (Sweden)

    Raquel Castelo

    2016-09-01

    Full Text Available Presentamos un estudio arqueométrico de un conjunto de teselas procedentes de los mosaicos que solaron algunas de las salas del espacio convivial, en el que pudieron llegar a reunirse hasta un total de 27 comensales. Los datos aportados por la difracción de rayos X y el estudio con microscopio han permitido determinar la composición mineralógica de las teselas y plantear hipótesis sobre su identificación petrográfica; sugiriéndose el empleo de diferentes tipos de rocas (cuarzoarenitas, cuarcitas y mármoles calcáreos que ofrecían una paleta de colores amplia. ENGLISH: We present an archaeometric study of a group of tessellae from the floor mosaics of the Villa de Saucedo’s convivial space (a room with place for 27 guests. Data provided by X-ray diffraction and microscopic examination revealed the mineralogical composition of the tessellae and therefore allowed some hypotheses regarding their petrographic identification. The data suggest the use of different kinds of rocks (quartzarenites, quartzites and calcareous marbles, which allowed for a broad color palette.

  9. First report of a human case of polycystic echinococcosis due to Echinococcus vogeli from neotropical area of Peru, South America Primer reporte de un caso humano de echinococcosis poliquística causada por E. vogeli procedente del área neotropical del Perú, America del Sur

    Directory of Open Access Journals (Sweden)

    José R. Somocurcio

    2004-02-01

    Full Text Available We report a human case of polycystic hidatidosis due to Echinococcus vogeli from Contamana (Department of Loreto village located in the central jungle of Peru. The patient is a 44 year-old lady, teacher, who carried a painless liver mass since a year ago. She was submitted to abdominal surgery and the liver mass was removed and showed multiple cysts containing colorless liquid as is showed in the polycystic hidatidosis. The morphology and measure of the hooks obtained from the liquid contained in the cysts are from Echinococcus vogeli. It is the first report of this parasitism in Perú.Reportamos un caso humano de hidatidosis poliquística debido a Echinococcus vogeli procedente de Contamana (Departamento de Loreto, localidad ubicada en la selva central del Perú. La paciente es una mujer de 44 años de edad, profesora, quien portaba una hepatomegalia no dolorosa de un año de evolución. Sometida a intervención quirúrgica, se removió la masa hepática que macroscópicamente mostró múltiples quistes conteniendo líquido incoloro. El examen microscópico correspondió a una hidatidosis poliquística. El examen y medida de los ganchos obtenidos del contenido de los quistes correspondieron a Echinococcus vogeli. Es el primer reporte de este parasitismo en el Perú.

  10. Morbidade da doença de Chagas: I - Estudo de casos procedentes de vários estados do Brasil, observados no Rio de Janeiro Morbidity of Chagas' disease: I - Study of cases originating from various states of Brazil, observed in Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    J. Rodrigues Coura

    1983-09-01

    Full Text Available Um estudo da morbidade através de exames clínicos, eletrocardiográficos, radiológicos, sorológicos, xenodiagnósticos e outros exames laboratoriais seriados, foi feito em 510 pacientes com sorologia positiva para doença de Chagas, procedentes de vários Estados do Brasil e observados no Rio de Janeiro a partir de 1960. Os pacientes foram classificados, de acordo com a forma clínica, em assintomáticos (forma indeterminada, cardíacos, portadores de "megas" ou com formas clínicas associadas. Foi observada uma prevalência de cardiopatia em 52,1% dos pacientes, de "megas" em 14,3% e de associação entre cardiopatia e "megas" em 10,7% e entre megaesôfago e megacolon em 10,9% dos casos. A forma indeterminada (assintomática foi observada em 39% dos pacientes. A proporção de casos de cardiopatia aumentou progressivamente da 1ª a 5ª décadas de vida, enquanto a dos "megas" continuou aumentando até a 7ª década. Entretanto, em número de casos o pico de ambas as formas ocorreu na 4ª década. Não houve diferenças significativas de formas clínicas com relação ao sexo, apesar de uma discreta predominância de cardiopatia no sexo masculino e de "megas" no sexo feminino. Com relação à raça, entre os pacientes classificados como brancos, pretos e mestiços, não foi possível determinar a significância entre as diversas formas clínicas, por desconhecimento da constituição do universo da procedência de cada paciente. Embora o reduzido número de casos não possa ser considerado como representativo da prevalência das fomas clínicas nas regiões de origem dos pacientes, tomando-se os quatro Estados representados com maior número de casos, verificou-se que as proporções de cardiopatia e "megas" foram respectivamente de 65,7 e 20,1% nos casos procedentes da Bahia, de 55,7 e 14,7% nos de Minas Gerais, de 50,9 e 15% nos de Pernambuco e de 23,3 e 0% nos procedentes da Paraíba. O reduzido número de casos procedentes dos demais

  11. Indução de empiema em ratos através da inoculação pleural de bactérias Experimental empyema in rats through intrapleural injection of bacteria

    Directory of Open Access Journals (Sweden)

    José Carlos Fraga

    2001-12-01

    Full Text Available OBJETIVOS: avaliar a indução experimental de empiema em ratos, através da inoculação intrapleural de duas bactérias (Pasteurella multocida e Staphylococcus aureus, utilizando técnica cirúrgica simples e de fácil execução. MÉTODOS: foram utilizados 24 ratos albinos da raça Wistar, de ambos os sexos, pesando entre 250 e 300g, que, após a anestesia geral, foram submetidos à toracotomia anterior direita, afastamento da musculatura e inoculação de 0,2ml de solução, conforme descrição a seguir: grupo I (n=12, inoculação de Pasteurella multocida, 10(10 unidades formadoras de colônia/ml cultivados em caldo cérebro-coração; grupo II (n=8, inoculação de Staphylococcus aureus, 10(10 unidades formadoras de colônia/ml cultivados em caldo cérebro-coração; e grupo III (n=4, inoculação de caldo cérebro-coração estéril (controle. Os animais foram sacrificados em até 7 dias e a intensidade da reação pleural, analisada macroscopicamente conforme escala padronizada. Também foram avaliados a mortalidade, o volume de líquido na cavidade pleural e o exame bacteriológico (animais mortos e líquido pleural. RESULTADOS: no grupo I (Pasteurella multocida, sete ratos morreram nas primeiras 48 horas de experimento. Cinco ratos foram sacrificados no período programado, mas nenhum deles apresentava empiema. No grupo II (Staphylococcus aureus, somente um animal morreu nas primeiras 24 horas, os outros 7 (88% foram sacrificados e apresentavam empiema. No grupo III, considerados controles, todos os animais sobreviveram, não se observando nenhuma anormalidade torácica ao sacrifício. Analisando conjuntamente os grupos, a indução de empiema esteve associada de maneira significativa à inoculação de Staphylococcus aureus no espaço pleural (p OBJECTIVE: to evaluate empyema formation in rats through the injection of two bacteria (Pasteurella multocida and Staphylococcus aureus, using a simple, easy-to-use surgical technique

  12. Nueva estela decorada procedente de El Viso (Córdoba)

    OpenAIRE

    Iglesias Gil, José Manuel

    2009-01-01

    RESUMEN: El artículo nos ofrece el estudio de una estela inédita hallada en El Viso (Córdoba). La estela se sitúa cronológicamente en la fase orientalizante antigua probablemente en el siglo Vil a. J.C., y geográficamente en la región del suroeste de la Península. Los escudos sin escotadura y la ausencia de cascos en los guerreros concretan más su área de dispersión entre el Guadiana y el Guadalquivir. Los motivos representados denotan una procedencia de Oriente con una expansión hacia la Pen...

  13. Nueva estela decorada procedente de El Viso (Córdoba

    Directory of Open Access Journals (Sweden)

    José Manuel IGLESIAS GIL

    2009-10-01

    Full Text Available RESUMEN: El artículo nos ofrece el estudio de una estela inédita hallada en El Viso (Córdoba. La estela se sitúa cronológicamente en la fase orientalizante antigua probablemente en el siglo Vil a. J.C., y geográficamente en la región del suroeste de la Península. Los escudos sin escotadura y la ausencia de cascos en los guerreros concretan más su área de dispersión entre el Guadiana y el Guadalquivir. Los motivos representados denotan una procedencia de Oriente con una expansión hacia la Península Ibérica a través del Mediterráneo.ABSTRACT: The article offers us the study of a unique trail found in El Viso (Córdoba. The trail is situated chronologically around ancient times probably in the VII century B. C , and geographically in the region of the southwest of the Peninsula. The smooth shields and the absence of helmets on the warriors fix their area of dispersion morebetween the Guadiana and the Guadalquivir. The motifs represented indicate that they proceeded from the Orient, extending towards the Iberian Peninsula across the Mediterranean.

  14. Alterações bioquímicas post-mortem de matrinxã Brycon cephalus (Günther, 1869 procedente da piscicultura, mantido em gelo Post-mortem biochemical alterations in aquacultured matrinxã fish Brycon cephalus (Günther, 1869 when stored on ice

    Directory of Open Access Journals (Sweden)

    Gilvan Machado Batista

    2004-12-01

    Full Text Available No presente trabalho, foram estudadas as alterações bioquímicas post-mortem que ocorreram em matrinxã Brycon cephalus (Günther, 1869 procedente da piscicultura e mantido em gelo em Manaus - AM. Foi determinado o tempo de estocagem em gelo por meio das avaliações sensoriais físicas e gustativas, das análises de pH, Nitrogênio das Bases Voláteis Totais (N-BVT e bacteriológicas durante 29 dias. Foram determinados os índices de rigor-mortis, as concentrações de ATP e seus produtos de degradações e o valor K. De acordo com a composição química, o peixe foi classificado como "semi-gordo". Os peixes entraram em rigor-mortis aos 75 minutos após a morte por hipotermia, tendo permanecido durante 10 dias. As avaliações sensoriais (físicas e gustativas mostraram que os peixes apresentaram condição de consumo até 26 dias. As análises de ATP e de seus produtos de degradação mostraram que a referida espécie foi considerada formadora de inosina (HxR, nas condições de experimento. O valor K mostrou que os exemplares de matrinxãs permaneceram "muito frescos" até 16 dias de estocagem em gelo, concordante com a avaliação sensorial gustativa.Post-mortem biochemical alterations in aquacultured matrinxã fish Brycon cephalus (Günther, 1869 when stored on ice in Manaus-AM, were studied in this paper. The storage time on ice was determined through tasting and physical sensory evaluations, pH, total volatile bases nitrogen (TVB-N and bacteriological analyses during 29 days. Rigor-mortis index, ATP-related compounds and K value were also determined. Chemical composition demonstrated that fish was classified as "semi-fat". The specimens presented rigor-mortis 75 minutes after death caused by hypothermia and remained that way for 10 days. Shelf life time on ice was 26 days, according to sensory evaluations, pH, TVBN determinations and bacteriological analyses. ATP-related compounds pointed out that the referred species was considered to

  15. INTERPRETACIÓN DE LA COSMOVISIÓN AMAZÓNICA SHUAR A TRAVÉS DE UN MONOLITO ANTROPOZOOMORFO PROCEDENTE DE WAPULA (MORONA SANTIAGO, ECUADOR (Interpretation of the Shuar Amazonian Worldview through an Anthropozoomorphic Monolith from Wapula, Morona Santiago, Ecuador

    Directory of Open Access Journals (Sweden)

    Edwin Hernán Ríos Rivera

    2017-06-01

    Full Text Available El presente trabajo pretende introducirse en el proceso cognoscitivo de paradigmas y estructuras teocráticas, posiblemente politeístas —representadas en el código iconográfico, iconológico y morfoespacial— a través del estudio de un monolito de andesita procedente del sitio arqueológico de Wapula (Morona Santiago, Ecuador. La pieza, sin contexto arqueológico conocido pero con una clara iconografía shuar, ha sido seleccionada para hacer un acercamiento a la cosmovisión de este pueblo y la importancia de la figura del uwishin en la misma. El estudio de estas piezas contribuye a la puesta en valor y conservación preventiva de uno de los más importantes bienes culturales del enclave amazónico ecuatoriano. El monolito en cuestión permite entender la cosmovisión del pueblo shuar a través del estudio de sus características, lo cual se vio ampliado con un análisis químico-mineralógico realizado en el Instituto Universitario de Restauración del Patrimonio de la Universidad Politécnica de Valencia (España. ENGLISH: This article is intended to introduce readers to the cognitive processes of potentially polytheistic theocratic structures and paradigms represented in the iconographic, iconological, and morpho-spatial characteristics of an andesite monolith from the archaeological site of Wapula (Morona Santiago, Ecuador. The piece, whose archaeological context is unknown but whose iconography is clearly Shuar, was selected in order to study the worldview of Wapula and the importance of the uwishin figure there. The study of these figures contributes to the valuation and preventative conservation of one of the most important pieces of cultural heritage in the Ecuadorian Amazon. Our analysis of allowed us to understand the Shuar worldview through the analysis of its features; this was amplified by a chemical-mineralogical analysis accomplished in the University Institute of Heritage Restoration, Polytechnic University of Valencia

  16. Efecto de la inoculación con rizobios procedentes de Alberta, Canadá, en sorgo (Sorghum bicolor L. Moench, en condiciones de campo Effect of the inoculation with rhizobia from Alberta, Canada, in sorghum (Sorghum bicolor L. Moench, under field conditions

    Directory of Open Access Journals (Sweden)

    C. J Bécquer

    2011-09-01

    Full Text Available Se realizó un experimento de campo con el objetivo de medir el efecto de cepas de rizobio en las variables agronómicas del sorgo, en las condiciones ambientales de Sancti Spíritus, Cuba. Se utilizaron 10 cepas de Sinorhizobium meliloti, procedentes de ecosistemas ganaderos de Alberta, Canadá; así como cuatro cepas de referencia pertenecientes a diferentes géneros y especies de rizobio, que procedían de la colección de Agriculture and AgriFood Canada. La confección de los inóculos y la inoculación de las semillas se realizaron por métodos estándar. El diseño experimental fue de bloques al azar, con 16 tratamientos y cuatro réplicas. Se evaluó el peso seco aéreo, la longitud del tallo y la longitud de la panoja; además, se calculó el incremento del peso seco aéreo en los tratamientos inoculados con relación al control absoluto. Los resultados demostraron la capacidad de las cepas estudiadas de influir en las variables agronómicas, ya que los tratamientos seleccionados igualaron sus valores a los del control fertilizado y presentaron un incremento de más del 100% del peso seco aéreo, comparado con el control absoluto.A field trial was conducted with the objective of measuring the effect of rhizobium strains on the agronomic variables of sorghum under the environmental conditions of Sancti Spiritus, Cuba. Ten Sinorhizobium meliloti strains, from livestock production ecosystems of Alberta, Canada, were used; as well as four reference strains belonging to different rhizobium genera and strains, which were from the collection of Agriculture and AgriFood Canada. The inoculi confection and seed inoculation were made by standard methods. The experimental design was randomized blocks, with 16 treatments and four replications. The dry aerial weight, stem length and ear length were evaluated; in addition, the increase of aerial dry weight was calculated in the inoculated treatments as compared to the absolute control. The results

  17. Antimicrobial susceptibility monitoring of respiratory tract pathogens isolated from diseased cattle and pigs across Europe: the VetPath study.

    Science.gov (United States)

    de Jong, Anno; Thomas, Valérie; Simjee, Shabbir; Moyaert, Hilde; El Garch, Farid; Maher, Kirsty; Morrissey, Ian; Butty, Pascal; Klein, Ulrich; Marion, Hervé; Rigaut, Delphine; Vallé, Michel

    2014-08-06

    VetPath is an ongoing pan-European antibiotic susceptibility monitoring programme collecting pathogens from diseased antimicrobial non-treated cattle, pigs and poultry. In the current study, 1001 isolates from cattle and pig respiratory tract infections were tested for their antimicrobial susceptibilities. Non-replicate lung samples or nasopharyngeal/nasal swabs were collected from animals with acute clinical signs in 11 countries during 2002-2006. Pasteurella multocida and Mannheimia haemolytica from cattle and P. multocida, Actinobacillus pleuropneumoniae and Streptococcus suis from pigs were isolated by standard methods. S. suis was also isolated from meningitis cases. MICs of 16 antibiotics were assessed centrally by broth microdilution following CLSI recommendations. Results were interpreted using CLSI breakpoints where available. P. multocida (231) and M. haemolytica (138) isolates were all susceptible to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin and trimethoprim/sulfamethoxazole. Resistance to florfenicol and spectinomycin was 0.4% and 3.5% in P. multocida, respectively, and absent in M. haemolytica isolates. Tetracycline resistance was 5.7% and 14.6% for P. multocida and M. haemolytica. In pigs, 230 P. multocida, 220 A. pleuropneumoniae and 182 S. suis isolates were recovered. Resistance to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin, florfenicol, tiamulin and tilmicosin was absent or <1%. Trimethoprim/sulfamethoxazole resistance was 3-6% and tetracycline resistance varied from 14.7% in A. pleuropneumoniae to 81.8% in S. suis. In conclusion, low resistance to antibiotics with defined clinical breakpoints, except for tetracycline, was observed among the major respiratory tract pathogens recovered from cattle and pigs. Since for approximately half of the antibiotics in this panel no CLSI-defined breakpoints were available, setting of the missing veterinary breakpoints is important. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. A longitudinal study of serological patterns of respiratory infections in nine infected Danish swine herds

    DEFF Research Database (Denmark)

    Andreasen, Margit; Nielsen, Jens; Bækbo, Poul

    2000-01-01

    Sixteen litters of seven pigs from each of nine Danish farrow-to-finish herds were followed to investigate the serological patterns caused by natural infection with Mycoplasma hyponeumoniae, Pasteurella multocida toxin and Actinobacillus pleuroneumoniae serotypes 2, 5-7, 12. In seven of the herds......, pigs were followed as two separate cohorts started 4 weeks apart, and in two herds only one cohort was followed. A total of 999 pigs were included in the study. The pigs were blood sampled at weaning and subsequently every fourth week until slaughter. All pigs were examined for antibodies against M....... hyopneumoniae (enzyme-linked immunosorbent assay), P. multocida toxin (enzyme-linked immunosorbent assay) and A. pleuropneumoniae serotypes 2, 5-7, 12 (complement-fixation tests). The most-common pattern (28%) of seroconversion was that of pigs first seroconverting to A. pleuropneumoniae serotype 2, followed...

  19. Antibacterial Activity of the Hydro-Alcoholic Extract of Juglans regia L. Stem Bark on Human Bacterial Infection

    Directory of Open Access Journals (Sweden)

    Moori Bakhtiari N.* PhD,

    2015-12-01

    Full Text Available Aims Bovine mastitis continues to be the most costly disease to the dairy farmers. It dominates in Iran as one of the most prevalent diseases in dairy cattle among the dairy farms. Mastitis treatment with antibiotics leads to the development of antibiotic resistant strains and consumer health problem.This study was performed for the first time to analyze in vitro effects of hydro-alcoholic extract of Juglans regia L. stem bark on 6 mastitis pathogens. Materials & Methods the susceptibility of 6 strains of bacteria (Staphylococcus aureus, Escherichia coli, Klebsiella pneumoniae, Streptococcus spp., Pasteurella multocida and Mannheimia haemolytica were analyzed against hydro-alcoholic extract of Juglans regia L. stem bark with minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC methods. Findings Hydro-alcoholic extract did not have antibacterial effects on E. coli and K. pneumoniae. Minimum inhibitory concentration for S. aureus, P. multocida, M. haemolytica and Streptococcus spp. was 62.5mg/ml of hydro-alcoholic extract. There was not any significant response with concentrations below 100mg/disc on S. aureus, Streptococcus species, P. multocida and M. haemolytica. Minimum bactericidal concentration of this extract was 100mg/ml in all isolates. Conclusion Juglans regia L. have some antibacterial effects on S. aureus, P. multocida, M. haemolytica and Streptococcus species.

  20. Caracterización cultural y morfológica e identificación de diez aislamientos de Fusarium procedentes de semillas de Leucaena leucocephala cv. Perú almacenadas Cultural and morphological characterization and identification of ten Fusarium isolates from stored Leucaena leucocephala cv. Peru seeds

    Directory of Open Access Journals (Sweden)

    J. C Lezcano

    2012-06-01

    Full Text Available El objetivo de este trabajo fue caracterizar cultural y morfológicamente diez aislamientos de Fusarium, obtenidos de semillas de L. leucocephala cv. Perú almacenadas, con vistas a su clasificación taxonómica. Sus cultivos puros se conservaron en tubos Eppendorf con medio Agar Papa y Dextrosa (APD, en cámara fría a 10°C. La siembra de cada aislamiento se realizó en tres placas Petri, esterilizadas, de 9 cm de diámetro; estas contenían, separadamente, los medios APD y Agar Papa Sacarosa (APS, que constituyeron las réplicas; se colocó en su centro un disco micelial de 7 mm de diámetro, procedente de cultivos con 10-15 días de edad, sembrados también en dichos medios. Posteriormente, las placas se sellaron con papel parafinado y se incubaron durante diez días a 25°C, con alternancia de 8 h de luz/16 h de oscuridad, o a oscuridad constante. Las variables culturales medidas fueron: el color de la colonia en el anverso y el reverso, la textura y el crecimiento lineal y aéreo; y como morfológicas se evaluaron: el tamaño, la forma y el color de las estructuras vegetativas y reproductivas que aparecieron en los cultivos. Se utilizó un diseño completamente aleatorizado y los datos se procesaron estadísticamente a través de un análisis descriptivo. Para la identificación de los hongos se utilizaron diferentes claves taxonómicas. Los aislamientos 10, 18 y 29 se correspondieron con las características descritas en la literatura científica para la especie Fusarium oxysporum Schlecht; el 17, el 28 y el 30, con Fusarium sambucinum Fuckel; el 27, con Fusarium semitectum Berk & Rav.; el 25 y el 26, con Fusarium incarnatum (Rob Sacc, y el 31, con Fusarium chlamydosporum Wollenw & Reinking, lo que permitió la identificación de cinco especies de Fusarium asociadas a las simientes almacenadas.The objective of this work was to characterize cultural and morphologically ten Fusarium isolates, obtained from stored Leucaena leucocephala cv

  1. Síndrome de Gianotti-Crosti: aspectos clínicos, laboratoriais e perfis sorológicos observados em 10 casos procedentes de Belém-PA (Brasil Gianotti-Crosti syndrome: clinical, laboratorial features, and serologic profiles of 10 cases from Belém, State of Para, Brazil

    Directory of Open Access Journals (Sweden)

    Daniela A. Lima

    2004-12-01

    Full Text Available FUNDAMENTOS: A síndrome de Gianotti-Crosti (SGC é uma doença rara e autolimitada caracterizada por erupção eritematopapulosa acrolocalizada e simétrica. Relaciona-se, na maioria das vezes, com infecção pelos vírus da hepatite B e Epstein-Barr, porém há poucas publicações relacionando a SGC com herpesvírus humano tipo 6 (HHV6. OBJETIVO: Estudar aspectos clínicos e laboratoriais e investigar a participação de patógenos virais na etiologia de casos de SGC procedentes de Belém-PA. PACIENTES E MÉTODOS: Dez crianças com diagnóstico clínico de SGC foram investigadas no período de agosto de 1996 a dezembro de 2002, utilizando-se provas laboratoriais de rotina e pesquisa de anticorpos séricos específicos para determinados vírus. O diagnóstico de SGC estabeleceu-se quando, além de aspectos clínicos considerados compatíveis, um ou mais dos seguintes critérios estavam presentes: elevação das enzimas hepáticas, linfocitose, positividade sorológica para um ou mais agentes virais ou história de vacinação prévia. RESULTADOS: Seis pacientes (60% apresentaram evidência de infecção primária pelo HHV6 demonstrada pela presença de anticorpos específicos da classe IgM. CONCLUSÃO: A detecção de anticorpos anti-HHV6 da classe IgM em seis dos pacientes apresentados sugere um possível papel etiológico desse vírus na doença, recomendando-se que seja acrescentado ao painel sorológico rotineiramente pesquisado em processos exantemáticos com morfologia sugestiva de SGC.BACKGROUND: Gianotti-Crosti syndrome (GCS is a rare, self-limited disease characterized by a symmetrical erythematopapulous, acral-based eruption. In most cases a definite relationship with a viral infection can be established, especially when hepatitis B or Epstein-Barr viruses are involved. However, few case reports on associations between GCS and human herpesvirus 6 (HHV6 have been published to date. OBJECTIVE: To study clinical and laboratorial aspects

  2. Fatal pneumonia of bighorn sheep following association with domestic sheep.

    Science.gov (United States)

    Foreyt, W J; Jessup, D A

    1982-04-01

    During 1979-1980 acute fibrinopurulent bronchopneumonia resulted in high mortality or total loss of herds of bighorn sheep (Ovis canadensis) in California and Washington. Contact with domestic sheep occurred shortly before the onset of disease in each case. Circumstantial evidence indicated that the apparently healthy domestic sheep transmitted pathogenic bacteria to the bighorns, resulting in mortality. Pasteurella multocida and Corynebacterium pyogenes were isolated from pulmonary tissue of dead bighorns. The presence of domestic sheep may have been an important stress which initiated or compounded the disease.

  3. An Investigation of the Pathology and Pathogens Associated with Porcine Respiratory Disease Complex in Denmark

    DEFF Research Database (Denmark)

    Hansen, Mette Sif; Pors, S. E.; Jensen, H. E.

    2010-01-01

    ), porcine reproductive and respiratory syndrome virus (both European and US type), porcine circovirus type 2 (PCV2), porcine respiratory coronavirus, porcine cytomegalovirus, Mycoplasma hyopneumoniae and Mycoplasma hyorhinis. All cases had cranioventral lobular bronchopneumonia consistent with PRDC....... There was a broad range of microscopical lesions and the cases were characterized as acute (n=10), subacute (n=24) or chronic (n=114) bronchopneumonia. Five bacterial species, five viruses and two Mycoplasma spp. were detected in different combinations. PCV2, M. hyopneumoniae, M. hyorhinis and Pasteurella multocida...

  4. RESPIRATORY SYNDROME: A MAJOR THREAT TO THE LIVESTOCK FARMERS AND ITS ECONOMIC IMPACT

    Directory of Open Access Journals (Sweden)

    A. B. ZAHUR, U. FAROOQ, M. HUSSAIN1, S. H. HASHMI2 AND R. MUNEER

    2007-10-01

    Full Text Available Epidemiology of a respiratory syndrome was studied at Landhi Dairy Colony (LDC, Karachi, Pakistan and its economic impact was estimated. Among 5889 buffaloes examined, 2.3% animals were suffering from this syndrome. From some of the sick animals, Pasteurella multocida, the causative agent of haemorrhagic septicaemia, was isolated. In the present study, an average loss of Rs. 0.2 million per farm was calculated and the extrapolated values for 0.2 and 0.8 million animals present in LDC and other dairy colonies in Karachi were Rs. 225.6 and Rs. 1128.1 million, respectively.

  5. Microbiological and serological monitoring in hooded crow (Corvus corone cornix in the Region Lombardia, Italy

    Directory of Open Access Journals (Sweden)

    Guido Grilli

    2010-01-01

    Full Text Available The health status of 276 hooded crows (Corvus corone cornix from various provinces of Lombardy was monitored for three years. Bacteriological examination detected E. coli (76%, Campylobacter jejuni (17%, Salmonella typhimurium (11.6%, Yersinia spp. (6.5%, Clamydophila abortus and C. psittaci (2.6%; from six birds showing severe prostration Pasteurella multocida was isolated. Virological and serological tests were negative for Avian Influenza virus (AIV, West Nile virus (WNV and only three samples were positive for Newcastle disease virus (NDV but only at serology (titre 1:16.

  6. Biased distribution of DNA uptake sequences towards genome maintenance genes

    DEFF Research Database (Denmark)

    Davidsen, T.; Rodland, E.A.; Lagesen, K.

    2004-01-01

    Repeated sequence signatures are characteristic features of all genomic DNA. We have made a rigorous search for repeat genomic sequences in the human pathogens Neisseria meningitidis, Neisseria gonorrhoeae and Haemophilus influenzae and found that by far the most frequent 9-10mers residing within...... in these organisms. Pasteurella multocida also displayed high frequencies of a putative DUS identical to that previously identified in H. influenzae and with a skewed distribution towards genome maintenance genes, indicating that this bacterium might be transformation competent under certain conditions....

  7. Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil - doi: 10.4025/actascibiolsci.v32i3.5471 Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil - doi: 10.4025/actascibiolsci.v32i3.5471

    Directory of Open Access Journals (Sweden)

    Adolfo Jatoba

    2010-09-01

    Full Text Available This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and the effects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrio alginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by experimental infection with V. alginolyticus. Decrease in the total haemocyte count and increase in the phenoloxidase activity and the serum agglutinate titre (p V. alginolyticus isolated from larvae and juvenile reared marine shrimp.This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and the effects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrio alginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by

  8. Características físico-químicas e produtividade de acessos de Passiflora nitida Kunth procedentes do Centro-Norte do Brasil Physical and chemical characteristics and yield of Passiflora nitida Kunth accessions from North and Central regions of Brazil

    Directory of Open Access Journals (Sweden)

    Nilton Tadeu Vilela Junqueira

    2010-09-01

    Full Text Available O maracujá-suspiro (Passiflora nitida Kunth é uma espécie silvestre amplamente distribuída no território nacional. Tem alto potencial para o melhoramento visando à resistência a diversas doenças que provocam perdas expressivas em cultivos comerciais de maracujá-azedo (Passiflora edulis Sims. Seus frutos são comestíveis e têm elevado valor comercial como fruta fresca. Dessa forma, esse estudo teve como objetivo analisar as características físicas e químicas dos frutos e determinar, em condições de campo, o rendimento de dez acessos de P. nitida procedentes de estados e/ou de diferentes tipos fitofisionômicos das regiões Centro - Norte do Brasil. O experimento foi conduzido na Embrapa Cerrados, localizada em Planaltina, Distrito Federal. Os acessos avaliados foram coletados em Manaus-AM, de capoeira; no Núcleo Rural São José - DF, de chapada e de vereda; no Vale do Amanhecer - DF, de vereda; Jardim Botânico-DF, de Cerrado Stricto Sensu; em Silvânia-GO, de mata ciliar e de chapada; em Itiquira - MT, de Cerrado Stricto Sensu; em Alto Paraíso-GO, de chapada, e em Natividade-TO, de chapada. O delineamento estatístico foi em blocos casualizados, com quatro repetições e três plantas úteis por repetição. As plantas foram propagadas por estacas enraizadas de cada acesso e conduzidas em espaldeiras verticais de 1,80 metro de altura, com irrigação por gotejamento. As avaliações foram feitas durante as colheitas de 2006 e 2007. O acesso do Vale do Amanhecer apresentou o melhor rendimento de frutos. Este acesso pode ser usado no programa de melhoramento visando à inserção de P. nitida no mercado. Também foi possível observar que as fontes provenientes do Cerrado têm características físicas mais desejáveis, produzindo frutos maiores e com melhor rendimento em polpa. Por outro lado, o acesso do Amazonas teve a menor espessura da casca, característica desejável para o mercado de frutas naturais.The passion fruit

  9. Clinical, epidemiological and mycological report on 65 patients from the Eastern Amazon region with chromoblastomycosis Relato clínico, epidemiológico e micológico de 65 pacientes com cromoblastomicose procedentes da Amazônia oriental

    Directory of Open Access Journals (Sweden)

    Carla Andréa Avelar Pires

    2012-08-01

    cromoblastomicose é uma infecção fúngica crônica, causada por fungos da família Dematiaceae, sendo Fonsecaea pedrosoi a mais comum, segundo vários estudos. É mais frequente em países tropicais e o estado do Pará possui grande casuística mundial. A doença é de difícil tratamento e apresenta recorrência frequente. OBJETIVOS: Descrever os aspectos epidemiológicos, micológicos e formas clínicas dos casos de cromoblastomicose procedentes do estado do Pará - Brasil. MÉTODOS: Foram realizados exames micológicos (direto, cultura e microcultivo e observação clinicoepidemiológica em 65 pacientes do Serviço de Dermatologia da Universidade Federal do Pará, atendidos no período de 2000 a 2007. Empregou-se a classificação clínica proposta por Carrión em 1950. RESULTADOS: Os pacientes eram, em sua maioria, homens (93,8%, lavradores (89,2%, faixa etária entre 45-55 anos, com predominância de lesões verruciformes (55,4%, localizadas principalmente nos membros inferiores (81,5%. A maioria dos casos pesquisados (61,5% apresentou um longo tempo de doença, com uma média de 11 anos. O exame micológico direto foi realizado em 86,2% (n=56 dos pacientes; destes, 96,4% (n=54 apresentaram resultado positivo. Foram realizados cultura e microcultivo in vitro de 47 pacientes com exame micológico positivo e os resultados mostraram o Fonsecaea pedrosoi como único agente etiológico identificado nesta amostra. CONCLUSÃO: Este estudo mostrou o quanto a cromoblastomicose ainda compromete a qualidade de vida da população local, principalmente a de indivíduos que trabalham em lavouras, cursando com evolução crônica e sem tratamento eficaz. Observa-se a importância de dar continuidade a este estudo, o que poderá proporcionar novas contribuições clínicas ou epidemiológicas.

  10. Prevalence and Biotyping of Pasteurella Haemolytica Isolates from ...

    African Journals Online (AJOL)

    P. haemolytica isolated from Sahel sheep and goat in Maiduguri was characterized phenotypically. A total of 92 P. haemolytica isolates were obtained from the nasopharyngeal swabs while a total of 15 isolates came from pneumonic lung samples. The results showed that 37(20.22%) P. haemolytica isolates were obtained ...

  11. Isolation of Mannheimia (Pasteurella) haemolytica serotypes A2 and ...

    African Journals Online (AJOL)

    http://dx.doi.org/10.4314/tv.v23i2.4572 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...

  12. Estudio bacteriológico de la Pasteurella pestis

    Directory of Open Access Journals (Sweden)

    Héctor Colichón

    1942-10-01

    Full Text Available Un considerable número de cepas de P. pestis aisladas en el Perú han sido estudiadas bacteriológicamente y los resultados obtenidos pueden ser resumidos en la forma siguiente: 2 cepas entre 148 estudiadas en caldo produjeron franco enturbiamiento del medio. La liquefación de la gelatina, la producción de indol y acetil metilcarbinol fueron negativos para todas las cepas estudiadas. En las condiciones ordinarias puede haber débil producción de SH2 por muy pocas cepas; en cambio, en el agar-Martín-infusión-extracto hepático la producción de SH2 ocurre en el mayor número de cepas, y en un considerable número de ellas en forma notablemente intensa. La temperatura de incubación es decisiva en la producción de hidrógeno sulfurado. Salvo una excepción la reducción del azul de metileno fue negativa para las cepas estudiadas, en esta misma forma la reducción de nitratos a nitritos, la producción de ácido nitroso y reacción del rojo de metilo fueron positivas para las cepas de P. pestis probadas. Todas las cepas estudiadas dieron reacción de catalasas positiva y no desarrollaron en ácido úrico, ni en medio de Koser. La acción de la P. pestis sobre los carbohidratos fue dividida en los siguientes grupos: Carbohidratos atacados constantemente con producción de ácido, no gas; ellos son: glucosa, maltosa, manita, xilosa, salicina y leche tornasolada. Carbohidratos constantemente no atacados, como son: sacarosa, rafinosa, dulcita, inosita, glicerina y dextrina. Carbohidratos, inconstantemente atacados y son: rhamnosa, trehalosa, lactosa, sorbita y arabinosa. En condiciones adecuadas de cultivo, muchas cepas pueden desarrollar en papa, entre las que desarrollaron se observaron algunas que producen pigmentación amarillo-cepia o amarillo dorado. Las pruebas, del ácido nitroso, de la reducción del azul de metileno y de la rahmnosa tienen valor relativo para el Diagnóstico de la Peste, en cambio la glicerina, el indol, la sacarosa, salicina, el agar-sangre-humana y la leche tornasolada son pruebas de valor en la diferenciación de la P. pestis, P. pseudotuberculosis y la P. séptica.

  13. Development of pneumonia in desert bighorn sheep after exposure to a flock of exotic wild and domestic sheep.

    Science.gov (United States)

    Callan, R J; Bunch, T D; Workman, G W; Mock, R E

    1991-03-15

    From 1986 to 1989, 5 desert bighorn sheep (3 Ovis canadensis mexicana and 2 O c nelsoni), ranging in age from 2 to 3 years, were exposed to a flock of exotic wild and domestic sheep to potentially achieve naturally acquired pneumonia. Pasteurella multocida was isolated from nasal samples from 4 of 6 sheep randomly sampled from the flock. Bighorn sheep were exposed individually and each exposure period was a trial. Treatment before and after exposure varied and included combinations of alpha interferon, antibiotics, anti-inflammatory drugs, and vaccines. Treatments were chosen on the basis of recommendations of others for treating pneumonia in desert bighorn sheep as well as our own experience in sheep and cattle. Regardless of treatment used, bighorn sheep in trials 1 to 4 developed signs of pneumonia within 10 to 14 days of exposure. Bighorn sheep in trials 1 to 3 died within 11 to 17 days of initial exposure. In trial 4, the bighorn sheep was isolated from the carrier sheep for treatment of pneumonia on day 14 and died on day 30. Pasteurella multocida was isolated from lung tissue in 3 of the 4 bighorn sheep. On the basis of results of trials 1 to 4, a more in depth clinical study was conducted in trial 5. Nasal and blood specimens were collected prior to and during trial 5 for bacteriologic culturing and serologic testing for bovine viral diarrhea virus, infectious bovine rhinotracheitis, parainfluenza-3 virus, and respiratory syncytial virus.(ABSTRACT TRUNCATED AT 250 WORDS)

  14. Use of radioactively labelled bacteria in animal experiments. 4

    International Nuclear Information System (INIS)

    Flossmann, K.D.; Mueller, G.; Heilmann, P.; Finsterbusch, L.; Hubald, J.

    1981-01-01

    Intratracheal administration of 3 H-, 14 C-, 59 Fe- or 125 I-labelled Pasteurella multocida germs to mice resulted in a more or less differentiated, nuclidedependent distribution of radioactivity in blood, spleen, liver, lung, kidney, and gastrointestinal tract, and was comparable to that following subcutaneous application. The elimination of the antigen from the lungs and other organs could be characterised by an e function, after having reached a certain level of distribution. Some of the antigen was persistent in the lung not less than 14 days. Extremely high activity concentration and persistence was recordable, following the use of 59 Fe complete antigen. Phagocytosis of Pasteurella multocida germs through alveolar macrophages of the lung was secured by autoradiography. Most of the antigen seemed to be discharged from the lungs through the digestive tract. Antigen distribution recorded from immunized and non-immunized mice seemed to suggest that the fate of antigen applied was affected by the kind of immunization. No difference in antigen distribution between non-immunized and subcutaneously immunized animals were provable, following intratracheal antigen application, but is was clearly provable, following intratracheal immunization. Elimination of antigen from the lungs of intratracheally immunized animals was found to occur faster than it did from non-immunized animals. (author)

  15. Septicemic pasteurellosis in free-ranging neonatal pronghorn in Oregon

    Science.gov (United States)

    Dunbar, Michael R.; Wolcott, Mark J.; Rimler, R.B.; Berlowski, Brenda M.

    2000-01-01

    As part of a study to determine the cause(s) of population decline and low survival of pronghorn (Antilocapra americana) neonates on Hart Mountain National Antelope Refuge (HMNAR), Oregon (USA), 55 of 104 neonates captured during May 1996 and 1997 were necropsied (n = 28, 1996; n = 27, 1997) to determine cause of death. Necropsies were conducted on fawns that died during May, June, or July of each year. The objectives of this study were to report the occurrence and pathology of pasteurellosis in neonates and determine if the isolated strain of Pasteurella multocida was unique. Septicemic pasteurellosis, caused by P. multocida, was diagnosed as the cause of death for two neonates in May and June 1997. Necropsy findings included widely scattered petechial and ecchymotic hemorrhages found over a large portion of the subcutaneous tissue, meninges of the brain, epicardium, skeletal muscle, and serosal surface of the thorasic and abdominal cavities. Histological examination of lung tissues revealed diffuse congestion and edema and moderate to marked multifocal infiltrate of macrophages, neutrophils, and numerous bacteria within many terminal bronchioles and alveoli. Pasteurella multocida serotypes A:3,4, and B:1 were isolated from several tissues including lung, intestinal, thorasic fluid, and heart blood. Each B:1 isolate had DNA restriction endonuclease fingerprint profiles distinct from isolates previously characterized from domestic cattle, swan (Olor spp.), moose (Alces alces), and pronghorn from Montana (USA). This is the first report of pasteurellosis in pronghorn from Oregon and the B:1 isolates appear to be unique in comparison to DNA fingerprint profiles from selected domestic and wild species.

  16. Standard PK/PD concepts can be applied to determine a dosage regimen for a macrolide: the case of tulathromycin in the calf.

    Science.gov (United States)

    Toutain, P-L; Potter, T; Pelligand, L; Lacroix, M; Illambas, J; Lees, P

    2017-01-01

    The pharmacokinetic (PK) profile of tulathromycin, administered to calves subcutaneously at the dosage of 2.5 mg/kg, was established in serum, inflamed (exudate), and noninflamed (transudate) fluids in a tissue cage model. The PK profile of tulathromycin was also established in pneumonic calves. For Mannheimia haemolytica and Pasteurella multocida, tulathromycin minimum inhibitory concentrations (MIC) were approximately 50 times lower in calf serum than in Mueller-Hinton broth. The breakpoint value of the PK/pharmacodynamic (PD) index (AUC (0-24 h) /MIC) to achieve a bactericidal effect was estimated from in vitro time-kill studies to be approximately 24 h for M. haemolytica and P. multocida. A population model was developed from healthy and pneumonic calves and, using Monte Carlo simulations, PK/PD cutoffs required for the development of antimicrobial susceptibility testing (AST) were determined. The population distributions of tulathromycin doses were established by Monte Carlo computation (MCC). The computation predicted a target attainment rate (TAR) for a tulathromycin dosage of 2.5 mg/kg of 66% for M. haemolytica and 87% for P. multocida. The findings indicate that free tulathromycin concentrations in serum suffice to explain the efficacy of single-dose tulathromycin in clinical use, and that a dosage regimen can be computed for tulathromycin using classical PK/PD concepts. © 2016 John Wiley & Sons Ltd.

  17. Avian cholera in waterfowl: the role of lesser snow and Ross's geese as carriers of avian cholera in the Playa Lakes region

    Science.gov (United States)

    Samuel, M.D.; Shadduck, D.J.; Goldberg, Diana R.; Johnson, W.P.

    2005-01-01

    We collected samples from apparently healthy geese in the Playa Lakes Region (USA) during the winters of 2000a??01 and 2001a??02 to determine whether carriers of Pasteurella multocida, the bacterium that causes avian cholera, were present in wild populations. With the use of methods developed in laboratory challenge trials (Samuel et al., 2003a) and a serotype-specific polymerase chain reaction method for identification of P. multocida serotype 1, we found that a small proportion of 322 wild birds (cholera infection. Our results confirm the hypothesis that wild waterfowl are carriers of avian cholera and add support for the hypothesis that wild birds are a reservoir for this disease. In concert with other research, this work indicates that enzootic infection with avian cholera occurs in lesser snow goose (Chen caerulescens caerulescens) populations throughout their annual cycle. Although fewer Rossa??s geese (Chen rossii) were sampled, we also found these birds were carriers of P. multocida. Even in the absence of disease outbreaks, serologic evidence indicates that chronic disease transmission and recent infection are apparently occurring year-round in these highly gregarious birds and that a small portion of these populations are potential carriers with active infection.

  18. Prevalência e padrão de distribuição das doenças cerebrovasculares em 242 idosos, procedentes de um hospital geral, necropsiados em Belo Horizonte, Minas Gerais, no período de 1976 a 1997 Prevalence and types of cerebrovascular diseases in 242 hospitalized elderly patients, autopsied in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997

    Directory of Open Access Journals (Sweden)

    José Eymard H. Pittella

    2002-03-01

    Full Text Available OBJETIVO: Descrever a prevalência e os tipos das doenças cerebrovasculares (DCVs em indivíduos idosos necropsiados. MÉTODO: Foram consultados os laudos neuropatológicos de 242 pacientes com idade igual ou superior a 61 anos, procedentes em sua maioria do Hospital das Clínicas da Universidade Federal de Minas Gerais, em Belo Horizonte, Minas Gerais, e necropsiados consecutivamente no período 1976 a 1997. RESULTADO: Os principais grupos de doenças do sistema nervoso central (SNC foram representados por DCVs (71,9%, infecções (12,4%, neoplasias (7,1%, traumatismos crânio-encefálicos (3,7%, doenças nutricionais (2,5% e doenças degenerativas (1,7%. As DCVs mais frequentes foram: aterosclerose (61,2%, doença cerebrovascular hipertensiva (25,6% e infarto cerebral (14,9%. Observou-se aumento da frequência e da gravidade da aterosclerose e da frequência da doença cerebrovascular hipertensiva com o avançar da idade. Houve associação significativa entre doença cerebrovascular hipertensiva e aterosclerose. As DCVs foram clinicamente sintomáticas e as responsáveis diretas pelo óbito em 42,7% e 17,3% dos pacientes, respectivamente. CONCLUSÃO: As DCVs constituíram o principal grupo de doenças do SNC no idoso. A aterosclerose e a doença cerebrovascular hipertensiva foram as principais doenças deste grupo, notando-se aumento de sua frequência com o avançar da idade e associação significativa entre ambas.OBJECTIVE: To describe the prevalence and the types of cerebrovascular diseases (CVDs in autopsied elderly individuals. METHOD: Consecutive clinical charts and neuropathological reports of 242 patients aged 61 years or older were reviewed. The patients died in Hospital das Clínicas, Federal University of Minas Gerais, in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997. RESULTS: The prevalent diseases of the central nervous system (CNS found in decreasing order were: CVDs (71.9%, infections (12.4%, neoplasms (7.1%, head

  19. Mycoplasma ovipneumoniae - A Primary Cause of Severe Pneumonia Epizootics in the Norwegian Muskox (Ovibos moschatus) Population

    Science.gov (United States)

    Handeland, Kjell; Tengs, Torstein; Kokotovic, Branko; Vikøren, Turid; Ayling, Roger D.; Bergsjø, Bjarne; Sigurðardóttir, Ólöf G.; Bretten, Tord

    2014-01-01

    The Norwegian muskox (Ovibos moschatus) population lives on the high mountain plateau of Dovre and originates from animals introduced from Greenland. In the late summers of 2006 and 2012, severe outbreaks of pneumonia with mortality rates of 25-30% occurred. During the 2012 epidemic high quality samples from culled sick animals were obtained for microbiological and pathological examinations. High throughput sequencing (pyrosequencing) of pneumonic lung tissue revealed high concentrations of Mycoplasma ovipneumoniae in all six animals examined by this method and Pasteurella multocida subsp. multocida in four animals, whereas no virus sequences could be identified. Mycoplasma ovipneumoniae and P. multocida multocida were also isolated by culture. Using real time PCR on lung swabs, M. ovipneumoniae was detected in all of the 19 pneumonic lungs examined. Gross pathological examination revealed heavy consolidations primarily in the cranial parts of the lungs and it also identified one case of otitis media. Histologically, lung lesions were characterized as acute to subacute mixed exudative and moderately proliferative bronchoalveolar pneumonia. Immunohistochemical (IHC) examination revealed high load of M. ovipneumoniae antigens within lung lesions, with particularly intensive staining in the neutrophils. Similar IHC finding were observed in archived lung tissue blocks from animals examined during the 2006 epidemic. An M. ovipneumoniae specific ELISA was applied on bio-banked muskox sera from stray muskoxen killed in the period 2004–2013 and sick muskoxen culled, as well as sera from wild reindeer (Rangifer tarandus tarandus) on Dovre and muskoxen from Greenland. Serology and mycoplasma culturing was also carried out on sheep that had been on pasture in the muskox area during the outbreak in 2012. Our findings indicated separate introductions of M. ovipneumoniae infection in 2006 and 2012 from infected co-grazing sheep. Salt licks shared by the two species were a

  20. Mycoplasma ovipneumoniae--a primary cause of severe pneumonia epizootics in the Norwegian Muskox (Ovibos moschatus population.

    Directory of Open Access Journals (Sweden)

    Kjell Handeland

    Full Text Available The Norwegian muskox (Ovibos moschatus population lives on the high mountain plateau of Dovre and originates from animals introduced from Greenland. In the late summers of 2006 and 2012, severe outbreaks of pneumonia with mortality rates of 25-30% occurred. During the 2012 epidemic high quality samples from culled sick animals were obtained for microbiological and pathological examinations. High throughput sequencing (pyrosequencing of pneumonic lung tissue revealed high concentrations of Mycoplasma ovipneumoniae in all six animals examined by this method and Pasteurella multocida subsp. multocida in four animals, whereas no virus sequences could be identified. Mycoplasma ovipneumoniae and P. multocida multocida were also isolated by culture. Using real time PCR on lung swabs, M. ovipneumoniae was detected in all of the 19 pneumonic lungs examined. Gross pathological examination revealed heavy consolidations primarily in the cranial parts of the lungs and it also identified one case of otitis media. Histologically, lung lesions were characterized as acute to subacute mixed exudative and moderately proliferative bronchoalveolar pneumonia. Immunohistochemical (IHC examination revealed high load of M. ovipneumoniae antigens within lung lesions, with particularly intensive staining in the neutrophils. Similar IHC finding were observed in archived lung tissue blocks from animals examined during the 2006 epidemic. An M. ovipneumoniae specific ELISA was applied on bio-banked muskox sera from stray muskoxen killed in the period 2004-2013 and sick muskoxen culled, as well as sera from wild reindeer (Rangifer tarandus tarandus on Dovre and muskoxen from Greenland. Serology and mycoplasma culturing was also carried out on sheep that had been on pasture in the muskox area during the outbreak in 2012. Our findings indicated separate introductions of M. ovipneumoniae infection in 2006 and 2012 from infected co-grazing sheep. Salt licks shared by the two

  1. Effects of Enrofloxacin on Porcine Phagocytic Function

    Science.gov (United States)

    Schoevers, E. J.; van Leengoed, L. A. M. G.; Verheijden, J. H. M.; Niewold, T. A.

    1999-01-01

    The interaction between enrofloxacin and porcine phagocytes was studied with clinically relevant concentrations of enrofloxacin. Enrofloxacin accumulated in phagocytes, with cellular concentration/extracellular concentration ratios of 9 for polymorphonuclear leukocytes (PMNs) and 5 for alveolar macrophages (AMs). Cells with accumulated enrofloxacin brought into enrofloxacin-free medium released approximately 80% (AMs) to 90% (PMNs) of their enrofloxacin within the first 10 min, after which no further release was seen. Enrofloxacin affected neither the viability of PMNs and AMs nor the chemotaxis of PMNs at concentrations ranging from 0 to 10 μg/ml. Enrofloxacin (0.5 μg/ml) did not alter the capability of PMNs and AMs to phagocytize fluorescent microparticles or Actinobacillus pleuropneumoniae, Pasteurella multocida, and Staphylococcus aureus. Significant differences in intracellular killing were seen with enrofloxacin at 5× the MIC compared with that for controls not treated with enrofloxacin. PMNs killed all S. aureus isolates in 3 h with or without enrofloxacin. Intracellular S. aureus isolates in AMs were less susceptible than extracellular S. aureus isolates to the bactericidal effect of enrofloxacin. P. multocida was not phagocytosed by PMNs. AMs did not kill P. multocida, and similar intra- and extracellular reductions of P. multocida isolates by enrofloxacin were found. Intraphagocytic killing of A. pleuropneumoniae was significantly enhanced by enrofloxacin at 5× the MIC in both PMNs and AMs. AMs are very susceptible to the A. pleuropneumoniae cytotoxin. This suggests that in serologically naive pigs the enhancing effect of enrofloxacin on the bactericidal action of PMNs may have clinical relevance. PMID:10471554

  2. Short communication: Interaction of the isomers carvacrol and thymol with the antibiotics doxycycline and tilmicosin: In vitro effects against pathogenic bacteria commonly found in the respiratory tract of calves.

    Science.gov (United States)

    Kissels, W; Wu, X; Santos, R R

    2017-02-01

    Bovine respiratory disease is the major problem faced by cattle, specially calves, leading to reduced animal performance and increased mortality, consequently causing important economic losses. Hence, calves must be submitted to antibiotic therapy to counteract this infection usually initiated by the combination of environmental stress factors and viral infection, altering the animal's defense mechanism, and thus allowing lung colonization by the opportunistic bacteria Mannheimia haemolytica and Pasteurella multocida. Essential oils appear to be candidates to replace antibiotics or to act as antibiotic adjuvants due to their antimicrobial properties. In the present study, we aimed to evaluate the 4 essential oil components carvacrol, thymol, trans-anethole, and 1,8 cineole as antibacterial agents or as adjuvants for the antibiotics doxycycline and tilmicosin against M. haemolytica and P. multocida. Bacteria were cultured according to standard protocols, followed by the determination of minimum inhibitory concentration (MIC) and minimum bactericidal concentration. A checkerboard assay was applied to detect possible interactions between components, between antibiotics, and between components and antibiotics. Doxycycline at 0.25 and 0.125 μg/mL inhibited the growth of P. multocida and M. haemolytica, respectively, whereas tilmicosin MIC values were 1.0 and 4.0 μg/mL for P. multocida and M. haemolytica, respectively. Carvacrol MIC values were 2.5 and 1.25 mM for P. multocida and M. haemolytica, respectively, whereas thymol MIC values were 1.25 and 0.625 mM for P. multocida and M. haemolytica, respectively. Trans-anethole and 1,8 cineole did not present any antibacterial effect even at 40 mM against the investigated pathogens. All minimum bactericidal concentration values were the same as MIC, except when thymol was tested against M. haemolytica, being twice the MIC data (i.e., 1.25 mM thymol). Based on fractional inhibitory concentration checkerboard assay, no

  3. Radioactive rare earths from fallout for study of particle movement in the sea; Etude du mouvement des particules dans la mer a l'aide de terres rares radioactives provenant de retombees; Ispol'zovanie osazhdayushchikhsya pri vypadenii radioaktivnykh redkikh zemel' dlya issledovaniya dvizheniya chastits v more; Estudio del movimiento de las particulas en el mar con ayuda de tierras raras radiactivas procedentes de las precipitaciones

    Energy Technology Data Exchange (ETDEWEB)

    Sugihara, Thomas T [Clark University, Worcester, MA (United States); Bowen, Vaughan T [Woods Hole Oceanographic Institution, Woods Hole, MA (United States)

    1962-01-15

    'interpreter les resultats de cette etude dans le cadre general de la geochimie marine des cations trivalente, et de mettre en evidence les aspects particuliers et l'utilite generale de cet essai d'utilisation des retombees comme indicateurs. (author) [Spanish] En el marco de un vasto estudio sobre la distribucion en el oceano Atlantico de los raclionuclidos de periodo largo procedentes de precipitaciones radiactivas, se han efectuado numerosas mediciones de la concentracion del cerio-144 y del promecio-147. Una comporacion de las variaciones horizontales y verticales de estas concentraciones con las concentraciones del estroncio-90, que fueron medidas al mismo tiempo, demuestra que las tierras rasas suelen abundar menos en las aguas superficiales que los nuclidos que se sabe son solubles. Esta observacion, unida al hecho de que se ha observado a menudo un enriquecimiento de las aguas profundas en tierras raras, permite afirmar que esos elementos experimentan un rapido transporte vertical al fijarse a particulas en vias de sedimentacion. Esta hipotesis es perfectamente compatible con el comportamiento ''radiocoloidal'' caracteristico de las tierras raras al pH del agua de mar. En la memoria se procura interpretar este estudio en el contexto de las propiedades generales de los cationes trivalentes en geoquimica marina; asimismo, se ponen de manifiesto los aspectos caracteristicos y la utilidad general de este ensayo de utilizacion de las precipitaciones como indicadores radiactivos. (author) [Russian] V kachestve chasti podrobnogo issledovaniya raspredeleniya dolgozhivushchikh radioizotopov, osevshikh pri vypadenii v Atlanticheskom okeane, bylo prodelano znachitel'noe chislo zamerov kontsentratsii tseriya-144 i prometiya-147. Sopostavlenie ehtikh kontsentratsij po mere ikh izmeneniya kak v gorizontal'nom, tak i v verti-kal'nom napravleniyakh s odnovremenno zamerennymi kontsentratsiyami strontsiya-90 pokazyvaet, chto redkie zemli nakhodyatsya obychno v men'shikh kolichestvakh na

  4. Rapport for Center for Vildtsundhed 1. halvår 2012

    DEFF Research Database (Denmark)

    Chriél, Mariann; Enemark, Heidi L.; Therkildsen, Ole Roland

    for vurderingen af parasitbelastningen hos raske ederfugle. Redemateriale til undersøgelse af Pasteurella multocida, der forårsager udbrud af fjerkrækolera, fortsættes i et specialestudie af de dyrkbare bakterier. Med henblik på kortlægning af rævens dværgbændelorm (Echinococcus multilocularis) hos mårhund og ræv...... Danmark siden 2000, og det er første gang bændelormen er påvist i jyske ræve. Echinococcus multilocularis kan smitte til mennesker, hvor de i larvestadiet angriber leveren, hvilket kan have fatale følger, så det er vigtigt, at folk er opmærksomme på risikoen og tager deres forbehold. Mennesker smittes...

  5. Aspects relating to use of radioactively labelled bacteria in animal experiments. 7

    International Nuclear Information System (INIS)

    Heilmann, P.; Flossmann, K.D.; Mueller, G.; Finsterbusch, L.

    1983-01-01

    Two different types of aerosol dispensers were used in an aerosol compartment to apply 59 Fe-labelled bacteria (Pasteurella multocida) to SPE Mini-LEWE piglets as well as to conventionally raised piglets and calves. Germ intake was verified by detection of radioactivity in the lungs. Antigen deposition on each lung amounted to 2-3 . 10 8 in mini-piglets, 6-8 . 10 8 in ordinary piglets, and 2 . 10 9 in conventionally raised calves, as determined by SAG-1, a Soviet model of aerosol dispenser. More or less equally high concentrations of aerosol particles were retained in the pulmonary lobes, independent of the animal species used. Antigen intake could not be influenced by addition of skim milk or by restriction of germ suspensions. (author)

  6. [Transformation from chronic subdural hematoma into subdural empyema following cat bites: a case report].

    Science.gov (United States)

    Konno, Takuya; Yamada, Kei; Kasahara, Sou; Umeda, Yoshitaka; Oyake, Mutsuo; Fujita, Nobuya

    2015-01-01

    A 69-year-old man developed motor aphasia and right hemiparesis with severe headache, during the treatment of cellulitis and sepsis due to cat bites. Brain CT showed a low density, crescent-shaped lesion in the left subdural space, which was hypointense on brain diffusion-weighted imaging (DWI). One week later, when his neurological symptoms had worsened, the signal of the subdural lesion had changed to hyperintense on DWI. The lesion was capsule-shaped when enhanced by Gadolinium. The signal changes on DWI of the lesion indicated the existing hematoma had changed to an empyema, or so-called infected subdural hematoma, due to a hematogenous bacterial infection. Pasteurella multocida, a resident microbe in the oral cavity of cats, could be the responsible pathogen in this case. The patient recovered completely after treatment with intravenous high dose antibiotics. This is an important case report describing the transformation from a chronic subdural hematoma into a subdural empyema by DWI.

  7. مطالعه بر روی ایمنی زایی یک واکسن آزمایشی سپتی سمی هموراژیک با ادجوان روغنی در گاو

    Directory of Open Access Journals (Sweden)

    ا. ستوده نیا

    2005-01-01

    Full Text Available An oil adjuvant vaccine (OAV was prepared from a local strain of Pasteurella multocida. Strain 6:B was cultured and inactivated by formalin. Bacterial pellet was prepared by centrifugation and subsequently adjuvanted by Montannide oil ISA-70. A dose of prepared vaccine containing 3ml (2mg dry weight/ml was injected into five calves by IM route. Animals were bled before and at 24, 90, 150, and 200 days post-vaccination. Collected sera were used in passive mouse protection test (PMPT. Active mouse protection test (AMPT was carried out for OAV according to standard method. Results of PMPT showed 100% protection up to 150 days and 66-83% up to 200 days post-vaccination. In AMPT, 4 log of protection was gained. In this experiment the immunity induced by OAV adjuvanted by ISA-70 could protect the calves.

  8. Causes of Pneumonia Epizootics among Bighorn Sheep, Western United States, 2008–2010

    Science.gov (United States)

    Highland, Margaret A.; Baker, Katherine; Cassirer, E. Frances; Anderson, Neil J.; Ramsey, Jennifer M.; Mansfield, Kristin; Bruning, Darren L.; Wolff, Peregrine; Smith, Joshua B.; Jenks, Jonathan A.

    2012-01-01

    Epizootic pneumonia of bighorn sheep is a devastating disease of uncertain etiology. To help clarify the etiology, we used culture and culture-independent methods to compare the prevalence of the bacterial respiratory pathogens Mannheimia haemolytica, Bibersteinia trehalosi, Pasteurella multocida, and Mycoplasma ovipneumoniae in lung tissue from 44 bighorn sheep from herds affected by 8 outbreaks in the western United States. M. ovipneumoniae, the only agent detected at significantly higher prevalence in animals from outbreaks (95%) than in animals from unaffected healthy populations (0%), was the most consistently detected agent and the only agent that exhibited single strain types within each outbreak. The other respiratory pathogens were frequently but inconsistently detected, as were several obligate anaerobic bacterial species, all of which might represent secondary or opportunistic infections that could contribute to disease severity. These data provide evidence that M. ovipneumoniae plays a primary role in the etiology of epizootic pneumonia of bighorn sheep. PMID:22377321

  9. Causes of pneumonia epizootics among bighorn sheep, Western United States, 2008-2010.

    Science.gov (United States)

    Besser, Thomas E; Highland, Margaret A; Baker, Katherine; Cassirer, E Frances; Anderson, Neil J; Ramsey, Jennifer M; Mansfield, Kristin; Bruning, Darren L; Wolff, Peregrine; Smith, Joshua B; Jenks, Jonathan A

    2012-03-01

    Epizootic pneumonia of bighorn sheep is a devastating disease of uncertain etiology. To help clarify the etiology, we used culture and culture-independent methods to compare the prevalence of the bacterial respiratory pathogens Mannheimia haemolytica, Bibersteinia trehalosi, Pasteurella multocida, and Mycoplasma ovipneumoniae in lung tissue from 44 bighorn sheep from herds affected by 8 outbreaks in the western United States. M. ovipneumoniae, the only agent detected at significantly higher prevalence in animals from outbreaks (95%) than in animals from unaffected healthy populations (0%), was the most consistently detected agent and the only agent that exhibited single strain types within each outbreak. The other respiratory pathogens were frequently but inconsistently detected, as were several obligate anaerobic bacterial species, all of which might represent secondary or opportunistic infections that could contribute to disease severity. These data provide evidence that M. ovipneumoniae plays a primary role in the etiology of epizootic pneumonia of bighorn sheep.

  10. Purification, crystallization and preliminary crystallographic characterization of the α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224

    International Nuclear Information System (INIS)

    Okino, Nozomu; Kakuta, Yoshimitsu; Kajiwara, Hitomi; Ichikawa, Masako; Takakura, Yoshimitsu; Ito, Makoto; Yamamoto, Takeshi

    2007-01-01

    Crystallization of the α2,6-sialyltransferase from Photobacterium. Sialyltransferases transfer sialic acid from cytidine-5-monophospho-N-acetylneuraminic acid (CMP-NeuAc) to the nonreducing termini of the oligosaccharyl structures of various glycoproteins and glycolipids. The newly cloned α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224 (from the Vibrionaceae family) is composed of two domains: an unknown N-terminal domain and a catalytic C-terminal domain which shares significant homology with the Pasteurella multocida multifunctional sialyltransferase. The putative mature form of JT-ISH-224 α2,6-sialyltransferase was overproduced in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method at 293 K. The crystal belonged to space group P3 1 21 or P3 2 21, with unit-cell parameters a = b = 90.29, c = 204.33 Å. X-ray diffraction data were collected to 2.5 Å resolution

  11. Clinical and microbiological study of otitis externa in sheep

    Directory of Open Access Journals (Sweden)

    M. I. Al-Farwachi

    2008-01-01

    Full Text Available In this study one hundred Awassi sheep were examined clinically and bacteriologically for isolation and identification of the bacterial agents of otitis externa in sheep. The main clinical signs appeared included weakness, pale mucus membrane, auricular discharge, cough, anorexia, emaciation, and nasal discharge. Results revealed isolation of bacteria from (45% examined swabs. The most being from right ear. Younger animals were more frequently infected than older animals. Pseudomonas aeruginosa, Staphylococcus aureus, Mannheimia haemolytica, Staph. epidermidis, Pasteurella multocida, Streptococcus spp., Acintobacter spp., Escherichia coli and Klebsiella pneumonia were isolated. The results revealed that the most bacterial isolates were resistance to the bactericidal effect of the normal serum included Streptococcus pneumonia, Staphylococcus aureus, Mannheimia haemolytica. While the most bacterial isolates were produced hydroxymate siderophore included Staphylococcus aureus, Mannheimia haemolytica, Streptococcus pneumonia. The obtained results indicated to the importance of determination of serum resistance as a bacterial virulence factor in otitis externa in sheep.

  12. Investigation of genome sequences within the family Pasteurellaceae

    DEFF Research Database (Denmark)

    Angen, Øystein; Ussery, David

    Introduction The bacterial genome sequences are now available for an increasing number of strains within the family Pasteurellaceae. At present, 24 Pasteurellaceae genomes are publicly available through internet databases, and another 40 genomes are being sequenced. This investigation will describe...... the core genome for both the family Pasteurellaceae and for the species Haemophilus influenzae. Methods Twenty genome sequences from the following species were included: Haemophilus influenzae (11 strains), Haemophilus ducreyi (1 strain), Histophilus somni (2 strains), Haemophilus parasuis (1 strain......), Actinobacillus pleuropneumoniae (2 strains), Actinobacillus succinogenes (1 strain), Mannheimia succiniciproducens (1 strain), and Pasteurella multocida (1 strain). The predicted proteins for each genome were BLASTed against each other, and a set of conserved core gene families was determined as described...

  13. Bovine mastitis caused by gram negative bacteria in Mosul

    Directory of Open Access Journals (Sweden)

    S. Y. A. Al-Dabbagh

    2012-01-01

    Full Text Available A total of 90 milk samples were collected from cows with clinical and subclinical mastitis from different areas in Mosul city, in a period from October 2009 to June 2010, for the detection of gram negative bacteriological causative agents. The bacteria were identified using morphological, cultural and biochemical characteristics. thirty tow (35.3% gram negative bacterial isolates were obtained from the total count which included 14 isolates (15.5% for Escherichia coli, 7 isolates (7.7% for Klebsiella spp, 4 isolates (4.4% for Pseudomonas aeruginosa, 3 isolates (3.3% for Enterobacter aerogenes ,2 isolates for Serratia marcescens and one isolates (1.1% for each of Aeromonas hydrophila and Pasteurella multocida. Results of antibiotic sensitivity test indicated that most of these isolates were sensitive to Ciprofloxacin following by Gentamycin and Cotrimoxazole, while most of these organisms were resistant to Ampicillin, the isolates showed different percentages of sensitivity to Doxycycline, Tetracycline, Neomycin and Chloramphenicol.

  14. Dicty_cDB: AFK338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK338 (Link to dictyBase) - - - - AFK338P (Link to Original s...ite) AFK338F 659 AFK338Z 221 AFK338P 880 - - Show AFK338 Library AF (Link to library) Clone ID AFK338 (Link to dic...01175_2502( CP001175 |pid:none) Listeria monocytogenes HCC23, c... 40 0.099 AY714838_16( AY714838 |pid:none) Unculture...A sequence. 44 3.0 1 AE006080 |AE006080.1 Pasteurella multocida PM70 section 47 o... 0.003 BX294148_242( BX294148 |pid:none) Rhodopirellula baltica SH 1 comp... 44 0.005 CP000910_1528( CP00091

  15. Aqueous Humor Antimicrobial Activity: In Vitro Analysis after Topical 0.5% Chloramphenicol Application.

    Science.gov (United States)

    Cagini, Carlo; Dragoni, Annalisa; Orsolini, Giampaolo; Fiore, Tito; Beccasio, Alfredo; Spadea, Leopoldo; Moretti, Amedeo; Mencacci, Antonella

    2017-06-01

    To assess aqueous humor antimicrobial activity in vitro after topical 0.5% chloramphenicol application. This investigation included 63 eyes from 65 cataract surgery patients. The study group of 48 eyes received preoperatively four topical applications of 0.5% chloramphenicol. The control group of 15 eyes was given no topical applications. Aqueous humor samples were collected for in vitro antimicrobial analysis using Streptococcus pneumoniae, Haemophilus influenzae, Moraxella catarrhalis, and Pasteurella multocida organisms by means of disk diffusion test. No inhibition halo was observed around all aqueous humor samples from all chloramphenicol-treated patients, irrespective of the sample quantity added to the paper disks, with no significant difference from aqueous humor from untreated control patients. Aqueous humor displayed no bactericidal effect against any of the microorganisms evaluated after topical 0.5% chloramphenicol application.

  16. Helmintos oxiuridae parasitos de Iguana iguana (Squamata, Lacertilia, Iguanidae procedentes do Brasil

    Directory of Open Access Journals (Sweden)

    P. Breves

    2011-12-01

    Full Text Available The results of a study on nematode fauna occurring in wild iguanas (Iguana iguana from Brazilian Northeast (Alagoas and Maranhão and Central-west (Goiás and Mato Grosso areas were presented. Six adult iguanas, three males and three females, were necropsied and the digestive system removed to examination. All the iguana specimens were heavily parasitized. The helminths diagnosed were: Ozolaimus cirratus in the cecum and colon of five iguanas; Ozolaimus megatyphlon in cecum, colon and rectum of three iguanas; and Alaeuris vogelsangi in the small intestine, cecum, colon and rectum of five animals. Two larvae of Ozolaimus sp. were recovered from the pyloric region of the stomach of one iguana. The three diagnosed species of nematodes were reported for the first time in the Brazilian Central-West region.

  17. Nuevos restos humanos procedentes de la Cueva de la Zarzamora (Segovia, España

    Directory of Open Access Journals (Sweden)

    SALA, N., ALGABA, M., GÓMEZ-OLIVENCIA, A., PABLOS, A., BONMATÍ, A., RODRÍGUEZ, L., GARCÍA, R. y ARSUAGA, J.L.

    2013-01-01

    Full Text Available Once restos humanos, dos dientes y nueve fragmentos del esqueleto postcraneal pertenecientes al tronco, pelvis y pie, han sido recuperados en la cueva de la Zarzamora, situada en el límite meridional de la meseta Castellana (Segovia, España. Los resultados obtenidos del estudio métrico y morfológico permiten inferir que podrían corresponder a un solo individuo con una edad de muerte en torno a los diez años. Los huesos humanos se encontraban englobados en un relleno sedimentario del Pleistoceno superior interpretado como cubil de hienas. No obstante, una datación directa ha proporcionado una fecha de 4.749±34 años BP correspondiente a una fase temprana del Calcolítico. Estos hallazgos son de gran relevancia, teniendo en cuenta la escasez de restos humanos de esta época en esta región de la Península Ibérica.

  18. Producción de pigmentos procedentes de Arthrospira maxima cultivada en fotobiorreactores

    Directory of Open Access Journals (Sweden)

    Lolymar de los Ángeles Romero Maza

    2017-01-01

    Full Text Available El cultivo de cianobacterias, como Arthrospira, puede realizarse en sistemas abiertos y sistemas cerrados o fotobiorreactores. El objetivo de la presente investigación fue evaluar la producción de pigmentos de Arthrospira maxima cultivada en dos tipos de fotobiorreactores. El cultivo se realizó de forma discontinua (Batch bajo ambiente controlado, en fotobiorreactores helicoidales y cilíndricos, durante 30 días, en medio Zarrouk. La determinación de los pigmentos se realizó en las fases de crecimiento exponencial y estacionario. Para los pigmentos liposolubles, la biomasa se sometió a extracción con acetona 90%, y posterior determinación por Cromatografía Líquida de Alta Eficiencia, y para la extracción de los pigmentos ficobiliproteínicos se ensayaron cuatro métodos: 1. regulador de fosfatos/enzimas; 2. solución alcalina, previo tratamiento con CaCl2; 3. buffer de fosfato, previo tratamiento con hielo seco y 4. agua (4ºC, y posterior determinación por Espectrofotometría UV-Visible. Los mayores valores de pigmentos liposolubles fueron obtenidos en los cultivos realizados en fotobiorreactor helicoidal durante la fase exponencial (clorofila a 11,08±0,006 µg mL-1; β-caroteno 1,82±0,003 µg mL-1; zeaxantina 0,72±0,002 µg mL-1; mientras que los mayores contenidos de los pigmentos ficobiliproteínicos se obtuvieron en fotobiorreactor cilíndrico, durante la fase estacionaria, utilizando el buffer de fosfato tratado con hielo seco para la extracción. Dentro de las ficobiliproteínas, fue la ficocianina la que se encontró en mayor proporción (FC = 77,74±0,767 mg L-1, seguido por la aloficocianina y ficoeritrina. Se concluye que la biomasa de Arthrospira maxima presenta potencial biotecnológico por sus altos contenidos de pigmentos.

  19. Complementos alimenticios funcionales: péptidos antihipertensivos procedentes de la leche

    Directory of Open Access Journals (Sweden)

    Gómez Sala B

    2011-09-01

    Full Text Available Los complementos alimenticios representan una importante fuente de nutrientes esenciales y otros elementos. Últimamente, se está produciendo un aumento de su consumo relacionado con la importancia que está adquiriendo el autocuidado de la salud, donde el farmacéutico juega un importante papel. Dentro de esta categoría de sustancias han aparecido recientemente los péptidos bioactivos. Estos péptidos son secuencias de aminoácidos de pequeño tamaño, inactivas dentro de la proteína intacta, pero que pueden ser liberados durante la digestión del alimento en el organismo o por un procesado previo del mismo. Tienen efectos beneficiosos en diversos casos y pueden influir positivamente en la salud de la población. Algunas actividades que han demostrado tener son: antihipertensiva, opiácea, antioxidante, quelante de minerales o inmunomoduladora. De entre los diferentes grupos de péptidos bioactivos, los péptidos antihipertensivos están recibiendo una especial atención debido a la frecuencia de la hipertensión arterial en la población mundial. Estos péptidos obtenidos por fermentación o hidrólisis enzimática han demostrado su actividad antihipertensiva como inhibidores de la enzima convertidora de angiotensina, mediante ensayos in vitro e in vivo en animales de experimentación en pruebas agudas, crónicas y toxicológicas, así como en ensayos clínicos en humanos. Son unos productos de probada seguridad y eficacia. Su aparición como complementos alimenticios permite al farmacéutico tener un recurso terapéutico, que no es de prescripción, para su indicación en aquellos casos en los que se detecten valores de presión arterial que sin llegar a la hipertensión sean susceptibles de una intervención farmacéutica.

  20. Restos óseos humanos procedentes de las sierras de Guasayán

    Directory of Open Access Journals (Sweden)

    Drube, Hilton

    2003-01-01

    Full Text Available Los restos óseos humanos que son objeto del presente informe fueron exhumados en el área pedemontana oriental de las sierras de Guasayán, provincia de Santiago del Estero. La información disponible en cuanto a las condiciones del hallazgo y al contexto inhumatorio no es precisa, si bien corresponden a un sitio de ocupación prehispánico. El análisis e identificación de las piezas óseas permite constatar la presencia de al menos tres individuos en el material esqueletal. En efecto, forman parte del conjunto estudiado tres porciones distales de un mismo elemento esqueletal, en este caso correspondientes al húmero derecho. En la asignación de la edad probable de muerte solamente pudo tomarse como elemento diagnóstico el grado de atrición de las piezas dentales y algunos aspectos morfológicos generales de las piezas presentes. Con los datos obtenidos se infieren edades estimadas para el primer caso en 45-50 años; aproximadamente 30 años en el segundo; en tanto que el tercer caso correspondería a un subadulto. Dos de los individuos presentan rasgos morfoscópicos y métricos correspondientes al sexo femenino, en tanto que no existen elementos suficientes para evaluar la expresión dimórfica en el tercer caso. El neurocráneo correspondiente a uno de los individuos presenta deformación artificial del tipo tabular erecta en su variante plano sagital. Los datos recabados en el presente informe revisten carácter preliminar. Un análisis ulterior permitirá develar mayor información, particularmente en cuanto a las modificaciones de origen patológico y tafonómico observables en el material óseo en consideración.

  1. Fíbula romana “de rodilla” (Kniefibeln procedente de Hijes (Guadalajara

    Directory of Open Access Journals (Sweden)

    María Luisa CERDEÑO

    2014-01-01

    Full Text Available En este artículo se quiere llamar la atención sobre la aparición de una “fíbula de rodilla” (Kniefibeln en el yacimiento romano de Los Arroyos II en Hijes (Guadalajara; su presencia es muy significativa dado que se trata de un tipo propio de Europa central y este es el primer ejemplar conocido en la Península Ibérica. El estudio tipológico de los elementos materiales es imprescindible en la investigación arqueológica pero, más allá de su mera clasificación, deben ser considerados como parte de las prácticas sociales y como reflejo de las personas que los fabricaron y utilizaron. La presencia de esta fíbula en la Meseta, lugar muy alejado de los territorios centroeuropeos, puede indicar movimientos de personas, presumiblemente militares termestinos, entre los ejércitos que defendían el limes germánico y renano-danubiano. Esta conclusión está avalada no solo por los datos que aporta la arqueología, sino también por documentos epigráficos, lo que confirma la necesidad metodológica de manejar diferentes fuentes de información para abordar un mismo estudio histórico.

  2. Un tensador textil procedente de la Cueva de Nerja (Málaga

    Directory of Open Access Journals (Sweden)

    Francisco Javier GONZÁLEZ-TABLAS SASTRE

    2009-10-01

    Full Text Available Durante la segunda campaña de excavaciones en la cueva de Nerja (Maro, Màlaga, dirigidas por el Catedrático de la Universidad de Salamanca don Francisco Jordá Cerda, fue hallada una pieza que, por su notoriedad, se ha creído conveniente dar a conocer fuera del contexto general de la excavación. El soporte de la pieza es un fragmento de caña de hueso largo de 112 x 19 x 8 mm., sobre el que se han realizado cuatro perforaciones, después de haber alisado y rebajado la parte externa del hueso mediante un sistema de frotación. Asimismo, en ambos extremos, se observan dos grandes muescas en «V» con claras muestras de abrasión por frotación. Las perforaciones son en doble «V» y su realización ha debido ser mediante un perforador dentado, ya que presenta una serie de rebajes escalonados. Las medidas de las misma oscilan entre 3,5 y 4 mm. en la parte media y entre 5 y 6 mm. en la superficie exterior.

  3. Thermal treatment of sewage sludge from waste water. Tratamiento termico de lodos procedentes de aguas residuales

    Energy Technology Data Exchange (ETDEWEB)

    Andreottola, G. (Universidad de Trento (Italy)); Canziani, R.; Ragazzi, M. (Politicnico de Milan (Italy))

    1994-01-01

    Thermal Treatment of sewage sludge can be beneficial as a pre-treatment step of many treatment/disposal options, but above all, it allows the recovery of the energetic content sludge. Energy recovery from sewage sludge can be performed in many ways; direct incineration thermal drying followed by incineration and co-combustion with municipal solid wastes or other non conventional fuels. Another option is the recovery of waste energy (e.g. from an endo thermal engine using biogas as fuel) to dry sludge wich, in turn can be used as a fuel. The paper will evaluate several options of thermal treatment of sewage sludge, with particular emphasis on the energetic yield from different processes. (Author)

  4. Movilidad de metales en jales procedentes del distrito minero de Guanajuato, México

    OpenAIRE

    RAMOS-GÓMEZ, Magdalena; AVELAR, Javier; MEDEL-REYES, Alejandro; YAMAMOTO, Laura; GODINEZ, Luis; RAMIREZ, Marcela; GUERRA, Ricardo; RODRÍGUEZ, Francisco

    2012-01-01

    Se realizó la caracterización de tres jales del distrito minero de Guanajuato: uno abandonado hace 20 años (Presa Abandonada), uno reciente (Presa en Operación) y un jal proveniente de la mezcla de diferentes compañías (Presa Mezcla). Los tres jales presentaron carácter alcalino, condiciones aerobias con tendencias oxidantes, bajo contenido de humedad, muy baja capacidad de intercambio catiónico y ausencia de materia orgánica. Estas condiciones limitan la lixiviación de metales. Los análisis ...

  5. Recovery of mining sludges by phyto remediation; Recuperacion de lodos procedentes de actividades mineralurgicas mediante fitorremediacion

    Energy Technology Data Exchange (ETDEWEB)

    Llarri, A.; Rubio, A.; Fernandez-Revuelta, B.

    2001-07-01

    Remediation of mining waste from ferric leaching process has been studied. A characterisation of the sludge formed in the neutralisation of leaching liquors was made up to determine the availability of phyto remediation techniques to remedy this soil. The sludge, with a high content in heavy metals such as copper, arsenic and zinc, and a high concentration in cations as sodium product of neutralisation process, and strongly basic, is not available for planting. The study was done with two objectives, the first a control of correct yield accord to climatic conditions and soil properties, and the second the determination the plant species capacity to absorb soil toxic ions, principally dissolved due to rainfall and leaching. The results obtained show a high resistance of shrub species versus floral species and a high tolerance of wild species to the removal of heavy metals in this type of soil. (Author) 15 refs.

  6. Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site

    Energy Technology Data Exchange (ETDEWEB)

    Gangi Setty, Thanuja [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India); Cho, Christine [Carver College of Medicine, University of Iowa, Iowa City, IA 52242-1109 (United States); Govindappa, Sowmya [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India); Apicella, Michael A. [Carver College of Medicine, University of Iowa, Iowa City, IA 52242-1109 (United States); Ramaswamy, S., E-mail: ramas@instem.res.in [Institute for Stem Cell Biology and Regenerative Medicine, NCBS Campus, GKVK Post, Bangalore, Karnataka 560 065 (India)

    2014-07-01

    Structure–function studies of sialic acid-binding proteins from F. nucleatum, P. multocida, V. cholerae and H. influenzae reveal a conserved network of hydrogen bonds involved in conformational change on ligand binding. Sialic acids are a family of related nine-carbon sugar acids that play important roles in both eukaryotes and prokaryotes. These sialic acids are incorporated/decorated onto lipooligosaccharides as terminal sugars in multiple bacteria to evade the host immune system. Many pathogenic bacteria scavenge sialic acids from their host and use them for molecular mimicry. The first step of this process is the transport of sialic acid to the cytoplasm, which often takes place using a tripartite ATP-independent transport system consisting of a periplasmic binding protein and a membrane transporter. In this paper, the structural characterization of periplasmic binding proteins from the pathogenic bacteria Fusobacterium nucleatum, Pasteurella multocida and Vibrio cholerae and their thermodynamic characterization are reported. The binding affinities of several mutations in the Neu5Ac binding site of the Haemophilus influenzae protein are also reported. The structure and the thermodynamics of the binding of sugars suggest that all of these proteins have a very well conserved binding pocket and similar binding affinities. A significant conformational change occurs when these proteins bind the sugar. While the C1 carboxylate has been identified as the primary binding site, a second conserved hydrogen-bonding network is involved in the initiation and stabilization of the conformational states.

  7. Development of colloidal gold immunochromatographic strips for detection of Riemerella anatipestifer.

    Directory of Open Access Journals (Sweden)

    Wanwan Hou

    Full Text Available Riemerella anatipestifer is one of the most important bacterial pathogen of ducks and causes a contagious septicemia. R. anatipestifer infection causes serositis syndromes similar to other bacterial infections in ducks, including infection by Escherichia coli, Salmonella enterica and Pasteurella multocida. Clinically differentiating R. anatipestifer infections from other bacterial pathogen infections is usually difficult. In this study, MAb 1G2F10, a monoclonal antibody against R. anatipestifer GroEL, was used to develop a colloidal gold immunochromatographic strip. Colloidal gold particles were prepared by chemical synthesis to an average diameter of 20 ± 5.26 nm by transmission electron microscope imaging. MAb 1G2F10 was conjugated to colloidal gold particles and the formation of antibody-colloidal gold conjugates was monitored by UV/Vis spectroscopy. Immunochromatographic strips were assembled in regular sequence through different accessories sticked on PVC plate. Strips specifically detected R. anatipestifer within 10 min, but did not detect E. coli, S. enterica and P. multocida. The detection limit for R. anatipestifer was 1 × 10(6 colony forming units, which was 500 times higher than a conventional agglutination test. Accuracy was 100% match to multiplex PCR. Assay stability and reproducibility were excellent after storage at 4°C for 6 months. The immunochromatographic strips prepared in this study offer a specific, sensitive, and rapid detection method for R. anatipestifer, which is of great importance for the prevention and control of R. anatipestifer infections.

  8. Pathological and molecular based study of pneumonic pasteurellosis in cattle and buffalo (bubalus bubalis)

    International Nuclear Information System (INIS)

    Hussain, R.

    2014-01-01

    In present study the clinico-pathological findings were recorded in naturally infected cattle and buffaloes due to pasteurella multocida during an outbreak at different livestock herds. There was no significant difference in mortality among various groups of buffaloes (p>0.78) and cattle (p>0.49). The infected animals showed clinical signs of moderate to acute anorexia, salivation, fever, depression, dysponea, submandibular edema, mucopurulent nasal discharge and respiratory grunts. Few of infected animals died due to septicemia. the necropsy of dead animals was performed and visceral organs lungs, kidneys, heart and lymph nodes were observed for gross and histopathological lesions. The tissue samples from these organs were fixed in formalin for pathological changes. Necropsy of dead animals revealed severe pneumonia, consolidation of lungs and intense pleural adhesions. serosanguinous fluid was accumulated in pericardium and peritoneal cavities. Histopathologically affected lungs exhibited severe congestion, mononuclear cell infiltration, thick interlobular septae punctuated with macrophages, plasma cells and peri-vascular cuffing. Liver, kidneys and lymph nodes had degenerative changes in histological sections. The specificity of p. multocida was determined by colony characteristics on macconkey's agar and morphological features with gram's iodine. The pcr product size approximately 511bp from lung tissues confirmed a total of 82% (19/23) bacterial isolates from dead animals. (author)

  9. Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site

    International Nuclear Information System (INIS)

    Gangi Setty, Thanuja; Cho, Christine; Govindappa, Sowmya; Apicella, Michael A.; Ramaswamy, S.

    2014-01-01

    Structure–function studies of sialic acid-binding proteins from F. nucleatum, P. multocida, V. cholerae and H. influenzae reveal a conserved network of hydrogen bonds involved in conformational change on ligand binding. Sialic acids are a family of related nine-carbon sugar acids that play important roles in both eukaryotes and prokaryotes. These sialic acids are incorporated/decorated onto lipooligosaccharides as terminal sugars in multiple bacteria to evade the host immune system. Many pathogenic bacteria scavenge sialic acids from their host and use them for molecular mimicry. The first step of this process is the transport of sialic acid to the cytoplasm, which often takes place using a tripartite ATP-independent transport system consisting of a periplasmic binding protein and a membrane transporter. In this paper, the structural characterization of periplasmic binding proteins from the pathogenic bacteria Fusobacterium nucleatum, Pasteurella multocida and Vibrio cholerae and their thermodynamic characterization are reported. The binding affinities of several mutations in the Neu5Ac binding site of the Haemophilus influenzae protein are also reported. The structure and the thermodynamics of the binding of sugars suggest that all of these proteins have a very well conserved binding pocket and similar binding affinities. A significant conformational change occurs when these proteins bind the sugar. While the C1 carboxylate has been identified as the primary binding site, a second conserved hydrogen-bonding network is involved in the initiation and stabilization of the conformational states

  10. Comparison of the diagnostic performance of bacterial culture of nasopharyngeal swab and bronchoalveolar lavage fluid samples obtained from calves with bovine respiratory disease.

    Science.gov (United States)

    Capik, Sarah F; White, Brad J; Lubbers, Brian V; Apley, Michael D; DeDonder, Keith D; Larson, Robert L; Harhay, Greg P; Chitko-McKown, Carol G; Harhay, Dayna M; Kalbfleisch, Ted S; Schuller, Gennie; Clawson, Michael L

    2017-03-01

    OBJECTIVE To compare predictive values, extent of agreement, and gamithromycin susceptibility between bacterial culture results of nasopharyngeal swab (NPS) and bronchoalveolar lavage fluid (BALF) samples obtained from calves with bovine respiratory disease (BRD). ANIMALS 28 beef calves with clinical BRD. PROCEDURES Pooled bilateral NPS samples and BALF samples were obtained for bacterial culture from calves immediately before and at various times during the 5 days after gamithromycin (6 mg/kg, SC, once) administration. For each culture-positive sample, up to 12 Mannheimia haemolytica, 6 Pasteurella multocida, and 6 Histophilus somni colonies underwent gamithromycin susceptibility testing. Whole-genome sequencing was performed on all M haemolytica isolates. For paired NPS and BALF samples collected 5 days after gamithromycin administration, the positive and negative predictive values for culture results of NPS samples relative to those of BALF samples and the extent of agreement between the sampling methods were determined. RESULTS Positive and negative predictive values of NPS samples were 67% and 100% for M haemolytica, 75% and 100% for P multocida, and 100% and 96% for H somni. Extent of agreement between results for NPS and BALF samples was substantial for M haemolytica (κ, 0.71) and H somni (κ, 0.78) and almost perfect for P multocida (κ, 0.81). Gamithromycin susceptibility varied within the same sample and between paired NPS and BALF samples. CONCLUSIONS AND CLINICAL RELEVANCE Results indicated culture results of NPS and BALF samples from calves with BRD should be interpreted cautiously considering disease prevalence within the population, sample collection relative to antimicrobial administration, and limitations of diagnostic testing methods.

  11. Antimicrobial Susceptibility of Bacteria That Cause Bovine Respiratory Disease Complex in Alberta, Canada

    Directory of Open Access Journals (Sweden)

    R. Michele Anholt

    2017-12-01

    Full Text Available Bovine respiratory disease (BRD is the most important illness of feedlot cattle. Disease management targets the associated bacterial pathogens, Mannheimia haemolytica, Mycoplasma bovis, Pasteurella multocida, Histophilus somni, and Trueperella pyogenes. We conducted a cross-sectional study to measure the frequencies of antimicrobial-resistant BRD pathogens using a collaborative network of veterinarians, industry, government, and a diagnostic laboratory. Seven private veterinary practices in southern Alberta collected samples from both living and dead BRD-affected animals at commercial feedlots. Susceptibility testing of 745 isolates showed that 100% of the M. haemolytica, M. bovis, P. multocida, and T. pyogenes isolates and 66.7% of the H. somni isolates were resistant to at least one antimicrobial class. Resistance to macrolide antimicrobials (90.2% of all isolates was notable for their importance to beef production and human medicine. Multidrug resistance (MDR was high in all target pathogens with 47.2% of the isolates resistant to four or five antimicrobial classes and 24.0% resistance to six to nine classes. We compared the MDR profiles of isolates from two feedlots serviced by different veterinary practices. Differences in the average number of resistant classes were found for M. haemolytica (p < 0.001 and P. multocida (p = 0.002. Compared to previous studies, this study suggests an increasing trend of resistance in BRD pathogens against the antimicrobials used to manage the disease in Alberta. For the veterinary clinician, the results emphasize the importance of ongoing susceptibility testing of BRD pathogens to inform treatment protocols. Surveillance studies that collect additional epidemiological information and manage sampling bias will be necessary to develop strategies to limit the spread of resistance.

  12. Monitoring of antimicrobial susceptibility of respiratory tract pathogens isolated from diseased cattle and pigs across Europe, 2009-2012: VetPath results.

    Science.gov (United States)

    El Garch, Farid; de Jong, Anno; Simjee, Shabbir; Moyaert, Hilde; Klein, Ulrich; Ludwig, Carolin; Marion, Hervé; Haag-Diergarten, Silke; Richard-Mazet, Alexandra; Thomas, Valérie; Siegwart, Ed

    2016-10-15

    VetPath is an ongoing pan-European antibiotic susceptibility monitoring programme that collects pathogens from diseased cattle, pigs and poultry. In the current study, 996 isolates from cattle and pig respiratory tract infections were tested for their antimicrobial susceptibilities. Non-replicate lung samples or nasopharyngeal/nasal swabs were collected from animals with acute clinical signs in 10 countries during 2009-2012. Pasteurella multocida, Mannheimia haemolytica and Histophilus somni from cattle and P. multocida, Actinobacillus pleuropneumoniae, Haemophilus parasuis, Bordetella bronchiseptica and Streptococcus suis from pigs were isolated by standard methods. S. suis was also isolated from meningitis cases. MIC values of 16 or 17 antibiotics were assessed centrally by broth microdilution following CLSI standards. Results were interpreted using CLSI breakpoints where available. Cattle isolates were generally highly susceptible to most antibiotics, except to tetracycline (3.0-12.0% resistance). Low levels of resistance (0-4.0%) were observed for the macrolide antibiotics. Resistance to spectinomycin varied from 0 to 6.0%. In pig isolates similar observations were made. Resistance to amoxicillin/clavulanic acid, ceftiofur, enrofloxacin, florfenicol, tulathromycin, tiamulin and tilmicosin was absent or <2%. Trimethoprim/sulfamethoxazole resistance varied from 1.9 to 5.3%, but tetracycline resistance varied from 20.4% in P. multocida to 88.1% in S. suis. For most antibiotics and pathogens the percentage resistance remained unchanged or only increased numerically as compared to that of the period 2002-2006. In conclusion, absence or low resistance to antibiotics with defined clinical breakpoints, except for tetracycline, was observed among the major respiratory tract pathogens recovered from livestock. Comparison of all antibiotics and organisms was hampered since for almost half of the antibiotics no CLSI-defined breakpoints were available. Copyright © 2016

  13. Phylogeny of 54 representative strains of species in the family Pasteurellaceae as determined by comparison of 16S rRNA sequences.

    Science.gov (United States)

    Dewhirst, F E; Paster, B J; Olsen, I; Fraser, G J

    1992-03-01

    Virtually complete 16S rRNA sequences were determined for 54 representative strains of species in the family Pasteurellaceae. Of these strains, 15 were Pasteurella, 16 were Actinobacillus, and 23 were Haemophilus. A phylogenetic tree was constructed based on sequence similarity, using the Neighbor-Joining method. Fifty-three of the strains fell within four large clusters. The first cluster included the type strains of Haemophilus influenzae, H. aegyptius, H. aphrophilus, H. haemolyticus, H. paraphrophilus, H. segnis, and Actinobacillus actinomycetemcomitans. This cluster also contained A. actinomycetemcomitans FDC Y4, ATCC 29522, ATCC 29523, and ATCC 29524 and H. aphrophilus NCTC 7901. The second cluster included the type strains of A. seminis and Pasteurella aerogenes and H. somnus OVCG 43826. The third cluster was composed of the type strains of Pasteurella multocida, P. anatis, P. avium, P. canis, P. dagmatis, P. gallinarum, P. langaa, P. stomatis, P. volantium, H. haemoglobinophilus, H. parasuis, H. paracuniculus, H. paragallinarum, and A. capsulatus. This cluster also contained Pasteurella species A CCUG 18782, Pasteurella species B CCUG 19974, Haemophilus taxon C CAPM 5111, H. parasuis type 5 Nagasaki, P. volantium (H. parainfluenzae) NCTC 4101, and P. trehalosi NCTC 10624. The fourth cluster included the type strains of Actinobacillus lignieresii, A. equuli, A. pleuropneumoniae, A. suis, A. ureae, H. parahaemolyticus, H. parainfluenzae, H. paraphrohaemolyticus, H. ducreyi, and P. haemolytica. This cluster also contained Actinobacillus species strain CCUG 19799 (Bisgaard taxon 11), A. suis ATCC 15557, H. ducreyi ATCC 27722 and HD 35000, Haemophilus minor group strain 202, and H. parainfluenzae ATCC 29242. The type strain of P. pneumotropica branched alone to form a fifth group. The branching of the Pasteurellaceae family tree was quite complex. The four major clusters contained multiple subclusters. The clusters contained both rapidly and slowly evolving

  14. Experimental infection with different bacterial strains in larvae and juvenile Litopenaeus vannamei reared in Santa Catarina State, Brazil = Infecção experimental em larvas e juvenis de Litopaenaeus vannamei cultivados no Estado de Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    Celso Carlos Buglione

    2010-07-01

    Full Text Available This study evaluated the pathogenic characteristics of bacteria isolated from Litopenaeus vannamei during an outbreak at the Laboratory of Marine Shrimp, UFSC, Santa Catarina State, Brazil. Their virulence potential in larvae and juvenile shrimp and theeffects on the total haemocyte count, phenoloxidase activity and serum agglutinate titre were examined after experimental infection. Bacterial strains were isolated from larvae and adult shrimps, identified by the AP120E biochemical system as: two strains of Vibrioalginolyticus, three of Aeromonas salmonicida and one of Pasteurella multocida sp. and Pasteurella sp. All the bacterial strains isolated in this study caused mortality in shrimp. One strain of V. alginolyticus was responsible for 97.3 and 88.7% mortality in larvae and juvenil shrimps, respectively. The shrimp immunological system was influenced by experimental infection with V. alginolyticus. Decrease in the total haemocyte count and increase in the phenoloxidase activity and the serum agglutinate titre (p Este estudo avaliou as características patogênicas de cepas de bactérias isoladas de Litopenaeus vannamei durante surto de mortalidade no Laboratório de Camarões Marinhos, UFSC, Estado de Santa Catarina, Brasil. Seu potencial de virulência em larvas e juvenis de camarão marinho e os efeitos sobre a contagem total de hemócito, atividade de fenoloxidase e título aglutinante do soro foramavaliados após infecção experimental. As cepas bacterianas foram isoladas de larvas e de camarões adultos e identificadas bioquimicamente pelo sistema API20E como: duas cepas de Vibrio alginolyticus, três de Aeromonas salmonicida e uma de Pasteurella sp. e P. multocida. Todas as cepas isoladas provocaram mortalidade em L. vannamei, e uma de V. alginolyticus resultou em mortalidade de 97,3 e 88,7% para larvas e juvenis de camarões, respectivamente. O sistema imunológico dos camarões juvenis sofreu influência da infecção experimental

  15. Further Pasteurella Isolates from the republic of Zambia: A brief report

    African Journals Online (AJOL)

    http://dx.doi.org/10.4314/tv.v20i3.4491 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...

  16. Moldes de arcilla para fundir metales procedentes del Castro Hallstáttico de El Royo (Soria

    Directory of Open Access Journals (Sweden)

    Jorge Juan EIROA

    2009-12-01

    Full Text Available Durante los trabajos de la segunda campaña de excavaciones arqueológicas en el castro de la Virgen del Castillo de El Royo (Soria, que se desarrollaron durante el verano de 1979, apareció un lote de moldes de arcilla para fundir metales que, por su indudable interés para documentar aún más el desarrollo de la metalurgia en la Meseta, ofrecemos hoy, independientemente de la memoria oficial que sobre el yacimiento y su excavación preparamos.

  17. Estudio de la composición química de la especie Commelia erecta L., procedente de Ecuador

    OpenAIRE

    Migdalia Miranda; Margarita Hall

    2016-01-01

    En el presente trabajo se realizó el estudio de algunos parámetros físico-químicos y químicos  de las hojas de Cornmelina erecta L. que incluyó el estudio como droga cruda, el control de calidad del extracto y su composición química. Se comprobó las características físico-químicas de la droga cruda (humedad residual 6,64% y cenizas totales de 15,99%) que se encontraban dentro del rango informado por la OMS para drogas y vegetales, aunque este último se considera algo elevado ya que posee una ...

  18. La infección de cangrejos procedentes del valle de Condebamba (Cajamarca por metacercarias de Paragonimus

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán V.

    2014-06-01

    Full Text Available En los meses de febrero y julio de 1973 se colectaron cangrejos del Valle de Condebamba (Cajamarca correspondientes a Pseudothelphusa chilensis, 69 de ellos (34 machos y 35 hembras fueron examinados, buscando metacercarias de Paragonimus; 22 (64.7% de los machos y 29 (28.85 % de las hembras resultaron infectados con metacercarias, o sea 52 (72.46% de los 69 cangrejos estaban infectados, esta cifra es coincidente con la obtenida por Cuba y cols. (1974.

  19. Tecnologías de membrana para recuperar el nitrógeno amoniacal procedente de aguas residuales urbanas

    OpenAIRE

    San José Caballero, Marta

    2017-01-01

    La realización de este estudio tiene como objetivo la recuperación de nutrientes de aguas residuales urbanas de un pequeño municipio, con el fin de recuperar así, componentes valiosos, como es el amoníaco, y poder reutilizarlos, por ejemplo, en la fabricación de fertilizantes usados en la agricultura. En los próximos años el número de habitantes en la Tierra se prevé aumente en gran medida, teniendo que aumentar por ello la cantidad de alimento disponible. Recuperando los nutrientes que...

  20. Usos de remesas procedentes de España en la región Pacífica Colombiana

    Directory of Open Access Journals (Sweden)

    María Gertrudis Roa-Martínez

    2011-07-01

    Full Text Available Este artículo explora los usos de remesas que tienen los hogares colombianos con experiencia migratoria en la región del Pacífico con una metodología cuantitativa. Describe las características socio-demográficas principales de los remitentes de remesas y los hogares beneficiarios (especialmente en cabeza del beneficiario que recibe el giro bancario y la distribución del gasto en los hogares.

  1. Biological treatment: potential reusing of recycled plastics from grenhouses; La depuracin biolgica: posible reutilizacin de plsticos reciclados procedentes de invernaderos

    Energy Technology Data Exchange (ETDEWEB)

    Zamorano, M.; Hontaria, E. [Universidad de Granada (Spain)

    1997-12-31

    The purpose of this study was to investigate recycled plastic used to cover crops as support beds in submerged biofilters for the purification of residual water, which also permit the re-used of recycled or waste products and the clarification and improvement of the effluent flow from the filter. The recycled plastic shows that the efficiency was 88% COD-removal and 84% SS-removal, without secondary clarification. The functioning of the system with this material has not improved 100%, this study has opened up a new field of investigation that will perfect the system and materials. (Author) 10 refs.

  2. Huella de H (procedente de s en la Ilíada y el origen de la épica

    Directory of Open Access Journals (Sweden)

    José Vara

    1974-12-01

    Full Text Available In Mycenaean dialect there are traces of survival of H from s with consonantal function. This paper attest also the traces of H with consonantal function in Homeric poetry, corroborating in this way, from a linguistic point of view, the theory that Homeric poetry is rooted in Mycenaean or pre-Mycenaean times, at least in certain formulae.

  3. AVALIAÇÃO DE PESSEGUEIROS E NECTARINEIRAS INTRODUZIDOS NO BRASIL, PROCEDENTES DA FLÓRIDA, EUA

    Directory of Open Access Journals (Sweden)

    W. BARBOSA

    1997-09-01

    Full Text Available Avaliou-se o comportamento vegetativo e reprodutivo de vinte e dois pessegueiros e treze nectarineiras introduzidos no Brasil, provenientes da Universidade da Flórida, Gainesville, EUA. O material foi avaliado por três anos na Estação Experimental de Jundiaí, do IAC(23o08'S; 46o55'W, anotando-se as características: número de nós de gemas por metro de ramo e de gemas vegetativas e floríferas por nó; porcentagem de frutificação efetiva; ciclo de maturação dos frutos; coloração da película e polpa; textura e acidez da polpa e época de colheita. Verificou-se que os cinco cultivares e seleções que apresentaram grande quantidade de gemas foram: Sungem; Fla 3-4N; Fla 6-4; Fla 84-16N e Okinawa, com 51,1; 50,8; 45,8; 45,2 e 44,2 nós de gemas por metro de ramo respectivamente. Considerando o nº de gemas por nó, observou-se que Desertgold (2,36, Sunwright (2,32, Rubro-sol (2,24, Sunlite (2,21, Newbelle (2,16 e Sundowner (2,13 foram os cultivares com maior potencial de desenvolvimento de folhas e flores. As melhores frutificações ocorreram em `Okinawa'(66,3%, `TropicBeauty' (51,1%, `Flordastar'(50,0%, Fla 84-4(48,5% e `Flordaprince'(41,5%. Os pêssegos `Flordadawn', Fla 84-5, Fla 84-4, `Flordastar' e Oro A constituiram-se nos mais precoces, com ciclos de 75 a 85 dias da florada à maturação dos frutos e colheitas desde meados de setembro até início de outubro. Verificou-se que as novas seleções como Fla 84-5, Fla 84-16N, Fla 84-4 e Fla 84-13N possuem características agronômicas favoráveis à persicultura paulista e aos cruzamentos com as seleções do IAC. São dois pêssegos e duas nectarinas de polpa amarela, produtivos, precoces, menos ácidos, com oBrix 12 a 15 e pH 3,8 a 4,0. Os cultivares e seleções mais tolerantes à ferrugem foram: Fla 9-11N, Sundowner, Sunlite, Fla 87-3 e Fla 84-16 e ao chumbinho: Sunwright, Fla 82-23N, Fla 9-11N, Flordadawn e Fla 1-8, sendo 70% nectarinas.Twenty-two peaches and thirteen nectarines introduced from the University of Florida breeding program were evaluated by the Instituto Agronômico (IAC at the Jundiaí Experimental Station (23o08' S; 46o55' W, State of São Paulo, Brazil. Bud density based on the average number of buds per branch meter; flower and leaf buds per node; fruit set; fruit development period; epiderm and flesh color; flesh firmness; flesh acidity and harvest season, were evaluated for three years. The highest degree of bud density was observed in `Sungem', Fla 3-4N; Fla 6-4; Fla 84-16N and `Okinawa' with 51.1; 50.8; 45.8; 45.2; 44.2 buds per meter, respectively. The highest number of flower and leaf buds per node was observed for `Desertgold'(2.36, `Sunwright'(2.32, `Sunred'(2.24, `Sunlite'(2.21, `Newbelle'(2.16 and `Sundowner'(2.13. Fruit set was higher in `Okinawa'(66.3%, `TropicBeauty'(51.1%, Flordastar'(50.0%, Fla 84-4 (4,5% and `Flordaprince' (41.5%. Cultivars such as Flordadawn, Fla 84-5, Fla 84-4, Flordastar and Oro A were the most precocious, with fruit development period between 75 and 85 days from bloom to harvest. The less susceptible cultivars or selections to rust leaf disease were: Fla 9-9N, Sundowner, Sunlite, Fla 87-3 and Fla 84-16N and to peach blight: Sunwright, Fla 82-23N, Fla 9-11N, Flordadawn and Fla 1-8. The new Fla. selections: Fla 84-5, Fla 84-16N; Fla 84-4 and Fla 84-13N, with low chilling requirement, productive, precocious, red skin, yellow flesh and mainly fruits of large size and less acidity were selected for crosses in the IAC peach breeding program and experimental cultivation by fruit growers.

  4. Podridão peduncular e qualidade de mangas 'Tommy atkins' procedentes do mercado atacadista de Campina Grande-PB

    Directory of Open Access Journals (Sweden)

    Erbs Cintra de Souza Gomes

    2010-12-01

    Full Text Available O Brasil destaca-se no cenário mundial como um dos maiores produtores de manga (Mangifera indica L.. No entanto, perdas significativas são observadas em todas as etapas da cadeia produtiva, sobretudo na comercialização varejista, sendo estas correlacionadas em quase sua totalidade à incidência de doenças fúngicas. Neste sentido, objetivou-se com este trabalho determinar a incidência natural de Lasiodiplodia theobromae, agente causal da podridão peduncular, e aspectos da qualidade pós-colheita de mangas 'Tommy Atkins', comercializadas no mercado atacadista da Empresa Paraibana de Abastecimento e Serviços Agrícolas (EMPASA de Campina Grande-PB. Para a determinação da incidência natural da doença, coletaram-se 40 frutos no estádio de maturação 'de vez', de quatro diferentes estabelecimentos de comercialização, que foram encaminhados ao Laboratório de Fitopatologia (CCA/UFPB. Após sanificação, os frutos foram mantidos sob condições ambientes (28 ± 2 ºC e UR 75 ± 6% por oito dias, determinando-se o aparecimento dos primeiros sintomas e sinais do patógeno. As características de qualidade foram determinadas através da coleta de 10 frutos de cada estabelecimento de comercialização da EMPASA. Os frutos foram transportados ao Laboratório de Biologia e Tecnologia Pós-Colheita (CCA/UFPB, onde foram avaliados quanto aos teores de Sólidos Solúveis (SS, Acidez Titulável (AT, Relação SS/AT e pH. Os dados foram submetidos à análise de variância, e as médias, comparadas pelo teste de Tukey, a 5% de probabilidade. A manga comercializada no mercado atacadista da EMPASA de Campina Grande apresentou baixo conteúdo de SS e elevada AT, caracterizando fruto no início da maturação. Os frutos apresentaram 88,9% de incidência natural de podridão peduncular no oitavo dia de armazenamento, o que compromete a qualidade do produto no varejo, constituindo-se em uma causa das elevadas perdas pós-colheita.

  5. Paleopatología de los restos humanos de la Edad del Bronce procedentes de Gobaederra (Alava.

    Directory of Open Access Journals (Sweden)

    Francisco Etxeberria

    1986-01-01

    Full Text Available Se estudian los aspectos patológicos de una serie de restos óseos humanos que pertenecen a un número mínimo de 81 individuos inhumados durante la Edad del Bronce en la cueva sepulcral de Gobaederra (Alava. Entre la variedad de las lesiones descritas, resultan de interés los signos de artrosis que presentan los codos de dos individuos, compatibles con ejercicios repetitivos de prono-supinación del antebrazo con flexión del mismo a 90°, en lo que suponemos una actividad de perforación o similar en labores artesanales. Asimismo hemos de destacar la lesión generalizada que presenta un individuo y que etiquetamos como osteoartropatía hipertrófica pulmonar, probablemente debida a carcinoma broncógeno o proceso supurativo crónico de pulmón que tuvo que ser causa irremediable del fallecimiento del mismo. Por otra parte existen tres piezas dentarias que presentan desgastes, acaso intencionados, a nivel de sus cuellos.

  6. Precisiones histológicas y bioquímicas acerca de los ejemplares de Frenelopsis procedentes de Torrelaguna (Madrid

    Directory of Open Access Journals (Sweden)

    Álvarez Ramis, C.

    1984-04-01

    Full Text Available Different morphological features of the Frenelopsis from a Torrelaguna bassin (Madrid, Spain are described and compared with F. alata and F. oligostomata , studied by other authors. The Frenelopsis rests present, in the studied deposit, a remarkable polymorphism with respect 10 the dimensions of the leaves, but all the specimens studied are greatiy related to F. oligostomata . The chemical study of the organic constituents of the cutic1es shows a heterogeneous composition, being the major constituents an alkali-insoluble cutinized residue and a likehumic acid polyphenolic extractable fraction, Cuticles contains a certain proportion of a highly alterated lignin-like polymer, and minimal amounts of fulvic acids, nitrogenated compounds, free hydrocarbons and carbohydrates. KEY WORDS: Hystology, Biochemistry, Frenelopsis, Upper cretaceous, Palaeobotany, Humic substances.

    Son descritos diferentes aspectos morfológicos de los Frenelopsis del yacimiento de Torrelaguna, comparándose sus características con las descritas por otros autores para las especies F. alata y F. oligostomata . Los restos de Frenelopsis presentan, en el yacimiento estudiado, un notable polimorfismo respecto a las dimensiones del fronde; pero todos los ejemplares descritos poseen características muy similares a las de F. oligostomata . El estudio químico de los constituyentes orgánicos de las cutículas muestra una composición compleja, siendo los componentes mayoritarios un residuo cutinizado insoluble en álcalis y una fracción polifenólica extraíble de características similares a los ácidos húmicos. Los restos presentan una cierta proporción de polímeros similares a la lignina, aunque muy alterada, así como pequeñas cantidades de ácidos fúlvicos, compuestos nitrogenados, hidrocarburos libres y carbohidratos.

  7. Desarrollo y ensayo de nuevos biocombustibles para motores diesel procedentes de diversas semillas oleaginosas y de grasas vegetales usadas

    OpenAIRE

    Dorado, M.P.

    2001-01-01

    Diversos cambios socioeconómicos, medioambientales y políticos han auspiciado un creciente interés hacia el desarrollo de nuevas formas de energía. Un mercado de libre competencia requiere el cese paulatino de las políticas agrarias proteccionistas y la reduccion de los excedentes agroalimentarios que las propician. Por ello, la PAC, en la UE, exige el barbecho obligatorio de un porcentaje de las tierras de cultivo, salvo que se destine a fines energéticos. El aprovechamiento de estos terreno...

  8. Caracterización de un vidrio rojo medieval procedente de las vidrieras del Monasterio de las Huelgas de Burgos

    Directory of Open Access Journals (Sweden)

    Gómez, B.

    2009-08-01

    Full Text Available In the year 2007 the process of conservation-restoration of the windows of the apostles that close the windows of the Chapter Hall of Cloister of S. Fernando del Real Monasterio de Santa María la Real de las Huelgas de Burgos was completed the process. A red glass obtained from the process of conservation and restoration has been characterized by Optical microscopy by light reflected (OMLR, Field emission scanning electron microscopy (FE-SEM, X ray fluorescence espectrpmetry (XRF, Particle induced X ray emission (PIXE, Transmission electron microscopy (TEM to identify the chemical composition and structure. Chemical analys by XRF and PIXE are in the good agreement. The studied glass has a very original cross section, consisting of a lightly greenish glass holder and multilayers of red glass, characteristic of the thirteenth and fourteenth centuries. A elemental mapping of the cross-section showing the distribution of elements in the glass has been obtained by micro PIXE analysis in a vacuum chamber.

    En el año 2007 se culminó el proceso de restauración integral de las vidrieras que cierran los ventanales de la Sala Capitular del Claustro de S. Fernando del Real Monasterio de Santa María la Real de las Huelgas de Burgos. Un vidrio rojo, de características peculiares, extraído durante el proceso de conservación-restauración de una de las vidrieras, se ha caracterizado mediante las técnicas de Microscopía óptica de luz reflejada (MOLR, Microscopía electrónica de emisión de campo (MEEC, Fluorescencia de rayos X (FRX, Emisión de rayos X inducidos por partículas (PIXE y Microscopía electrónica de transmisión (MET para conocer su composición química y su estructura. Los análisis realizados por las técnicas de FRX y PIXE permiten comprobar la buena concordancia que existe entre los resultados. El vidrio analizado presenta una sección transversal muy original, formada por un vidrio soporte ligeramente verdoso y múltiples capas de color rojo, característico de los siglos XIII y XIV. El análisis mediante micro-PIXE en cámara de vacío ha permitido obtener información sobre la distribución en profundidad de los elementos que lo componen.

  9. Optimización de la auto-biorremediación de aguas residuales procedentes de la industria del corcho.

    OpenAIRE

    Paredes Páliz, Karina

    2012-01-01

    Los compuestos fenólicos requieren una relevante atención en el estudio de la contaminación del ambiente, debido a su toxicidad y prevalencia en agua y suelo. En la naturaleza, estos contaminantes se generan por procesos de humificación y degradación de proteínas. Su incremento ambiental se ve reflejado por la quema de bosques (Morrison, 35698).

  10. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available eurella multocida subsp. multocida str. Pm70] ... Length = 97 ... Query: 3 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDS...ENPGEAGFTGSTV 62 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDS...ENPGEAGFTGSTV Sbjct: 1 ... YYVIFAQDNPNTLAQRLAVREKHLARLTQLQAEDRLLVAGPNPAIDSENPGEAGFTGSTV 60 ...

  11. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available multocida ... subsp. multocida str. Pm70] ... Length = 159 ... Query: 2 ... TTNRQEVLQNRLGPEIQELKAQ...CKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 61 ... TTNRQEVLQNRLGPEIQELKAQCKTVML...ATVGEDGNPNVSYAPFAINNGEYQVFISTIAR Sbjct: 1 ... TTNRQEVLQNRLGPEIQELKAQCKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 60

  12. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available multocida ... subsp. multocida str. Pm70] ... Length = 108 ... Query: 2 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAH...WEVIYFVRAFYQEYKTSP 61 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAH...WEVIYFVRAFYQEYKTSP Sbjct: 1 ... IEVNQQQIETDAHGYLLDLTQWDEDVARAIAQQENIDLTDAHWEVIYFVRAFYQEYKTSP 60 ...

  13. Anti-BACE1 and Antimicrobial Activities of Steroidal Compounds Isolated from Marine Urechis unicinctus

    Directory of Open Access Journals (Sweden)

    Yong-Zhe Zhu

    2018-03-01

    Full Text Available The human β-site amyloid cleaving enzyme (BACE1 has been considered as an effective drug target for treatment of Alzheimer’s disease (AD. In this study, Urechis unicinctus (U. unicinctus, which is a Far East specialty food known as innkeeper worm, ethanol extract was studied by bioassay-directed fractionation and isolation to examine its potential β-site amyloid cleaving enzyme inhibitory and antimicrobial activity. The following compounds were characterized: hecogenin, cholest-4-en-3-one, cholesta-4,6-dien-3-ol, and hurgadacin. These compounds were identified by their mass spectrometry, 1H, and 13C NMR spectral data, comparing those data with NIST/EPA/NIH Mass spectral database (NIST11 and published values. Hecogenin and cholest-4-en-3-one showed significant inhibitory activity against BACE1 with EC50 values of 116.3 and 390.6 µM, respectively. Cholesta-4,6-dien-3-ol and hurgadacin showed broad spectrum antimicrobial activity, particularly strongly against Escherichia coli (E. coli, Salmonella enterica (S. enterica, Pasteurella multocida (P. multocida, and Physalospora piricola (P. piricola, with minimal inhibitory concentration (MIC ranging from 0.46 to 0.94 mg/mL. This is the first report regarding those four known compounds that were isolated from U. unicinctus and their anti-BACE1 and antimicrobial activity, highlighting the fact that known natural compounds may be a critical source of new medicine leads. These findings provide scientific evidence for potential application of those bioactive compounds for the development of AD drugs and antimicrobial agents.

  14. Anti-BACE1 and Antimicrobial Activities of Steroidal Compounds Isolated from Marine Urechis unicinctus.

    Science.gov (United States)

    Zhu, Yong-Zhe; Liu, Jing-Wen; Wang, Xue; Jeong, In-Hong; Ahn, Young-Joon; Zhang, Chuan-Jie

    2018-03-14

    The human β-site amyloid cleaving enzyme (BACE1) has been considered as an effective drug target for treatment of Alzheimer's disease (AD). In this study, Urechis unicinctus (U. unicinctus) , which is a Far East specialty food known as innkeeper worm, ethanol extract was studied by bioassay-directed fractionation and isolation to examine its potential β-site amyloid cleaving enzyme inhibitory and antimicrobial activity. The following compounds were characterized: hecogenin, cholest-4- en -3-one, cholesta-4,6- dien -3-ol, and hurgadacin. These compounds were identified by their mass spectrometry, ¹H, and 13 C NMR spectral data, comparing those data with NIST/EPA/NIH Mass spectral database (NIST11) and published values. Hecogenin and cholest-4- en -3-one showed significant inhibitory activity against BACE1 with EC 50 values of 116.3 and 390.6 µM, respectively. Cholesta-4,6- dien -3-ol and hurgadacin showed broad spectrum antimicrobial activity, particularly strongly against Escherichia coli (E. coli) , Salmonella enterica (S. enterica) , Pasteurella multocida (P. multocida) , and Physalospora piricola (P. piricola) , with minimal inhibitory concentration (MIC) ranging from 0.46 to 0.94 mg/mL. This is the first report regarding those four known compounds that were isolated from U. unicinctus and their anti-BACE1 and antimicrobial activity, highlighting the fact that known natural compounds may be a critical source of new medicine leads. These findings provide scientific evidence for potential application of those bioactive compounds for the development of AD drugs and antimicrobial agents.

  15. Preliminary clinical pharmacological investigations of tylosin and tiamulin in chickens.

    Science.gov (United States)

    Ziv, G

    1980-10-15

    The minimal inhibitory concentrations (MIC) of tiamulin and tylosin for mycoplasma, Gram-positive, and Gram-negative micro-organisms isolated from chickens were determinated by the agar dilution method. Median MIC values for tiamulin against Mycoplasma gallisepticum (0.05 microgram/ml) and Mycoplasma synoviae (0.10 microgram/ml) were 2 to 4 times lower than the corresponding values for tylosin. Tiamulin was also slightly more effective in vitro in inhibiting Escherichia coli, Pasteurella multocida, and beta-haemolytic streptococci than was tylosin. Groups of chicken were offered tiamulin medicated drinking water at rates of 125 and 250 mg/litre for 48 hours. Average serum tiamulin concentrations were 0.38 and 0.78 microgram/ml, respectively. When tylosin tartrate was added to the drinking water at 500 and 700 mg/litre, average serum drug levels were 0.12 and 0.17 microgram/ml, respectively. Tiamulin was 45% bound in chicken serum, as against 30% serum protein binding for tylosin. Correlations were made between free (non protein bound) serum drug levels and the MIC values of the two drugs. Such comparisons suggest that when tiamulin is given in the drinking water at rates of 125 to 250 mg/litre, better antimycoplasmal activity is to be expected in vivo than by giving tylosin tartrate in the drinking water at 500 to 700 mg/litre. Based on these data, no clinical efficacy of these dose rates can be expected in flocks infected by gram-negative micro-organisms such as E. coli or P. multocida. The tylosin tartrate rate of 500 to 700 mg/litre, may be clinical ineffective the treatment of Staphylococcus aureus infections.

  16. Aerobic bacteria from mucous membranes, ear canals, and skin wounds of feral cats in Grenada, and the antimicrobial drug susceptibility of major isolates.

    Science.gov (United States)

    Hariharan, Harry; Matthew, Vanessa; Fountain, Jacqueline; Snell, Alicia; Doherty, Devin; King, Brittany; Shemer, Eran; Oliveira, Simone; Sharma, Ravindra N

    2011-03-01

    In a 2-year period 54 feral cats were captured in Grenada, West Indies, and a total of 383 samples consisting of swabs from rectum, vagina, ears, eyes, mouth, nose and wounds/abscesses, were cultured for aerobic bacteria and campylobacters. A total of 251 bacterial isolates were obtained, of which 205 were identified to species level and 46 to genus level. A commercial bacterial identification system (API/Biomerieux), was used for this purpose. The most common species was Escherichia coli (N=60), followed by Staphylococcus felis/simulans (40), S. hominis (16), S. haemolyticus (12), Streptococcus canis (9), Proteus mirabilis (8), Pasteurella multocida (7), Streptococcus mitis (7), Staphylococcus xylosus (7), S. capitis (6), S. chromogenes (4), S. sciuri (3), S. auricularis (2), S. lentus (2), S. hyicus (2), Streptococcus suis (2) and Pseudomonas argentinensis (2). Sixteen other isolates were identified to species level. A molecular method using 16S rRNA sequencing was used to confirm/identify 22 isolates. Salmonella or campylobacters were not isolated from rectal swabs. E. coli and S. felis/simulans together constituted 50% of isolates from vagina. S. felis/simulans was the most common species from culture positive ear and eye samples. P. multocida was isolated from 15% of mouth samples. Coagulase-negative staphylococci were the most common isolates from nose and wound swabs. Staphylococcus aureus, or S. intemedius/S. pseudintermedius were not isolated from any sample. Antimicrobial drug resistance was minimal, most isolates being susceptible to all drugs tested against, including tetracycline. Copyright © 2010 Elsevier Ltd. All rights reserved.

  17. Dose dependency of outcomes of intrapleural fibrinolytic therapy in new rabbit empyema models

    Science.gov (United States)

    Florova, Galina; Azghani, Ali O.; Buchanan, Ann; Boren, Jake; Allen, Timothy; Rahman, Najib M.; Koenig, Kathleen; Chamiso, Mignote; Karandashova, Sophia; Henry, James; Idell, Steven

    2016-01-01

    The incidence of empyema (EMP) is increasing worldwide; EMP generally occurs with pleural loculation and impaired drainage is often treated with intrapleural fibrinolytic therapy (IPFT) or surgery. A number of IPFT options are used clinically with empiric dosing and variable outcomes in adults. To evaluate mechanisms governing intrapleural fibrinolysis and disease outcomes, models of Pasteurella multocida and Streptococcus pneumoniae were generated in rabbits and the animals were treated with either human tissue (tPA) plasminogen activator or prourokinase (scuPA). Rabbit EMP was characterized by the development of pleural adhesions detectable by chest ultrasonography and fibrinous coating of the pleura. Similar to human EMP, rabbits with EMP accumulated sizable, 20- to 40-ml fibrinopurulent pleural effusions associated with extensive intrapleural organization, significantly increased pleural thickness, suppression of fibrinolytic and plasminogen-activating activities, and accumulation of high levels of plasminogen activator inhibitor 1, plasminogen, and extracellular DNA. IPFT with tPA (0.145 mg/kg) or scuPA (0.5 mg/kg) was ineffective in rabbit EMP (n = 9 and 3 for P. multocida and S. pneumoniae, respectively); 2 mg/kg tPA or scuPA IPFT (n = 5) effectively cleared S. pneumoniae-induced EMP collections in 24 h with no bleeding observed. Although intrapleural fibrinolytic activity for up to 40 min after IPFT was similar for effective and ineffective doses of fibrinolysin, it was lower for tPA than for scuPA treatments. These results demonstrate similarities between rabbit and human EMP, the importance of pleural fluid PAI-1 activity, and levels of plasminogen in the regulation of intrapleural fibrinolysis and illustrate the dose dependency of IPFT outcomes in EMP. PMID:27343192

  18. Aerobic salivary bacteria in wild and captive Komodo dragons.

    Science.gov (United States)

    Montgomery, Joel M; Gillespie, Don; Sastrawan, Putra; Fredeking, Terry M; Stewart, George L

    2002-07-01

    During the months of November 1996, August 1997, and March 1998, saliva and plasma samples were collected for isolation of aerobic bacteria from 26 wild and 13 captive Komodo dragons (Varanus komodoensis). Twenty-eight Gram-negative and 29 Gram-positive species of bacteria were isolated from the saliva of the 39 Komodo dragons. A greater number of wild than captive dragons were positive for both Gram-negative and Gram-positive bacteria. The average number of bacterial species within the saliva of wild dragons was 46% greater than for captive dragons. While Escherichia coli was the most common bacterium isolated from the saliva of wild dragons, this species was not present in captive dragons. The most common bacteria isolated from the saliva of captive dragons were Staphylococcus capitis and Staphylococcus capitis and Staphylococcus caseolyticus, neither of which were found in wild dragons. High mortality was seen among mice injected with saliva from wild dragons and the only bacterium isolated from the blood of dying mice was Pasteurella multocida. A competitive inhibition enzyme-linked immunosorbent assay revealed the presence of anti-Pasteurella antibody in the plasma of Komodo dragons. Four species of bacteria isolated from dragon saliva showed resistance to one or more of 16 antimicrobics tested. The wide variety of bacteria demonstrated in the saliva of the Komodo dragon in this study, at least one species of which was highly lethal in mice and 54 species of which are known pathogens, support the observation that wounds inflicted by this animal are often associated with sepsis and subsequent bacteremia in prey animals.

  19. Mutant prevention concentration, pharmacokinetic-pharmacodynamic integration, and modeling of enrofloxacin data established in diseased buffalo calves.

    Science.gov (United States)

    Ramalingam, B; Sidhu, P K; Kaur, G; Venkatachalam, D; Rampal, S

    2015-12-01

    The pharmacokinetic-pharmacodynamic (PK/PD) modeling of enrofloxacin data using mutant prevention concentration (MPC) of enrofloxacin was conducted in febrile buffalo calves to optimize dosage regimen and to prevent the emergence of antimicrobial resistance. The serum peak concentration (Cmax ), terminal half-life (t1/2 K10) , apparent volume of distribution (Vd(area) /F), and mean residence time (MRT) of enrofloxacin were 1.40 ± 0.27 μg/mL, 7.96 ± 0.86 h, 7.74 ± 1.26 L/kg, and 11.57 ± 1.01 h, respectively, following drug administration at dosage 12 mg/kg by intramuscular route. The minimum inhibitory concentration (MIC), minimum bactericidal concentration, and MPC of enrofloxacin against Pasteurella multocida were 0.055, 0.060, and 1.45 μg/mL, respectively. Modeling of ex vivo growth inhibition data to the sigmoid Emax equation provided AUC24 h /MIC values to produce effects of bacteriostatic (33 h), bactericidal (39 h), and bacterial eradication (41 h). The estimated daily dosage of enrofloxacin in febrile buffalo calves was 3.5 and 8.4 mg/kg against P. multocida/pathogens having MIC90 ≤0.125 and 0.30 μg/mL, respectively, based on the determined AUC24 h /MIC values by modeling PK/PD data. The lipopolysaccharide-induced fever had no direct effect on the antibacterial activity of the enrofloxacin and alterations in PK of the drug, and its metabolite will be beneficial for its use to treat infectious diseases caused by sensitive pathogens in buffalo species. In addition, in vitro MPC data in conjunction with in vivo PK data indicated that clinically it would be easier to eradicate less susceptible strains of P. multocida in diseased calves. © 2015 John Wiley & Sons Ltd.

  20. Yersinia philomiragia sp. n., a new member of the Pasteurella group of bacteria, naturally pathogenic for the muskrat (Ondatra zibethica)

    Science.gov (United States)

    Jensen, W.I.; Owen, C.R.; Jellison, W.L.

    1969-01-01

    A bacterium experimentally pathogenic for muskrats (Ondatra zibethica), white mice, mountain voles (Microtus montanus), and deer mice (Peromyscus maniculatus) was isolated from the tissues of a sick muskrat captured on the Bear River Migratory Bird Refuge (Brigham City, Utah) and from four surface water samples collected within 15 miles of that point. In culture, the cells are chiefly coccoid, but in the tissues of muskrats and voles they resemble the bizarre forms of Yersinia pestis, except for their smaller size. The characteristics of the organism are described and the name Yersinia philomiragia sp. n. is proposed.

  1. Efficacy of Elimination of Pasteurella pneumotropica from a Mouse Specific Pathogen-Free Barrier Breeding Unit through Treatment with Enrofloxacin

    DEFF Research Database (Denmark)

    Østergaard, Grete; Arnorsdottir, Stefania Embla; Schumacher-Petersen, Camilla

    2010-01-01

    , and enrofloxacin (EF) was chosen as the most appropriate antibiotic to treat this infection. Various doses of EF were tested for toxic effects on NMRI-mice prior to the treatment, and since no negative effects of EF, regardlessof dose tested, were observed, the highest dose of 150 mg/kg body weight was chosen...

  2. Susceptibilité de Rattus norvegicus et Rattus rattus frugivurus de la ville de Recife à la Pasteurella pestis

    Directory of Open Access Journals (Sweden)

    Dalva A. de Mello

    1968-06-01

    Full Text Available L'auíeur a vérifié la susceptibilité de deux espèces de rongeurs domestiques de la ville de Recife. Etat du Pernambuco, R. norvegicus et Rattus rattus frugivurus, les comparant aux souris albinos de la souche "Swiss" avec deux souches de P. pestis dont une était isolée au municipe d'Exu, Etat du Pernambuco âenommée PEXU 19 et Vautre provenante du Venezuela dite RANGEL. Les deux espèces de rongeurs ont montré une resistence modérée par rapport aux deux souches de P. pestis tandis que les souris ont révélé d'être hautement susceptibles.

  3. Classification of varieties of pasteurella pestis strains isolated in the interior of the state of Pernambuco-Brazil

    Directory of Open Access Journals (Sweden)

    Dalva A. Mello

    1969-01-01

    Full Text Available Studies were made on the biochemical behavior of 100 strains of P.pestis isolated in Northeastern Brazil with regard to production of nitrous acid, reduction of nitrates to nitrltes, and aciáification of glycerol. Results showed that 98 strains can be classified as "orientalis variety", while the remaining two could not be included in any of the existing "varieties".

  4. New derivatives of salicylamides: Preparation and antimicrobial activity against various bacterial species.

    Science.gov (United States)

    Pauk, Karel; Zadražilová, Iveta; Imramovský, Aleš; Vinšová, Jarmila; Pokorná, Michaela; Masaříková, Martina; Cížek, Alois; Jampílek, Josef

    2013-11-01

    Three series of salicylanilides, esters of N-phenylsalicylamides and 2-hydroxy-N-[1-(2-hydroxyphenylamino)-1-oxoalkan-2-yl]benzamides, in total thirty target compounds were synthesized and characterized. The compounds were evaluated against seven bacterial and three mycobacterial strains. The antimicrobial activities of some compounds were comparable or higher than the standards ampicillin, ciprofloxacin or isoniazid. Derivatives 3f demonstrated high biological activity against Staphylococcus aureus (⩽0.03μmol/L), Mycobacterium marinum (⩽0.40μmol/L) and Mycobacterium kansasii (1.58μmol/L), 3g shows activity against Clostridium perfringens (⩽0.03μmol/L) and Bacillus cereus (0.09μmol/L), 3h against Pasteurella multocida (⩽0.03μmol/L) and M. kansasii (⩽0.43μmol/L), 3i against methicillin-resistant S. aureus and B. cereus (⩽0.03μmol/L). The structure-activity relationships are discussed for all the compounds. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Ceftiofur sodium, a broad-spectrum cephalosporin: evaluation in vitro and in vivo in mice.

    Science.gov (United States)

    Yancey, R J; Kinney, M L; Roberts, B J; Goodenough, K R; Hamel, J C; Ford, C W

    1987-07-01

    Ceftiofur sodium, a broad-spectrum beta-lactamase-resistant cephalosporin, was evaluated in vitro and in vivo in mice. Ceftiofur is the sodium salt of (6R, 7R)-7[( 2-amino-4-thiazolyl)-Z- (methoxyimino)acetyl]amino)-3-[( (2-furanylcarbonyl)thio]methyl)-8-oxo-5- thia-1-azabicyclo-[4.2.0]oct-2-ene-2-carboxylate. Minimal inhibitory concentration values were obtained with 264 strains representing 9 genera and 17 species of bacterial pathogens from cattle, swine, sheep, horses, poultry, dogs, cats, and human beings. Ceftiofur was more active than was ampicillin against all strains tested including beta-lactamase-producing organisms. In mice with systemic infections, ceftiofur was more active than or equivalent to ampicillin, cephalothin, cefamandole, cloxacillin, cefoperazone, or pirlimycin. These protection tests included infections with Escherichia coli, Haemophilus pleuropneumoniae, H somnus, Pasteurella haemolytica, P multocida, Salmonella typhimurium, or Staphylococcus aureus. In infant mice with E coli-induced lethal diarrhea and in mice with S aureus and E coli-induced mastitis, ceftiofur was comparable or more active than was ampicillin.

  6. Isolation and polymerase chain reaction-based identification of Riemerella anatipestifer from ducks in Kerala, India

    Directory of Open Access Journals (Sweden)

    Manju Soman

    2014-10-01

    Full Text Available Aim: The aim was to isolate and characterize Riemerella anatipestifer organisms from disease outbreaks in ducks in Kerala. Materials and Methods: Ducklings, suspected of Riemerella infection, were sacrificed and subjected to post-mortem examination. Heart blood smears and impression smears from liver and spleen were examined for the presence of pathogenic organisms. Heart blood, lung, liver, and spleen collected aseptically from the birds were subjected to isolation trials in brain heart infusion agar and 10% bovine blood agar. The isolates were characterized based on morphology, cultural characteristics and biochemical tests, and their identity were confirmed by polymerase chain reaction (PCR and the PCR amplified DNA was sequenced. The antibiotic sensitivity testing of the isolates were carried out using six antibiotics viz ciprofloxacin, chloramphenicol, enrofloxacin, amoxycillin, cotrimoxazole, and gentamicin. Results: Colonies suggestive of Riemerella organisms could be isolated on blood agar. Biochemical characterization and PCR confirmed the identity of isolates as R. anatipestifer. The nucleotide sequence of the PCR product showed 99% homology to the R. anatipestifer sequences in the NCBI. The antibiogram revealed that the organisms were sensitive to ciprofloxacin, enrofloxacin, and gentamicin. Conclusion: The present study suggests that the PCR assay can facilitate fast and proper identification of R. anatipestifer infection in ducks. The assay can also differentiate between R. anatipestifer and Pasteurella multocida and can replace the traditional methods of differentiation which are cumbersome and time-consuming.

  7. Chronic intestinal pseudo-obstruction associated with enteric ganglionitis in a Persian cat

    Directory of Open Access Journals (Sweden)

    Jeremy Mortier

    2016-06-01

    Full Text Available Case summary A 7-year-old neutered male Persian cat was presented for acute vomiting and inappetence. Physical examination revealed severe abdominal distension. Radiographs demonstrated pneumoperitoneum, megaoesophagus and generalised gaseous distension of the digestive tract. Exploratory coeliotomy was performed, revealing markedly distended and thickened small and large intestines with no observable peristalsis. No intestinal perforation was present. Bacteriological and cytological analysis of abdominal fluid revealed a septic peritonitis involving Pasteurella multocida . Full-thickness intestinal biopsies demonstrated lymphocytic ganglioneuritis localised to the enteric nervous system, in association with glandular atrophy and muscular layer hypertrophy. Amoxicillin-clavulanate and analgesics were given. The cat’s general condition gradually improved after the addition of pyridostigmine bromide (0.5 mg/kg q12h PO, initiated 3 days postsurgery. Vomiting resolved and did not recur. Follow-up radiographs at 15 days, and 1 and 6 months showed persistent intestinal ileus, milder than on the pretreatment radiographs. Thirty months after presentation the cat is still alive, without clinical signs, and receives 1 mg/kg q12h pyridostigmine. Relevance and novel information To our knowledge, this is the first case of ganglioneuritis of the myenteric plexus described in cats, as well as the first one successfully treated with pyridostigmine. Chronic intestinal pseudo-obstruction is a very rare condition in cats but should be included in the differential diagnosis of generalised gastrointestinal ileus.

  8. A bighorn sheep die-off in southern Colorado involving a Pasteurellaceae strain that may have originated from syntopic cattle.

    Science.gov (United States)

    Wolfe, Lisa L; Diamond, Brandon; Spraker, Terry R; Sirochman, Michael A; Walsh, Daniel P; Machin, Chandra M; Bade, Donald J; Miller, Michael W

    2010-10-01

    We investigated a pasteurellosis epizootic in free-ranging bighorn sheep (Ovis canadensis) wherein a Pasteurellaceae strain carried by syntopic cattle (Bos taurus) under severe winter conditions appeared to contribute to pneumonia in affected bighorns. Twenty-one moribund or dead bighorn sheep were found on the "Fossil Ridge" herd's winter range, Colorado, USA, between 13 December 2007 and 29 February 2008. Eight carcasses examined showed gross or microscopic evidence of acute to subacute fibrinous bronchopneumonia. All eight carcasses yielded at least one β-hemolytic Mannheimia haemolytica biogroup 1(±(G)) strain, and seven also yielded a β-hemolytic Bibersteinia trehalosi biogroup 4 (CDS) strain; evidence of Pasteurella multocida, Mycoplasma ovipneumoniae, and parainfluenza 3 and bovine respiratory syncytial viruses was also detected. Isolates of β-hemolytic Manneimia haemolytica biogroup 1(G) from a bighorn carcass and a syntopic cow showed 99.5% similarity in genetic fingerprints; B. trehalosi biogroup 4(CDS) isolates were ≥94.9% similar to an isolate from a nearby bighorn herd. Field and laboratory observations suggested that pneumonia in affected bighorns may have been caused by a combination of pathogens including two pathogenic Pasteurellaceae strains--one likely of cattle origin and one likely of bighorn origin--with infections in some cases perhaps exacerbated by other respiratory pathogens and severe weather conditions. Our and others' findings suggest that intimate interactions between wild sheep and cattle should be discouraged as part of a comprehensive approach to health management and conservation of North American wild sheep species.

  9. How Respiratory Pathogens Contribute to Lamb Mortality in a Poorly Performing Bighorn Sheep ( Ovis canadensis ) Herd.

    Science.gov (United States)

    Wood, Mary E; Fox, Karen A; Jennings-Gaines, Jessica; Killion, Halcyon J; Amundson, Sierra; Miller, Michael W; Edwards, William H

    2017-01-01

    We evaluated bighorn sheep ( Ovis canadensis ) ewes and their lambs in captivity to examine the sources and roles of respiratory pathogens causing lamb mortality in a poorly performing herd. After seven consecutive years of observed December recruitments of sheep from the remnant Gribbles Park herd in Colorado, US were captured and transported to the Thorne-Williams Wildlife Research Center in Wyoming in March 2013. Ewes were sampled repeatedly over 16 mo. In April 2014, ewes were separated into individual pens prior to lambing. Upon death, lambs were necropsied and tested for respiratory pathogens. Six lambs developed clinical respiratory disease and one lamb was abandoned. Pathology from an additional six lambs born in 2013 was also evaluated. Mycoplasma ovipneumoniae , leukotoxigenic Mannheimia spp., leukotoxigenic Bibersteinia trehalosi , and Pasteurella multocida all contributed to lamb pneumonia. Histopathology suggested a continuum of disease, with lesions typical of pasteurellosis predominating in younger lambs and lesions typical of mycoplasmosis predominating in older lambs. Mixed pathology was observed in lambs dying between these timeframes. We suspected that all the ewes in our study were persistently infected and chronically shedding the bacteria that contributed to summer lamb mortality.

  10. Fusobacterium necrophorum in North American Bighorn Sheep ( Ovis canadensis ) Pneumonia.

    Science.gov (United States)

    Shanthalingam, Sudarvili; Narayanan, Sanjeevkumar; Batra, Sai Arun; Jegarubee, Bavananthasivam; Srikumaran, Subramaniam

    2016-07-01

    Fusobacterium necrophorum has been detected in pneumonic bighorn sheep (BHS; Ovis canadensis ) lungs, in addition to the aerobic respiratory pathogens Mannheimia haemolytica , Bibersteinia trehalosi , Pasteurella multocida , and Mycoplasma ovipneumoniae . Similar to M. haemolytica , F. necrophorum produces a leukotoxin. Leukotoxin-induced lysis and degranulation of polymorphonuclear leukocytes (PMNs) and macrophages are responsible for acute inflammation and lung tissue damage characteristic of M. haemolytica -caused pneumonia. As one approach in elucidating the role of F. necrophorum in BHS pneumonia, we determined the frequency of the presence of F. necrophorum in archived pneumonic BHS lung tissues, and susceptibility of BHS leukocytes to F. necrophorum leukotoxin. A species-specific PCR assay detected F. necrophorum in 37% of pneumonic BHS lung tissues (total tested n=70). Sequences of PCR amplicons were similar to the less virulent F. necrophorum subsp. funduliforme. Fusobacterium necrophorum leukotoxin exhibited cytotoxicity to BHS PMNs and peripheral blood mononuclear cells. As with the M. haemolytica leukotoxin, F. necrophorum leukotoxin was more toxic to BHS PMNs than domestic sheep PMNs. It is likely that F. necrophorum enters the lungs after M. haemolytica and other aerobic respiratory pathogens enter the lungs and initiate tissue damage, thereby creating a microenvironment that is conducive for anaerobic bacterial growth. In summary, Fusobacterium leukotoxin is highly toxic for BHS leukocytes; however, based on the PCR findings, it is unlikely to play a direct role in the development of BHS pneumonia.

  11. Pneumonia in slaughtered sheep in south-western Iran: pathological characteristics and aerobic bacterial aetiology.

    Science.gov (United States)

    Azizi, Shahrzad; Korani, Farzad Shahrani; Oryan, Ahmad

    2013-01-01

    In this study, the lungs of 1,000 sheep carcasses were subjected to gross examination and those suspected to be infected with pneumonia were studied at histopathological level as well as examined for presence of bacteria. Pneumonia was detected in 42 (4.2%) carcasses. Based on histopathological lesions, 45.24% were affected with suppurative bronchopneumonia, 20.93% with interstitial pneumonia, 11.9% bronchointerstitial pneumonia, 7.14% with fibrinous bronchopneumonia and 2.38% with embolic pneumonia. In addition, 11.9% of the lungs showed lung abscesses and 2.33% were affected with pleuritis without involving pulmonary parenchyma. Bacteriological examination revealed presence of ovine pathogens, such as Pasteurella multocida (24.53%), Staphylococcus aureus (20.75%), Klebsiella pneumoniae (15.09%), Corynebacterium pseudotuberculosis (7.55%) and Actinomyces pyogenes (1.89%). The most common form of pneumonia was suppurative bronchopneumonia with moderate amounts of fibrin deposits on the pleural surface and inside the bronchioles and alveoli.

  12. Pneumonia in slaughtered sheep in south-western Iran: pathological characteristics and aerobic bacterial aetiology

    Directory of Open Access Journals (Sweden)

    Shahrzad Azizi

    2013-03-01

    Full Text Available In this study, the lungs of 1,000 sheep carcasses were subjected to gross examination and those suspected to be infected with pneumonia were studied at histopathological level as well as examined for presence of bacteria. Pneumonia was detected in 42 (4.2% carcasses. Based on histopathological lesions, 45.24% were affected with suppurative bronchopneumonia, 20.93% with interstitial pneumonia, 11.9% bronchointerstitial pneumonia, 7.14% with fibrinous bronchopneumonia and 2.38% with embolic pneumonia. In addition, 11.9% of the lungs showed lung abscesses and 2.33% were affected with pleuritis without involving pulmonary parenchyma. Bacteriological examination revealed presence of ovine pathogens, such as Pasteurella multocida (24.53%, Staphylococcus aureus (20.75%, Klebsiella pneumoniae (15.09%, Corynebacterium pseudotuberculosis (7.55% and Actinomyces pyogenes (1.89%. The most common form of pneumonia was suppurative bronchopneumonia with moderate amounts of fibrin deposits on the pleural surface and inside the bronchioles and alveoli.

  13. Survey of susceptibility to marbofloxacin in bacteria isolated from diseased pigs in Europe.

    Science.gov (United States)

    El Garch, F; Kroemer, S; Galland, D; Morrissey, I; Woehrle, F

    2017-06-17

    A monitoring programme of marbofloxacin susceptibility of bacteria from Europe causing respiratory tract infection and meningitis in pigs has been active since 1994 and 2002, respectively. Monitoring digestive, metritis and urinary tract infection (UTI) in pigs has been active since 2005 and susceptibility results until 2013 are presented. Minimum inhibitory concentration (MIC) was determined by broth microdilution. For MIC interpretation, Vétoquinol-evaluated breakpoints were applied. For digestive pathogens, Escherichia coli and Salmonella species (1717 and 300 isolates, respectively) exhibited 7.5 per cent resistance in E coli and no resistance in Salmonella species. Similarly, E coli from metritis (369 isolates) had 7.0 per cent resistance to marbofloxacin. However, E coli from UTI (633 isolates) had higher resistance (10.4 per cent). For Streptococcus suis causing meningitis (585 isolates), marbofloxacin susceptibility was very high with only 0.5 per cent resistance and 0.4 per cent resistance was observed with S suis causing respiratory disease (729 isolates). Other respiratory pathogens were also highly susceptible to marbofloxacin with no resistance in Actinobacillus pleuropneumoniae (647 isolates) or Bordetella bronchiseptica (504 isolates), 0.1 per cent resistance in Pasteurella multocida (1373 isolates) and 1.4 per cent resistance in Haemophilus parasuis (145 isolates). There was no apparent change in marbofloxacin MIC over time for any bacterial pathogen based on MIC 50/90 These data confirm previously published MIC results from porcine and other animal infections. British Veterinary Association.

  14. Tiamulin activity against fastidious and nonfastidious veterinary and human bacterial isolates: initial development of in vitro susceptibility test methods.

    Science.gov (United States)

    Jones, Ronald N; Pfaller, Michael A; Rhomberg, Paul R; Walter, Donald H

    2002-02-01

    Tiamulin is a pleuromutilin derivative used in veterinary practice for the control and specific therapy of infections in swine. This report summarizes studies to establish standardized susceptibility testing methods, interpretive criteria, and reagent details for use in veterinary methods recently developed by the National Committee for Clinical Laboratory Standards (NCCLS) (standards M31-A and M37-A, NCCLS, Wayne, Pa., 1999). A total of 636 fastidious and nonfastidious animal and human pathogens were processed by using media and procedures described by the NCCLS. Tiamulin disk diffusion tests used a 30-microg disk concentration, and the proposed MIC breakpoints corresponding to levels achievable in animal target tissues (lung) were or =32 microg/ml for resistance. Correlate zone diameters for specific nonfastidious species were as follows: for Pasteurella multocida and staphylococci tested on Mueller-Hinton agar, susceptibility at > or =19 mm and resistance at or =16 mm and resistance at or =9 mm) was suggested for veterinary fastidious medium broth and enriched chocolate Mueller-Hinton agar. Absolute categorical agreement between NCCLS dilution and disk diffusion test results with these criteria ranged from 90.5 to 96.2%. Tiamulin susceptibility testing methods appear to be accurate in their categorical classification for indicated species, and their availability will allow immediate testing of animal isolates to guide therapy via appropriate levels of dosing and to monitor the development of resistance for agents in this unique class.

  15. Disclosing respiratory co-infections: a broad-range panel assay for avian respiratory pathogens on a nanofluidic PCR platform.

    Science.gov (United States)

    Croville, Guillaume; Foret, Charlotte; Heuillard, Pauline; Senet, Alexis; Delpont, Mattias; Mouahid, Mohammed; Ducatez, Mariette F; Kichou, Faouzi; Guerin, Jean-Luc

    2018-06-01

    Respiratory syndromes (RS) are among the most significant pathological conditions in edible birds and are caused by complex coactions of pathogens and environmental factors. In poultry, low pathogenic avian influenza A viruses, metapneumoviruses, infectious bronchitis virus, infectious laryngotracheitis virus, Mycoplasma spp. Escherichia coli and/or Ornithobacterium rhinotracheale in turkeys are considered as key co-infectious agents of RS. Aspergillus sp., Pasteurella multocida, Avibacterium paragallinarum or Chlamydia psittaci may also be involved in respiratory outbreaks. An innovative quantitative PCR method, based on a nanofluidic technology, has the ability to screen up to 96 samples with 96 pathogen-specific PCR primers, at the same time, in one run of real-time quantitative PCR. This platform was used for the screening of avian respiratory pathogens: 15 respiratory agents, including viruses, bacteria and fungi potentially associated with respiratory infections of poultry, were targeted. Primers were designed and validated for SYBR green real-time quantitative PCR and subsequently validated on the Biomark high throughput PCR nanofluidic platform (Fluidigm©, San Francisco, CA, USA). As a clinical assessment, tracheal swabs were sampled from turkeys showing RS and submitted to this panel assay. Beside systematic detection of E. coli, avian metapneumovirus, Mycoplasma gallisepticum and Mycoplasma synoviae were frequently detected, with distinctive co-infection patterns between French and Moroccan flocks. This proof-of-concept study illustrates the potential of such panel assays for unveiling respiratory co-infection profiles in poultry.

  16. Enzymatic production of human milk oligosaccharides

    DEFF Research Database (Denmark)

    Guo, Yao

    . A recombinant Pasteurella multocida sialyltransferase (EC 2.4.99.-), namely PmST, exhibiting promiscuous trans-sialidase activities was examined. The enzyme catalysed α-2,3- and α-2,6- sialylation of lactose using either 2- O -(p-nitrophenyl)-α- D - N -acetylneuraminic acid or casein glycomacropeptide...... galactooligosaccharides with use of galactooligosaccharides as acceptors. Secondly, we examined the regioselectivity of five designed mutants of PmST catalysing synthesis of 3'- and 6'-sialyllactoses using casein glycomacropeptide and lactose as substrates. The mutants PmST E271F , PmST R313Y and PmST E271F/R313Y...... was almost abolished. The k cat / K m value for PmST P34H catalysing 6'-sialyllactose synthesis using 3'-sialyllactose as donor was 31.2 M -1 s -1 . Moreover, both the wild type enzyme and PmST P34H were capable of catalysing the hydrolysis and transfer of α-2,6 bound sialic acid....

  17. Serologic survey for selected arboviruses and other potential pathogens in wildlife from Mexico.

    Science.gov (United States)

    Aguirre, A A; McLean, R G; Cook, R S; Quan, T J

    1992-07-01

    During 1988 and 1989, a serologic survey of wildlife was conducted in northeastern Mexico to determine the presence, prevalence, and distribution of arboviruses and other selected disease agents. Eighty mammal specimens were tested. Antibodies to vesicular stomatitis-Indiana, Venezuelan equine encephalitis-Mena II, Rio Grande virus, and vesicular stomatitis-New Jersey were detected predominantly in small mammals. Deer and mouflon (Ovis musimon) had antibodies to bluetongue and epizootic hemorrhagic disease. Two species had serologic evidence of recent exposure to Francisella tularensis. A white-tailed deer (Odocoileus virginianus) had antibodies to Anaplasma marginale. All specimens tested for antibodies against Yersinia pestis and Brucella abortus were negative. Sera from 315 birds were tested for antibody against five equine encephalitis viruses and six avian pathogens. During 1988, antibodies to Venezuelan equine encephalitis-Mena II, Venezuelan equine encephalitis-TC83, St. Louis encephalitis, eastern equine encephalitis, and western equine encephalitis were detected in birds of several species. Antibodies to Pasteurella multocida and Newcastle disease virus were also detected. Birds from five species presented antibodies to Mycoplasma meleagridis. Specimens tested for M. gallisepticum, M. synoviae, and Chlamydia psittaci were negative. To the best of our knowledge, this survey represents the first serologic evidence of bluetongue, Cache Valley virus, epizootic hemorrhagic disease, Jamestown Canyon virus, vesicular stomatitis-Indiana, vesicular stomatitis-New Jersey, Rio Grande virus, and tularemia reported among wildlife in Mexico.

  18. Isolation and Antibiogram of Aerobic Nasal Bacterial Flora of Apparently Healthy West African Dwarf Goats

    Directory of Open Access Journals (Sweden)

    B. O. Emikpe

    2009-01-01

    Full Text Available Goats are important in the livestock economy by their adaptability to adverse environmental conditions as they are good sources of protein and income for the rural poor. Studies conducted on the bacterial flora of the respiratory tract in goats focused on the pneumonic lungs, with fewer studies on the apparently normal nasal passage and antibiogram of isolated organisms. This study was carried out on 60 apparently healthy West African Dwarf goats. The nasal swab from each goat was analyzed using standard methods. The disc diffusion technique was used for the antibiotic sensitivity test. Three hundred and twenty-eight isolates were obtained. The most frequently isolated species was Streptococcus spp., while Escherichia coli and Staphylococcus aureus were the second dominant bacteria. Other species were isolated at relatively lower rates. The isolation of Mannheimia haemolytica and Pasteurella multocida from the nasal cavity of apparently healthy goats in this study reflects their possible role in most common respiratory diseases encountered in small ruminants. Most of the bacteria were found to be susceptible to streptomycin, quinolones (perfloxacin, ciprofloxacin and ofloxacin and gentamicin, while they were resistant to tetracycline, augmentin and erythromycin. This study shows the relationship between misuse or unrestricted use of antibiotics and drug resistance. Therefore, there is a need for practitioners and researchers to be informed of the appropriate antibiotics to be used in respiratory infections and during control programs.

  19. Quantification and characterization of enzymatically produced hyaluronan with fluorophore-assisted carbohydrate electrophoresis.

    Science.gov (United States)

    Kooy, Floor K; Ma, Muyuan; Beeftink, Hendrik H; Eggink, Gerrit; Tramper, Johannes; Boeriu, Carmen G

    2009-01-15

    Hyaluronan (HA) is a polysaccharide with high-potential medical applications, depending on the chain length and the chain length distribution. Special interest goes to homogeneous HA oligosaccharides, which can be enzymatically produced using Pasteurella multocida hyaluronan synthase (PmHAS). We have developed a sensitive, simple, and fast method, based on fluorophore-assisted carbohydrate electrophoresis (FACE), for characterization and quantification of polymerization products. A chromatographic pure fluorescent template was synthesized from HA tetrasaccharide (HA4) and 2-aminobenzoic acid. HA4-fluor and HA4 were used as template for PmHAS-mediated polymerization of nucleotide sugars. All products, fluorescent and nonfluorescent, were analyzed with gel electrophoresis and quantified using lane densitometry. Comparison of HA4- and HA4-fluor-derived polymers showed that the fluorophore did not negatively influence the PmHAS-mediated polymerization. Only even-numbered oligosaccharide products were observed using HA4-fluor or HA4 as template. The fluorophore intensity was linearly related to its concentration, and the limit of detection was determined to be 7.4pmol per product band. With this assay, we can now differentiate oligosaccharides of size range DP2 (degree of polymerization 2) to approximately DP400, monitor the progress of polymerization reactions, and measure subtle differences in polymerization rate. Quantifying polymerization products enables us to study the influence of experimental conditions on HA synthesis.

  20. Potential probiotic attributes of a new strain of Bacillus coagulans CGMCC 9951 isolated from healthy piglet feces.

    Science.gov (United States)

    Gu, Shao-Bin; Zhao, Li-Na; Wu, Ying; Li, Shi-Chang; Sun, Jian-Rui; Huang, Jing-Fang; Li, Dan-Dan

    2015-06-01

    A new strain of Bacillus coagulans CGMCC 9551, which has a broad range of antibacterial activities against six main pathogenic bacteria including Escherichia coli O8, Staphylococcus aureus, Salmonella enterica subsp. enterica serovar enteritidis, Streptococcus suis, Listeria monocytogenes and Pasteurella multocida, was isolated from healthy piglet feces. In adhesion assay, the isolate exhibited a stronger adhesion to pig intestinal mucus than that of B. subtilis JT143 and L. acidophilus LY24 respectively isolated from BioPlus(®)2B and FloraFIT(®) Probiotics (P coagulans CGMCC 9551 was reduced by only 20% at 4 h exposure under 0.9% w/v bile salt. The strain was fully resistant to pH 2 for 2 h with 90.1 ± 3.5% survival and susceptible to 15 antibiotics commonly used in veterinary medicine. Additionally, the bacteria showed amylase, protease and cellulase activities. The safety assessment demonstrated the lack of toxicity potential in B. coagulans CGMCC 9551 by ligated rabbit ileal loop assay, acute and subchronic toxicity test. These results implied that that the new strain of B. coagulans CGMCC 9951 isolated from healthy piglet feces has promising probiotic characteristics and offers desirable opportunities for its successful commercialization as one excellent candidate probiotic.

  1. Pharmacokinetic/pharmacodynamic evaluation of marbofloxacin as a single injection for Pasteurellaceae respiratory infections in cattle using population pharmacokinetics and Monte Carlo simulations.

    Science.gov (United States)

    Paulin, A; Schneider, M; Dron, F; Woehrle, F

    2018-02-01

    Population pharmacokinetic of marbofloxacin was investigated with 52 plasma concentration-time profiles obtained after intramuscular administration of Forcyl® in cattle. Animal's status, pre-ruminant, ruminant, or dairy cow, was retained as a relevant covariate for clearance. Monte Carlo simulations were performed using a stratification by status, and 1000 virtual disposition curves were generated in each bovine subpopulation for the recommended dosage regimen of 10 mg/kg as a single injection. The probability of target attainment (PTA) of pharmacokinetic/pharmacodynamic (PK/PD) ratios associated with clinical efficacy and prevention of resistance was determined in each simulated subpopulation. The cumulative fraction of response (CFR) of animals achieving a PK/PD ratio predictive of positive clinical outcome was then calculated for the simulated dosage regimen, taking into account the minimum inhibitory concentration (MIC) distribution of Pasteurella multocida, Mannheimia haemolytica, and Histophilus somni. When considering a ratio of AUC 0-24 hr /MIC (area under the curve/minimum inhibitory concentration) greater than 125 hr, CFRs ranging from 85% to 100% against the three Pasteurellaceae in each bovine subpopulation were achieved. The PTA of the PK/PD threshold reflecting the prevention of resistances was greater than 90% up to MPC (mutant prevention concentration) values of 1 μg/ml in pre-ruminants and ruminants and 0.5 μg/ml in dairy cows. © 2017 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

  2. Immunomodulatory activity of methanolic extract of Morus alba Linn. (mulberry) leaves.

    Science.gov (United States)

    Bharani, Shendige Eswara Rao; Asad, Mohammed; Dhamanigi, Sunil Samson; Chandrakala, Gowda Kallenahalli

    2010-01-01

    The leaves of Morus alba Linn. (Family: Moraceae) commonly known as mulberry are mainly used as food for the silkworms and they are sometimes eaten as vegetable or used as cattle fodder in different parts of the world. The effect of Morus alba on the immune system was evaluated by using different experimental models such as carbon clearance test, cyclophosphamide induced neutropenia, neutrophil adhesion test, effect on serum immunoglobulins, mice lethality test and indirect haemagglutination test. Methanolic extract of Morus alba was administered orally at low dose and high dose of 100 mg/kg and 1 g/kg respectively and Ocimum sanctum (100 mg/kg, po) was used as standard drug. Morus alba extract in both doses increased the levels of serum immunoglobulins and prevented the mortality induced by bovine Pasteurella multocida in mice. It also increased the circulating antibody titre in indirect haemagglutination test. On the other hand, it showed significant increase in the phagocytic index in carbon clearance assay, a significant protection against cyclophosphamide induced neutropenia and increased the adhesion of neutrophils in the neutrophil adhesion test. Hence, it was concluded that Morus alba increases both humoral immunity and cell mediated immunity.

  3. Chronic intestinal pseudo-obstruction associated with enteric ganglionitis in a Persian cat.

    Science.gov (United States)

    Mortier, Jeremy; Elissalt, Estelle; Palierne, Sophie; Semin, Marie Odile; Delverdier, Maxence; Diquélou, Armelle

    2016-01-01

    Case summary A 7-year-old neutered male Persian cat was presented for acute vomiting and inappetence. Physical examination revealed severe abdominal distension. Radiographs demonstrated pneumoperitoneum, megaoesophagus and generalised gaseous distension of the digestive tract. Exploratory coeliotomy was performed, revealing markedly distended and thickened small and large intestines with no observable peristalsis. No intestinal perforation was present. Bacteriological and cytological analysis of abdominal fluid revealed a septic peritonitis involving Pasteurella multocida . Full-thickness intestinal biopsies demonstrated lymphocytic ganglioneuritis localised to the enteric nervous system, in association with glandular atrophy and muscular layer hypertrophy. Amoxicillin-clavulanate and analgesics were given. The cat's general condition gradually improved after the addition of pyridostigmine bromide (0.5 mg/kg q12h PO), initiated 3 days postsurgery. Vomiting resolved and did not recur. Follow-up radiographs at 15 days, and 1 and 6 months showed persistent intestinal ileus, milder than on the pretreatment radiographs. Thirty months after presentation the cat is still alive, without clinical signs, and receives 1 mg/kg q12h pyridostigmine. Relevance and novel information To our knowledge, this is the first case of ganglioneuritis of the myenteric plexus described in cats, as well as the first one successfully treated with pyridostigmine. Chronic intestinal pseudo-obstruction is a very rare condition in cats but should be included in the differential diagnosis of generalised gastrointestinal ileus.

  4. Aerobic bacteria occurring in the vagina of bitches with reproductive disorders.

    Science.gov (United States)

    Bjurström, L

    1993-01-01

    A retrospective survey was performed of aerobic bacterial species found in the vagina of 203 bitches with genital disorders, e.g. infertility, vaginitis, pyometra and puppy death. Escherichia coli, beta-hemolytic streptococci, Staphylococcus intermedius and Pasteurella multocida were the species most often isolated. From bitches with pyometra E. coli in pure culture was the most frequent isolate. In contrast, the majority of infertile bitches gave rise to mixed cultures, and no specific bacterial species was consistently associated with infertility. Thus, bacterial sampling from infertile bitches was concluded to be of low diagnostic value. Bacterial species isolated from the bitches having vaginitis were present in pure culture in 26.9% of the samples while nonspecific mixed cultures were obtained from 34.6% of the samples from these bitches. E. coli was the most frequently isolated bacterial species from bitches with dead puppies. However, in such cases it is important to relate the vaginal bacterial findings to autopsy findings and the results of bacteriological cultures of the pups.

  5. A bibliography of references to avian cholera

    Science.gov (United States)

    Wilson, Sonoma S.

    1979-01-01

    Mrs. Wilson has made a genuine effort to include in this bibliography every significant reference to avian cholera since Louis Pasteur's articles appeared in 1880, although she recognizes the likelihood that a few have been overlooked. New listings have been added throughout 1978, but comprehensive coverage of the literature cannot be claimed beyond June of that year.Textbook accounts, because they are generally summaries of work published elsewhere, are excluded. Papers dealing primarily with the biology of Pasteurella multocida, as opposed to the disease it induces in birds, are also excluded, unless they report information of diagnostic usefulness. Short abstracts are not included unless the journals in which they are published are more widely available than those in which the complete articles appear or they are English summaries of foreign language articles.In compiling this bibliography, Mrs. Wilson has made extensive use of Biological Abstracts, the Pesticide Documentation Bulletin, and printouts generated by Bibliographic Retrieval Services, Inc. The "Literature Cited" sections of textbooks and journal articles pertinent to the subject were sources of many additional references. Regardless of the origin of the citation, its accuracy was confirmed by comparison with the original publication, except in those few instances (marked with an asterisk) when the journal was not on the shelves of the libraries accessible to us.The author will be grateful to users of the bibliography who point out errors or omissions.Wayne I. JensenMicrobiologist In Charge

  6. Granzyme A Produces Bioactive IL-1β through a Nonapoptotic Inflammasome-Independent Pathway

    Directory of Open Access Journals (Sweden)

    Dagmar Hildebrand

    2014-11-01

    Full Text Available Bacterial components are recognized by the immune system through activation of the inflammasome, eventually causing processing of the proinflammatory cytokine interleukin-1β (IL-1β, a pleiotropic cytokine and one of the most important mediators of inflammation, through the protease caspase-1. Synthesis of the precursor protein and processing into its bioactive form are tightly regulated, given that disturbed control of IL-1β release can cause severe autoinflammatory diseases or contribute to cancer development. We show that the bacterial Pasteurella multocida toxin (PMT triggers Il1b gene transcription in macrophages independently of Toll-like receptor signaling through RhoA/Rho-kinase-mediated NF-κΒ activation. Furthermore, PMT mediates signal transducer and activator of transcription (STAT protein-controlled granzyme A (a serine protease expression in macrophages. The exocytosed granzyme A enters target cells and mediates IL-1β maturation independently of caspase-1 and without inducing cytotoxicity. These findings show that macrophages can induce an IL-1β-initiated immune response independently of inflammasome activity.

  7. Whole Genome Sequence Analysis of Pig Respiratory Bacterial Pathogens with Elevated Minimum Inhibitory Concentrations for Macrolides.

    Science.gov (United States)

    Dayao, Denise Ann Estarez; Seddon, Jennifer M; Gibson, Justine S; Blackall, Patrick J; Turni, Conny

    2016-10-01

    Macrolides are often used to treat and control bacterial pathogens causing respiratory disease in pigs. This study analyzed the whole genome sequences of one clinical isolate of Actinobacillus pleuropneumoniae, Haemophilus parasuis, Pasteurella multocida, and Bordetella bronchiseptica, all isolated from Australian pigs to identify the mechanism underlying the elevated minimum inhibitory concentrations (MICs) for erythromycin, tilmicosin, or tulathromycin. The H. parasuis assembled genome had a nucleotide transition at position 2059 (A to G) in the six copies of the 23S rRNA gene. This mutation has previously been associated with macrolide resistance but this is the first reported mechanism associated with elevated macrolide MICs in H. parasuis. There was no known macrolide resistance mechanism identified in the other three bacterial genomes. However, strA and sul2, aminoglycoside and sulfonamide resistance genes, respectively, were detected in one contiguous sequence (contig 1) of A. pleuropneumoniae assembled genome. This contig was identical to plasmids previously identified in Pasteurellaceae. This study has provided one possible explanation of elevated MICs to macrolides in H. parasuis. Further studies are necessary to clarify the mechanism causing the unexplained macrolide resistance in other Australian pig respiratory pathogens including the role of efflux systems, which were detected in all analyzed genomes.

  8. Occurrence and severity of lung lesions in slaughter pigs vaccinated against Mycoplasma hyopneumoniae with different strategies.

    Science.gov (United States)

    Hillen, Sonja; von Berg, Stephan; Köhler, Kernt; Reinacher, Manfred; Willems, Hermann; Reiner, Gerald

    2014-03-01

    Different vaccination strategies against Mycoplasma hyopneumoniae have been adopted worldwide. Reports from the field indicate varying levels of protection among currently available vaccines. The goal of the present study was to compare the efficacies of three widespread commercial vaccination strategies against M. hyopneumoniae under field conditions. 20 farms were included. 14 farms used different single dose vaccines (vaccine 1 [V1], 8 herds; vaccine 2 [V2], 6 herds); another 6 farms (V3) used a two dose vaccination strategy. Gross lesions of 854 lungs and histopathology from 140 lungs were quantified, and a quantitative PCR was applied to detect M. hyopneumoniae and porcine circovirus 2 (PCV2) DNA in lung tissue (n=140). In addition, porcine reproductive and respiratory disease virus (PRRSV), swine influenza virus (SIV), Actinobacillus pleuropneumoniae, Haemophilus parasuis and Pasteurella multocida were tested by qualitative PCR. 53% of lungs were positive for M. hyopneumoniae. 55.9% of lungs showed macroscopic enzootic pneumonia (EP)-like lesions. Lung lesion scores (Phyopneumoniae-loads (Phyopneumoniae indicating that the applied diagnostic tools are valuable in confirming the prevalence and severity of M. hyopneumoniae infections. Comparing different vaccination strategies against M. hyopneumoniae indicates varying levels of protection. M. hyopneumoniae is still a major problem despite the widely applied vaccination. Copyright © 2014 Elsevier B.V. All rights reserved.

  9. Comparative investigation on the efficacy of tulathromycin and florfenicol in the treatment of bronchopneumonia in feedlot calves

    Directory of Open Access Journals (Sweden)

    Jezdimirović Milanka

    2011-01-01

    Full Text Available The clinical efficacy of tulathromycin (TU and florfenicol (FL in the treatment of bronchopneumonia (BP caused by Pasteurella multocida which was isolated from nose swabs of diseased calves has been examined. The symptoms of bronchopneumonia (BP were quantified by means of the clinical score (CS with a maximum of 47 points. In the current investigation the average CS in diseased calves was 23.5± 0.15. The clinical efficacy of TU and FL was assessed every day in the first week after the administration of the drugs and was based on the decrease in CS and on microbiological findings on days 7, 28 and 35 after the completion of therapy. Tulathromycin was administered s.c., in the prescribed therapeutic dose (2.5 mg/kg BW, and florfenicol s.c., twice at a 48 h interval, in its respective therapeutic dose (40 mg/kg BW. In spite of the repeated administration of FL, TU was significantly more rapid to decrease the major clinical symptoms in the first four days following the application, in comparison with FL (P<0.05. On the fourth day after the administration, the clinical efficacy of TU in the therapy of BP in calves was 43.4±1.5 %, and of florfenicol 27.2±1.6 %. However, five days after the application of TU and two days after the repeated application of FL the assessed clinical efficacy of the two antibiotics was roughly the same. The average efficacy of TU was 57.1±0.0%, and of florfenicol 58.5±0.0%, both the individual and mean CS in the treated calves was 10 points, due to hyperthermia, which remained the only symptom. Six days after the administration of TU and three days after the repeated application of FL both antibiotics had equal maximum efficacy (100% in the treatment of BP. The clinical efficacy remained unchanged on day seven. The recovery was confirmed by the absence of P. multocida in nose swabs sampled on the seventh day after the initial treatment. However, in 4 calves (21.05 % of the 19 treated Streptococcus alpha haemolyticus

  10. Modelado y análisis de datos procedentes de sistemas de imagen para diagnóstico médico mediante Mathematica

    Directory of Open Access Journals (Sweden)

    Nuria Ortigosa

    2017-01-01

    Full Text Available Los sistemas de imagen para diagnóstico médico son una de las tecnologías que han despertado gran interés en los últimos años. Precisamente por presentar un marcado carácter multidisciplinar, aunando matemáticas, física e ingeniería biomédica y electrónica, este área suscita un gran interés en el alumnado de secundaria y bachillerato. En este trabajo se presenta el contenido de una de las sesiones desarrolladas en la Universitat Politècnica de València, enmarcada dentro de los Campus Científicos de Verano CAMPUS-VLC, bajo el título "Tecnología y física médicas''. En ella, a partir de la base y el conocimiento previo del funcionamiento del Tomógrafo por Emisión de Positrones, los alumnos aprenden a procesar la información registrada por estos equipos utilizando el popular software Wolfram Mathematica. Gracias a él, por ejemplo, serán capaces de ubicar el punto de emisión de radioactividad mediante la utilización de histogramas. Además, también se les presentan los algoritmos para la manipulación y procesado de este tipo de imágenes, como la detección de bordes.

  11. Efectos de oferta sobre la economía andaluza de las ayudas procedentes de los fondos estructurales destinadas a infraestructuras

    Directory of Open Access Journals (Sweden)

    Simón Sosvilla Rivero

    2005-06-01

    Full Text Available El objetivo principal de este trabajo es analizar los efectos de oferta de las ayudas comunitarias recibidas por Andalucía, concretamente del Marco de Apoyo Comunitario 1994-1999 (MAC 94-99. En particular, se examinan los efectos derivados de una mayor y mejor dotación de recursos productivos e infraestructuras sobre la producción y el empleo de la región, mediante la estimación, mediante técnicas de cointegración con series temporales, de una función de producción agregada para el sector privado de la economía en la que el stock de capital público aparece como un factor productivo separado y diferente, así como de una demanda de trabajo derivada de dicha función. Las simulaciones realizadas sugieren que las inversiones en infraestructuras financiadas con cargo al MAC 94-99 habrían hecho posible que la economía andaluza creciera en términos reales durante el período 1994-2001 a una tasa acumulativa del 3,42%, frente al crecimiento del 3,15% que hubiese experimentado de no recibir dichas inversiones. En cuanto al mercado de trabajo, los resultados obtenidos indican que el MAC 94-99 habría generado o mantenido una media de 79.034 empleos durante el período 1994-2001, lo que habría contribuido a reducir la tasa de paro en unos 2,87 puntos porcentuales.

  12. Aprovechamiento de las oleinas residuales procedentes del proceso de refinado de los aceites vegetales comestibles, para la fabricación de biodiesel

    OpenAIRE

    Álvarez Mateos, P.; Barriga Mateos, F.; Pereda Marín, J.

    2003-01-01

    A procedure to obtain Biodiesel from “Oleinas” is studied. Biodiesel is a suitable product to replace diesel oil currently used to power the Diesel engines. It consists of a mixture of methyl esters of the fatty acids presents as triglycerides in vegetables oils (olive, sunflower, soya, rape oils). As a result of the refining of these oils for their use as food, a waste product is formed, the “oleinas” (acidulated soapstock)....

  13. Aprovechamiento de las oleinas residuales procedentes del proceso de refinado de los aceites vegetales comestibles, para la fabricación de biodiesel

    OpenAIRE

    Pereda Marín, Juan; Barriga Mateos, F.; Álvarez-Mateos, María Paloma

    2003-01-01

    Se estudia un procedimiento para la obtención de Biodiesel a partir de las “Oleínas”. Biodiesel es un producto capaz de sustituir al combustible Diesel ordinario que se obtiene del petróleo y que consiste en una mezcla de ésteres metílicos de ácidos grasos. Las oleínas son unos residuos que resultan del proceso de refina- do de aceites vegetales para su uso alimentario y se componen de una mezcla de triglicéridos y ácidos grasos libres, con un con- tenido de estos últimos...

  14. Estudio in-situ de la transformación térmica de limonita utilizada como pigmento procedente de Perú

    Directory of Open Access Journals (Sweden)

    Romero-Gómez, P.

    2013-06-01

    Full Text Available It has been performed a kinetic study of the thermal transformation of Limonite [FeO(OH.nH2O] by thermal gravimetric analysis (TGA, thermal X-ray Diffraction (XRD and μ-Raman spectroscopy. The mineral was extracted from the Taraco District, Huancané Province, Puno region (Peru. Powdered XRD identify goethite phase as the main mineralogical component besides quartz. It was subjected to in-situ thermal treatment in the range of temperatures 100 to 500 ºC in air and an inert atmosphere (nitrogen. The goethite phase remains stable from room temperature until 200 ºC. From 250ºC there is a phase transformation α-FeO(OH → α-Fe2O3 with 8 wt % weight loss and a chromatic change, i.e., the change of the hydroxylated goethite phase (yellow to oxided hematite phase (red, as evidenced by the TGA and evolution of the XRD profiles. Moreover, the μ-Raman spectra of the in-situ thermal treatment corroborate that there is a transition at 290 ºC by the transformation of the characteristic Raman bands of the goethite to hematite phase, in the frequency range from 200 to 1800cm-1.Se ha realizado un estudio cinético de la transformación térmica de limonita [FeO(OH.nH2O] mediante análisis térmico gravimétrico (TGA, termodifracción de rayos X (DRX y espectroscopía μ-Raman. La muestra estudiada fue extraída de un yacimiento en el distrito de Taraco, provincia de Huancané, Región de Puno (Perú. La técnica DRX en polvo identificó la fase goetita como el principal componente mineralógico, además de cuarzo. La muestra se sometió a un tratamiento térmico in-situ en un intervalo de temperaturas de 100 a 500 °C en atmósfera de aire e inerte (nitrógeno y se estudió por DRX. Los resultados han mostrado que la fase goetita permanece estable desde la temperatura ambiente hasta 200 °C. A partir de los 250 °C se produce una transformación de fase α-FeO(OH → α-Fe2O3 con un cambio cromático, es decir, el paso de la fase hidroxilada goetita (amarillo a la fase oxidada hematites (rojo con una pérdida de peso de un 8 %, teniendo como evidencia la evolución de los perfiles de difracción y los resultados de ATG. Los espectros μ-Raman del tratamiento térmico in-situ corroboran que se produce también una transición de fase a la temperatura de 290 °C a través de la transformación de las bandas Raman características de la fase goetita hacia la fase hematites en el rango de frecuencias de 200 a 1800cm-1.

  15. Estudios sobre leishmaniasis tegumentaria en el Perú: V. Leishmaniasis natural en perros procedentes de localidades utógenas

    Directory of Open Access Journals (Sweden)

    Arístides Herrer

    1951-01-01

    Full Text Available Por espacio de algo más de tres años se han llevado a cabo observaciones en diversos animales domésticos en, la zona utógena de la provincia de Huarochirí, llegando a verificar infecciones naturales a leishmanias en 46 perros. Entre los animales de otras especies que fueran objeto de estudio figuran principalmente: gatos, burros, caballos y chanchos, en ninguno de los cuales se consiguió observar leishmanias. Durante el primer año de observaciones fueron revisados 469 animales en las respectivas zonas leishmaníasicas de los valles del Rímac, Canchacalla y Lurín. Por entonces se creía que la infección natural en los animales sería semejante a la humana en cuanto al aspecto macroscópico de las lesiones, esto es, con ulceraciones de la piel fácilmente reconocibles, cosa que en ninguna ocasión fuera posible observar. Pero como simultáneamente se efectuaran en el laboratorio (en Lima ciertos estudios experimentales sobre la uta, principalmente tratando de determinar la susceptibilidad de los animales domésticos más frecuentes en las localidades utógenas, al germen etiológico de esta forma clínica de la Leishmaniasis tegumentaria, se llegó a conocer el aspecto que ofrecían algunas de las lesiones leishmaníasicas en el perro. En una nueva serie de observaciones, llevadas a cabo con el detenimiento que aconsejaban los citados estudios experimentales, fueron revisados un total de 621 animales, esta vez a lo largo de toda la zona utógena de la provincia de Huarochirí. Esta serie incluye 513 perros, en 46 de los cuales se logró verificar la infección, mientras que los restantes animales resultaron todos negativos. Aunque rutinariamente merecieran igual atención, cuando menos en lo que respecta al hocico y las orejas de los animales revisados, en los 46 casos el parásito fué hallado tan sólo en el hocico. Durante estos estudios se han llegado a conocer ciertos aspectos de la leishmaniasis natural en el perro, algunos de los cuales se mencionan a continuación: 1. De manera general las lesiones son benignas, llegando en algunos casos a no observarse alteración macroscópica alguna de la piel parasitada. Las raras lesiones ulceradas son bastantes superficiales, curan espontáneamente y con frecuencia no dejan cicatrices. 2. La leishmania que en forma natural parasita al perro, morfológicamente, ya sea en los cultivos o en los frotis de las lesiones, es idéntica a la que produce la uta en el, hombre (L. brasiliensis. 3. Parece que el parásito se localizara solamente en la piel de los animales infectados, desde que se han obtenido resultados negativos en una serie de cultivos hechos con la sangre de la vena yugular y con la de ciertos órganos internos. 4. En algunos casos se ha podido verificar la infección después de unos pocos meses de permanencia de los perros en las localidades utógenas. 5. La incidencia de la infección canina guarda un marcado paralelismo con el de la uta en el hombre, pero siendo por lo regular menor aquélla. No se ha encontrado perros infectados en lugares cuya incidencia leishmaníasica escolar fuera inferior al 20 por ciento. 6. Hay una notable semejanza entre la leishmaniasis natural del perro y la que se obtiene en forma experimental al inoculársele a este animal con cepas de leishmanias que proceden de casos de uta. 7. Con mayor o menor frecuencia de acuerdo con la endemicidad de las localidades, se observan coexistencia de casos de uta y perros infectados, especialmente en familias de pastores u otras personas que viven en el campo. 8. De idéntica manera a lo que sucede con perros infectados experimentalmente, los con infección natural no reaccionan cuando son inoculados intradérmicamente con el antígeno "leishmanina".

  16. Aprovechamiento de las oleinas residuales procedentes del proceso de refinado de los aceites vegetales comestibles, para la fabricación de biodiesel

    Directory of Open Access Journals (Sweden)

    Álvarez Mateos, P.

    2003-06-01

    Full Text Available A procedure to obtain Biodiesel from “Oleinas” is studied. Biodiesel is a suitable product to replace diesel oil currently used to power the Diesel engines. It consists of a mixture of methyl esters of the fatty acids presents as triglycerides in vegetables oils (olive, sunflower, soya, rape oils. As a result of the refining of these oils for their use as food, a waste product is formed, the “oleinas” (acidulated soapstock. The oleinas consist of a mixture of triglycerides and free fatty acids, the latter amounting to 50% or more of the mixture and are subject to a fluctuating market, therefore it exist at times a problem for their disposal. In our research work we have tried to obtain biodiesel from oleinas. The process resulting from our experimental work is as follows: 1. Sterification of the free fatty acids with methanol, by acid catalysis, centrifuging the reaction product and removal of the acid-methanol phase. Drying of the latter. At this stage we have a product containing about 70% of methyl esters. 2. Transesterification of the triglycerides present in the sterified product with methanol by alkaline catalysis, washing the reaction product with a water methanol solution. Centrifuging and removal of the water-methanol phase. At this stage a biodiesel product is obtained containing about 90% of methyl esters. 3. Fractional vacuum distillation of the 90% biodiesel gives a final product with a methyl esters content higher than 98%.Se estudia un procedimiento para la obtención de Biodiesel a partir de las “Oleínas”. Biodiesel es un producto capaz de sustituir al combustible Diesel ordinario que se obtiene del petróleo y que consiste en una mezcla de ésteres metílicos de ácidos grasos. Las oleínas son unos residuos que resultan del proceso de refinado de aceites vegetales para su uso alimentario y se componen de una mezcla de triglicéridos y ácidos grasos libres, con un contenido de estos últimos componentes superior al 50% . El mercado de oleinas es fluctuante, con lo que en ocasiones surge el problema de su eliminación. Como resultado del trabajo efectuado se define un proceso de obtención que consta de las siguientes etapas: 1. Esterificación de los ácidos libres de la Oleína con metanol, aplicando catálisis ácida, centrifugando el producto obtenido y separándolo de la fase metanol-ácido. En ésta etapa se obtiene un producto que contiene alrededor de un 70% de metil- esteres. 2. Transesterificación de los triglicéridos presentes en el producto esterificado con metanol, aplicando catálisis alcalina. El producto obtenido, previamente separado de la fase metanolagua, contiene alrededor de un 90% de metil-esteres. 3. Purificación del producto resultante de las etapas 1 y 2 , por rectificación a vacío. El producto destilado tiene un contenido en metil-esteres superior al 98%.

  17. Captura de amonio procedente de estiercol mediante membranas permeables de gases (capture of ammonnia from turkey manure using gas-permeable membranes)

    Science.gov (United States)

    This paper, written in Spanish, describes the capture and recovery of gaseous ammonia from turkey manure using gas-permeable membranes technology with formation of stabilized ammonium salts. Bench experiments were carried out in Maryland using a pilot prototype system with turkey litter inside contr...

  18. Aromatic hydrocarbons from service stations in the sewer system in Cartagena, Columbia; Hidrocarburos aromaticos en la red de alcantarillado procedentes de estaciones de servicio en Cartagena (Colombia)

    Energy Technology Data Exchange (ETDEWEB)

    Cachorro Sanchez, P.; Gonzalez Garcia, H.; Luna Jara, J.

    2000-07-01

    The results of this study are part of a project for characterising domestic and industrial waste flowing through the sewer system of Cartagena de Indias (Columbia). Characterisation was carried out in order to establish the contaminating load in the drinking water supply with a view to establishing a framework for compensatory taxes levied by the corresponding environmental agency. (Author)

  19. Estructura poblacional y variabilidad genética de Rhodnius prolixus (Hemiptera: Reduviidae procedente de diferentes áreas geográficas de Colombia

    Directory of Open Access Journals (Sweden)

    Diana Carolina López

    2007-01-01

    Resultados. R. prolixus presenta variabilidad genética moderada (Fst 0,057-0,15, entre las poblaciones domiciliadas se encontraron tasas de migración (Nm>1 que revelan flujo genético. Se encontró diferenciación genética de moderada-alta entre la población silvestre de Casanare y las poblaciones domésticas del centro del país (Tolima y Cundinamarca. Conclusión. Las poblaciones domiciliadas de R. prolixus son homogéneas debido a que existe flujo genético entre éstas; lo cual es favorable para el control químico, mientras que la población silvestre agrupa aparte de las domiciliadas. Se evidencia la necesidad de estudiar la estructura genética de los focos silvestres, sus posibles rutas de dispersión y el riesgo epidemiológico que representan.

  20. Procedimiento de obtención de materiales multifuncionales y renovables a partir del rechazo de pipa procedente de la producción de aceite de girasol

    OpenAIRE

    Martín-Luengo, María Ángeles; Yates Buxcey, Malcolm; Ramos Gómez, Milagros; Sáez Rojo, Eduardo; González Gil, Lorena; Martínez Serrano, Ana María; Martín-Aranda, Rosa María; López Sanz, Jesús

    2011-01-01

    La presente invención se refiere al procedimiento de 5 obtención de materiales renovables, a partir de residuos precedentes de la fabricación de aceite de girasol, para su uso como matrices biocompatibles en ingeniería de tejidos, administración controlada de sustancias de interés biológico (drogas, proteínas, genes, etc.) y como catalizadores en 10 procesos activados por centros básicos, utilizando tanto calentamiento dieléctrico, como activación solar, para aumentar la sostenibilidad ...

  1. Presence of helminth eggs in sewage sludge from waste water plants; Presencia de huevos de helmintos en lodos procedentes de la depuracion de aguas

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Muro, J. L.; Garcia Orenes, F.; Nieto Asensio, N.; Bonora, I. B.; Morenilla Martinez, J. J.

    2003-07-01

    Land application of sewage sludge is a usual practice in wide areas of the Comunidad Valencia, due the low organic contents and nutrients of the soils, and the sewage sludge is a suitable material to use os organic amendment of soils. However the use of sewage sludge involves a very detailed characterization of sewage, to avoid sanitary hazards as the presence of helminth eggs and its high resistant to most of the treatment used to stabilize sewage sludge. The aim of this work was determine the parasitic contamination of helminths found in sewage sludge, stabilized by anaerobic digestion, from two waste water plants of Alicante (Alcoy y Benidorm) destined to agricultural land. Also it was studies the evolution of helminth eggs content of a sewage sludge subjected to composting process. (Author) 12 refs.

  2. Bioensayo con macrófitas acuáticas para el tratamiento de lixiviados procedentes del relleno sanitario de Pichacay

    OpenAIRE

    Cuenca L., Numan; Carrión C., Ligia

    2009-01-01

    Los procesos de biodepuración son una alternativa que cada vez adquiere mayor importancia para el tratamiento de efluentes y lixiviados a nivel mundial. Por tal motivo se han estudiado tres especies de macrofitas acuáticas presentes en lugares próximos al Relleno Sanitario de Pichacay, con la finalidad de probar la capacidad de depuración de las plantas. Aunque las especies estudiadas no son nativas su potencial es promisorio. El trabajo se realizó con las siguientes especies: Jacinto de agua...

  3. CUANTIFICACIÓN, CARACTERIZACIÓN Y COMPOSICIÓN DEL MATERIAL PARTICULADO 2,5, PROCEDENTE DEL USO DE LA COMBARBALITA

    Directory of Open Access Journals (Sweden)

    Ricardo Zamarreño

    2015-01-01

    Full Text Available En este trabajo, se muestran los resultados del material particulado P.M. 2,5 en la ciudad de Combarbalá, por la explotación y tallado de la “Combarbalita”. Los monitoreos se realizaron entre los meses de septiembre del 2010 y mayo del 2011. Determinando P.M. 2,5 con una bomba succionadora, cuantificando la concentración de algunos metales, utilizando espectroscopia de absorción atómica. Comprobando las características morfológicas de los componentes, usando la técnica de microscopia de inmersión. El promedio del PM 2,5 es de 22,50 μg/m3, estando bajo los valores recomendados por la EPA. Los elementos con mayores concentraciones son el Hierro, el Cobre, el plomo y el Zinc, el Cadmio posee la menor concentración. Las partículas de 2.5 μm y menores bordean el 36.11% del total analizado, las que tienen dimensiones de 4 a 10 μm suman el 50%. Concluyendo que Combarbalá posee bajos niveles de contaminación de material particulado P.M. 2,5.

  4. La construcción naval del pecio de la Albufereta (Alicante. Un velero de comercio del S. I, procedente de la Bética

    Directory of Open Access Journals (Sweden)

    Carles de Juan Fuertes

    2008-01-01

    Full Text Available El presente artículo, profundiza en los aspectos técnicos de la arquitectura naval del pecio de la Albufereta de Alicante. Hemos realizado una serie de análisis estadísticos sobre su carpintería que consideramos pueden servir para crear valores de referencia en el estudio de la construcción naval de las embarcaciones relacionadas con el comercio Bético. Hacemos un breve repaso del comercio a cuenta del Imperio y lo interrelacionamos con la nave estudiada.

  5. Estudio de la mineralización en el suelo del nitrógeno de lodos procedentes de plantas depuradoras de aguas residuales

    OpenAIRE

    Garau, Ma. Antònia

    1983-01-01

    [spa] El incremento constante del consumo de agua potable hace necesaria la construcción de nuevas plantas depuradoras de aguas residuales; éstas, además de devolver a la naturaleza un producto más fácilmente reciclable, contribuyen a disminuir la contaminación del medio ambiente resultante de las actividades humanas. Como consecuencia se presenta el problema de eliminar el subproducto del proceso depurador, es decir, el lodo residual. El término “lodo residual” incluye una gran variedad ...

  6. Impacto ambiental por metales pesados en suelos y plantas del entorno de un depósito de chatarra procedente de automóviles de desguace

    Directory of Open Access Journals (Sweden)

    Chicharro, A.

    1998-05-01

    Full Text Available The contaminant impact of cadmium, chromium, copper, nickel, lead and zinc on soils and vegetation in the surroundings of a scrapyard of discarded vehicles, taken at several distances of the contaminant source, is evaluated and compared with control samples free of contamination. The total metal contents of these elements in the soils and vegetation samples are determined by ICP-AES and their presence in soils is detected by particles analysis with SEM-EDXRA. The contents of the affected soils are remarkably higher than the ones of a control sample for the all elements and gradually decrease from the contaminant source. These contents in plants are also relevantly higher than the values of the control sample, and are especially high for the aereal parts. This remarkable contamination, moreover the great retention capacity of these soils, due to their edaphical characteristics, and the presence of a great quantity of not-mineral particles, may indicate that the probable access path of the metal contaminants to the plants could be the atmospherical dispersion of the particles generated by the scrapyard activities (burning and transformation of the vehicles scrap.

    Se evalúa el impacto contaminante de cadmio, cromo, cobre, níquel, plomo y cinc en suelos y vegetación del entorno de un depósito de chatarra de automóviles, a diferentes distancias del mismo, tomando como referencia muestras control no contaminadas. Los contenidos totales de dichos elementos en muestras de suelos y plantas se determinan mediante ICP-AES, y su presencia en suelos mediante análisis de partículas por SEM-EDXRA. En los suelos, se detectan contenidos muy superiores a los de una muestra control para todos los elementos, que decrecen de forma gradual desde el foco contaminante. Estos contenidos en las plantas también son muy superiores a los valores de la muestra control, siendo especialmente elevados en las partes aéreas. Esta alta contaminación de las partes aéreas, junto con la gran capacidad de retención en estos suelos debido a sus características edáficas y la presencia de gran cantidad de partículas no minerales, puede ser un indicativo de que la vía de acceso más probable de estos contaminantes metálicos a las plantas sea la dispersión atmosférica de partículas generadas por las actividades de combustión y transformación de la chatarra en el depósito.

  7. Cerámica de tipo Kuass procedente de Caura. ¿Testimonios de un nuevo centro de producción?

    Directory of Open Access Journals (Sweden)

    Escacena Carrasco, José Luis

    2014-12-01

    Full Text Available An important set of Kuass pottery has been found during archeological excavations in Cerro de San Juan (Coria del Río, Seville –the small hill where ancient Caura was located. Its stratigraphic position is problematic in relation to known chronological contexts in Cádiz. However, the typological features of these pieces, their wide-spread local use and the composition of the pottery clay used in its production allow us to suggest the possible existence of a workshop in the settlement or in the surroundings. In any case, the amount and variety of registered shapes in this city are the highest ones in the Lower Guadalquivir Valley. Its consumption pattern, at the same time, is the closest one to Punic communities.Las excavaciones en el Cerro de San Juan de Coria del Río (Sevilla, cabezo donde nació la ciudad antigua de Caura, han proporcionado un buen lote de cerámica de tipo Kuass. Su posición estratigráfica es problemática si se compara con los contextos cronológicos conocidos en Cádiz. Sin embargo, sus rasgos tipológicos, su amplio uso local y la composición de las arcillas permiten proponer la posible ubicación en este asentamiento o en sus cercanías de un taller. En cualquier caso, la cantidad y variedad de formas registradas hacen de esta ciudad el enclave del Bajo Guadalquivir con mayor presencia de esta cerámica y el más cercano a los patrones de consumo del mundo púnico.

  8. Caracterización metalúrgica de tres piezas arqueológicas de materiales base cobre procedentes del Bajo Aragón

    Directory of Open Access Journals (Sweden)

    Gabaldón, A.

    2006-08-01

    Full Text Available Three archaeological metallic objects corresponding to three different cultural times are studied. The objects are: a point of arrow Palmela type, a fragment of adze (possibly of the First Iron Age and a ring or small ring of the Roman Period. The analysis show concordant results whit similar finds of the same cronology and contribute new data about the metallurgical technology of the copper base material for each of the cultural times of origen. At the same time how has affected the environment in which the objects have been found has been determinate.

    Se estudian tres piezas metálicas arqueológicas correspondientes a tres momentos culturales diversos. Se trata de una punta de flecha tipo Palmela, de un fragmento de azuela (posiblemente de la Primera Edad del Hierro y de un anillo o anilla del período romano. Los análisis ofrecen resultados concordantes con los de objetos similares de la misma cronología y aportan datos nuevos sobre la tecnología metalúrgica de los materiales de base cobre para cada uno de los momentos culturales de procedencia. Al mismo tiempo, se ha determinado cómo ha afectado el medio en el que se hallaron a su estado de conservación.

  9. SANIDADE, TRANSMISSÃO VIA SEMENTE E PATOGENICIDADE DE FUNGOS EM SEMENTES DE Cedrela fissilis PROCEDENTES DA REGIÃO SUL DO BRASIL

    Directory of Open Access Journals (Sweden)

    Marília Lazarotto

    2012-01-01

    Full Text Available Researches about seed pathology of native forest species, especially, those more extensive, are rare. This research aims to evaluate the health of Spanish-cedar seeds through two detection methods, to evaluate the possible transmission of fungi associated to Cedrela fissilis seeds to seedlings and to evaluate the pathogenicity of the fungus transmitted by Cedrela fissilis seeds. For this, seeds from six different locations from Rio Grande do Sul, Santa Catarina and Paraná states were used. The seeds were submitted to sanity tests, by blotter-test and potato-dextrose-agar (PDA methods, transmission by seeds to the seedlings and to the pathogenicity test of Rhizoctonia sp., chosen because it was commonin sanity testing and transmitted by seed. The fungi found in both of the methods were: Pestalotia sp., Rhizoctonia sp., Penicillium sp., Phomopsis sp., Rhizopus sp., Aspergillus sp. and Fusarium sp. Both tests can be used for thesanity test in Cedrela fissilis seeds. The fungi transmitted by seeds to the seedlings were Fusarium sp. and Rhizoctoniasp., both causing problems in roots and subsequent damping-off. One of the isolates of Rhizoctonia sp. was identified as pathogenic to seedlings, causing the same symptoms observed on transmission test.

  10. Análisis de datos cualitativos aplicación al caso de los datos procedentes de grupos de discusión

    OpenAIRE

    Gil Flores, Javier

    1992-01-01

    En el presente trabajo se ponen en práctica y se valoran distintas estrategias de análisis que permitan construir significados o llegar a conclusiones a partir de datos educativos que poseen una naturaleza cualitativa. Concretamente, los datos cualitativo

  11. Bioadsorción de iones de plomo y cromo procedentes de aguas residuales utilizando la cáscara de la mandarina (Citrus Reticuata Var. Clementina)

    OpenAIRE

    Verdugo Vergara, José Francisco

    2017-01-01

    El presente trabajo tiene el objetivo de evaluar la capacidad de bioadsorción de plomo y cromo mediante la cáscara de la mandarina, la cual es considerada un residuo, con esta investigación lo que se desea es aprovechar este residuo, empleándolo como bioadsorbente en el tratamiento de las aguas residuales contaminadas con metales pesados. En los procesos de bioadsorción se variaron algunos parámetros. The objective of this work assignment is to evaluate the bioadsorption capacity of lead a...

  12. The problem of slurries of industrial wastes water treatments; Problematica de los lodos procedentes del tratamiento de las aguas residuales de la actividad industrial

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Frutos, J.L. [Tecnologias del Medio Ambiente, Universidad del Pais Vasco (Spain)

    1995-07-01

    The water treatment is not a problem today. The major problem are the slurries and fungi produced by the industrial waste water treatment. This article explains the different utilizations and the main applications of the water in the industrial process. The different treatments (thermal inertization sanitary landfills, etc) are presented.

  13. Caracterización de residuos sólidos procedentes de dos procesos distintos de galvanizado en caliente por inmersión

    Directory of Open Access Journals (Sweden)

    Delvasto, P.

    2012-02-01

    Full Text Available Zinc dust and zinc ash from hot-dip galvanizing industries located in Venezuela were characterized using atomic spectroscopy, scanning electron microscopy, X-Ray diffraction and infrared spectroscopy. Dust was formed during the high-pressure drying process of the galvanized pieces, in a plant that uses a steel kettle to hold the molten zinc. Ash identified as “A” came from the same plant as the dust, while ash identified as “B” came from a hot-dip galvanizing plant which use a ceramic lined galvanizing furnace. Dust contained 98 wt % Zn, in metallic form. Both ash samples contained: Zn and ZnO, while Zn5(OH8Cl2—H2O and ZnCl2 were only found in ash “B”. Globally, ash “A” and ash “B” contain 71 and 75 wt % Zn, respectively.

    Se caracterizaron polvos y escorias de zinc de industrias venezolanas de galvanizado en caliente por inmersión empleando espectroscopía atómica, microscopía electrónica de barrido, difracción de R-X y espectroscopía infrarroja. Los polvos se obtienen del proceso de secado a alta presión de las piezas en una planta cuyo proceso se basa en una cuba de acero para contener el zinc fundido, planta de la cual procede también la muestra de escoria denominada “A”. Por su parte, la escoria denominada “B” se genera en una industria que utiliza una cuba recubierta con refractario cerámico. Los polvos contienen 98 % en peso de zinc, en forma metálica. Las escorias, por su parte, presentaron las siguientes fases: Zn y ZnO,. Adicionalmente, la escoria “B” mostró la presencia ZnCl2 y Zn5(OH8Cl2—H2O. El contenido total de zinc (% en peso en la escoria “A” es 71 %, mientras que en la escoria “B” es 75 %.

  14. Sewage sludges compost and organic fraction urban solid waste from selective collection; Compostaje de lodos de depuradora y FORSU procedente de recogida selectiva

    Energy Technology Data Exchange (ETDEWEB)

    Chica, A.; Diaz, M. M.; Mohedo, J.

    2001-07-01

    The organic fraction of urban solid waste (FORSU) from selective collection has been analysed to make a good quality compost for soils an agricultural use. Different mixtures of FORSU, sludge from the municipal water treatment plant, and pruning garden has been composted in turned windrow. The composting process and the obtained refined compost were characterised. The results on evolution of pH, conductivity, C/N relation, P, metals,-organic matter and recovery yield were related. (Author) 15 refs.

  15. Quality of compost from composting plant in Puerto Real (Cadiz, Spain); Calidad del compost procedente de la planta de compostaje de Puerto Real (Cadiz)

    Energy Technology Data Exchange (ETDEWEB)

    Godillo Romero, M. D.; Quiroga Alonso, J. M.; Garrido Perez, C.; Rodriguez Barros, R.; Sales Marquez, D. [Universidad de Cadiz (Spain)

    2000-07-01

    The compost taken from the Compost Plant, treating urban solid residues from the Consorcio Bahia de Cadiz in the municipal district of Puerto Real, Cadiz, has been analysed for its particular qualities over the years 1990-1996. With this in mind we have determined the most important of parameters with a view to defining the quality of this organic fertilizer extracted from urban solid residues (USR): pH, conductivity, rejection through net meshing, humidity, organic matter, carbon, nitrogen, C/N relationship, cadmium, copper, nickel, lead, tin, zinc and mercury. The compost gathered complies with the established legal requisites concerning fertilizers and their related substances. The quality in the first years of this study is better due possibly to the construction of the bio-recycling plant leaving the latter as a holding plant. (Author)

  16. Disseminated toxoplasmosis in an immunocompetent patient from Peruvian Amazon Toxoplasmosis diseminada en un paciente inmunocompetente procedente de la Amazonía peruana

    Directory of Open Access Journals (Sweden)

    Juan Nunura

    2010-04-01

    Full Text Available We report a case of severe toxoplasmosis in an immunocompetent patient, characterized by pneumonia, retinochoroiditis, hepatitis and myositis. Diagnosis was confirmed by serology, T. gondii in thick blood smear and presence of bradyzoites in muscle biopsy. Treatment with pyrimethamine plus sulfadoxine was successful but visual acuity and hip extension were partially recovered. This is the first case report of severe toxoplasmosis in an immunocompetent patient from Peru.Reportamos un caso de toxoplasmosis severa en un paciente inmunocompetente caracterizado por neumonía, retinocoroiditis, hepatitis y miositis. El diagnóstico fue confirmado por serología, el hallazgo de T. gondii en gota gruesa y la presencia de bradizoitos en biopsia muscular. El tratamiento con pirimetamina mas sulfadoxina fue exitoso pero solo hubo una parcial recuperación de la agudeza visual y de la capacidad de extensión de la cadera. Este es el primer reporte de un caso de toxoplasmosis severa en el Perú.

  17. Evaluación del efecto de la temperatura en el secado de polen apícola procedente de dos zonas de cundinamarca

    OpenAIRE

    BARAJAS-ORTIZ, JOHANNA PATRICIA; MARTÍNEZ, TELMO; RODRÍGUEZ-SANDOVAL, EDUARDO

    2011-01-01

    En este estudio se evalúa la influencia de la temperatura de secado (35°C y 45°C) y el origen del producto (la Calera y Zipaquirá) sobre las características físicas, químicas, y nutricionales del polen seco. Los métodos utilizados para determinar la influencia de los tratamientos son: Caracterización fisicoquímica, actividad de agua, índice de solubilidad, tamaño de partícula, contenido de vitamina C y carotenos. Los resultados confirman que el secado de polen a una temperatura de 45ºC es el ...

  18. EVALUACIÓN DEL EFECTO DE LA TEMPERATURA EN EL SECADO DE POLEN APÍCOLA PROCEDENTE DE DOS ZONAS DE CUNDINAMARCA

    OpenAIRE

    JOHANNA PATRICIA BARAJAS-ORTIZ; TELMO MARTÍNEZ; EDUARDO RODRÍGUEZ-SANDOVAL

    2011-01-01

    En este estudio se evalúa la influencia de la temperatura de secado (35°C y 45°C) y el origen del producto (la Calera y Zipaquirá) sobre las características físicas, químicas, y nutricionales del polen seco. Los métodos utilizados para determinar la influencia de los tratamientos son: Caracterización fisicoquímica, actividad de agua, índice de solubilidad, tamaño de partícula, contenido de vitamina C y carotenos. Los resultados confirman que el secado de polen a una temperatura de 45ºC es el ...

  19. DETERMINACIÓN DE PRECURSORES DE DIOXINAS Y FURANOS DE LOS GASES PROCEDENTES DE UN INCINERADOR EN UN REACTOR FOTOCATALÍTICO

    Directory of Open Access Journals (Sweden)

    Jorge Mario Giraldo

    Full Text Available Se presenta un método cromatográfico para la determinación de dioxinas y furanos a partir de uno de sus precursores, tanto en estándares de medición como en muestras reales de gases tomadas en una empresa incineradora de Itagüí, Colombia. La técnica empleada permite realizar estudios que pueden dar aproximaciones acertadas de los contenidos de dioxinas y furanos antes de realizar un muestreo certificado en equipos de alta resolución. Además, se emplea la tecnología de fotocatálisis como método para lograr la eliminación de precursores de dioxinas y furanos de los gases emitidos por un incinerador, con lo cual se disminuye la cantidad de reactivos utilizados en el proceso de depuración.

  20. Estudio arqueométrico de cerámicas procedentes de cinco alfares celtibéricos del sistema ibérico central

    Directory of Open Access Journals (Sweden)

    Igea, J.

    2008-02-01

    Full Text Available The aim of this work is the archaeometric characterization of pottery production related with five local Celtiberian production centres from the Central Iberian’s Chain. In these potter’s workshops dated from the third to the second centuries BC, have been made wheel’s pottery grouped in three main types of vessels: storage/transport, service and table. The main goal of this research is to characterize different ceramic pastes from a mineralogical, textural and chemical point of view, with the purpose to form reference groups from each production centre and to establish the technology of manufacture. The samples have been analysed using optical microscopy (OM, X-ray diffraction (XRD, textural analysis by means of an image digitalization system and chemical analyses by inductively coupled plasma-atomic emission spectrometry (ICP-AES. The results derived have allowed the recognition of eight different ceramic fabrics. All production centres used a mud clay raw material of illite-muscovite composition with very fine natural crushed inclusions of variable lithology. With the exception of one centre, the differences showed between pastes from the same atelier may be due to different manipulation of the same raw material. The minerals phases detected and microscopic observations have permitted to estimate fire conditions for the analyzed pastes.

    El objeto de este trabajo es la caracterización arqueométrica de la producción cerámica en un conjunto de 5 alfares celtibéricos ubicados en el Sistema Ibérico Central. En estos talleres, cuya cronología de funcionamiento se centró en los siglos III-II a. C., se fabricaban cerámicas finas a torno que han sido agrupadas en vajilla de almacenaje/transporte, vajilla de servicio y vajilla de mesa. El estudio arqueométrico se ha dirigido a la caracterización de sus diferentes pastas cerámicas desde un punto de vista mineralógico, textural y químico, con el propósito de crear grupos de referencia de cada alfar y establecer los procesos tecnológicos empleados en su manufactura. Las muestras fueron analizadas mediante microscopía óptica convencional (MO, difracción de rayos X (DRX, análisis textural por tratamiento digital de imágenes y análisis químico mediante espectrometría de emisión atómica con plasma de acoplamiento inductivo (ICP-AES. Los resultados obtenidos a partir de las distintas técnicas utilizadas han llevado a la distinción de 8 tipos de pastas. Las arcillas utilizadas como materia prima en todos los centros productores, fueron de composición illítica-moscovítica con inclusiones naturales de litología y tamaño variables, previamente trituradas. Salvo en uno de los yacimientos estudiados, las diferencias reconocidas entre las pastas de un mismo yacimiento parecen obedecer a la distinta manipulación de las arcillas de una misma materia prima. Las fases minerales detectadas y las observaciones microscópicas han servido para estimar las condiciones de cocción de dichas pastas.

  1. The determination of phosphorus in uranium minerals and resulting solutions; Determinacion de fosforo en minerales de uranio y soluciones procedentes de su beneficio

    Energy Technology Data Exchange (ETDEWEB)

    Petrement Eguiluz, J C; Rarellada Bellod, R; Fernandez Cellini, R

    1964-07-01

    Interferences of several elements present in Spanish uranium minerals in the phosphorus determination by the spectrophotometrical method of the molibdovanada te phosphoric acid are studied. A method is described with a previous separation of these element by a cationic resin. This method is successfully applied to the phosphorus determination in acid or alkaline lixiviation solutions of uranium minerals, as well as in the evaluates of ion exchange resins used used technically for the concentration of solutions with a low uranium content. (Author) 11 refs.

  2. Metals mobility in tailings coming from the mining district of Guanajuato, Mexico; Movilidad de metales en jales procedentes del distrito minero de Guanajuato, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ramos G, M.; Avelar, J.; Yamamoto, L.; Ramirez, M. [Universidad Autonoma de Aguascalientes, Departamento de Fisiologia y Farmacologia, Laboratorio de Estudios Ambientales, Av. Universidad No. 904, Ciudad Universitaria, 20131 Aguascalientes (Mexico); Medel R, A.; Godinez, L.; Rodriguez, F. [Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, S. C., Subdireccion de Investigacion, Parque Tecnologico Queretaro Sanfadila, 76703 Pedro Escobedo, Queretaro (Mexico); Guerra, R., E-mail: frodriguez@cideteq.mx [Centro de Innovacion Aplicada en Tecnologias Competitivas, A. C., Direccion de Investigacion, Omega No. 201, Fracc. Industrial Delta, 37545 Leon, Guanajuato (Mexico)

    2012-07-01

    Characterization of different tailings from the mining district of Guanajuato, Mexico were carried out, including a tailing from an abandoned dam 20 years ago, a dam in operation and another coming from the mixture of different companies. The three tailings presented alkaline conditions, normal salinity, aerobic environment with oxidative tendency, low humidity, very low capacity of cationic exchange, and absence of organic matter. These conditions restrict the metal mobility. The mineralogical analysis showed that the tailings contained mainly quartz, calcite and magnetite. Tailings coming from the mixture of different companies had greater total concentrations (mg/kg) of Mn (1042.8), Al (12919.8), Fe (23911.3), Cr (71.3), Pb (24.6) and Cu (19.8). The highest concentration of Zn was observed at the abandoned tailing (53.3 mg/kg). No significant concentrations of Cd and Hg were observed, although Pb (24.6 mg/kg) and Cr (71.4 mg/kg) were detected. Leaching tests indicated that metals cannot be leached in percentages higher than 0.1%, and so these tailings do not represent an environmental risk. The low leaching of metals in the studied tailings was consistent with the mineralogical and physicochemical prevailing conditions, the low acid drainage generation potential and the high degree of stability observed in the tests of metals fractionation. The mineralogical characteristics were determined by X-ray diffraction. (Author)

  3. Mineralogical Study of Workable Material Coming from Mina Fe Ciudad Rodrigo; Estudio mineralogico del material beneficiable procedente de la Mina Fe. Ciudad Rodrigo (Salamanca)

    Energy Technology Data Exchange (ETDEWEB)

    Mingarro Martin, E

    1962-07-01

    A mineralogical analysis is made to ascertain the effects of acid bleaching on normalized conditions. Uranium is mainly found under uranotile, pitchblende and autunite form with an average assay of 0.4 p. ct. The loss of uranium in tailings under current conditions of attach, mainly is due to pitchblende resistance, being practically no leachable, and to uranium absorption by hydrated iron oxides and colloidal ores. This last problem will be discussed in a next paper. (Author) 5 refs.

  4. The grinding of uranium dioxide from fluidized beds; Estudio del m icronizado del UO{sub 2} procedente de lechos Fluidizados

    Energy Technology Data Exchange (ETDEWEB)

    Alonso Folgueras, J A

    1974-07-01

    This work deals with the UO{sub 2} vibratory grinding, the UO{sub 2} obtained from fluidized beds. In this study the grinding time has been correlated with surface area, stoichiometry, granulometry and grinded product contamination. The efficiency losses in the grinding of moisten UO{sub 2} are outlined. Finally it is made a brief study of the granulate obtained from the grinded UO{sub 2} as well as the green pellets resulting from it, taking into consideration the dispersion of its density and height. (Author)

  5. Evaluación de indicadores de estres funcional en una muestra procedente del sitio Chenque I (Parque Nacional Lihue Calel, prov. de La Pampa

    Directory of Open Access Journals (Sweden)

    Baffi, Elvira Inés

    2005-01-01

    Full Text Available La posibilidad de identificar indicadores de actividades cotidianas mediante un análisis bioarqueológico resulta relevante dado que ellas se vinculan con los patrones de subsistencia y uso del cuerpo de los individuos. Uno de esos indicadores involucra una serie de cambios degenerativos en las articulaciones (cartílago y epífisis óseas conocidas bajo el rótulo general de osteoartritis. Se considera que el uso recurrente de una articulación produce una serie de alteraciones que incluyen la formación de labios en las superficies óseas, pitting, osteofitos, porosidad y eburnación. La evaluación comparativa del grado de manifestación de estos indicadores de estrés permite obtener información acerca del nivel de exigencia en el uso de determinadas porciones anatómicas en las actividades cotidianas. En este trabajo se presentan los primeros resultados del análisis de los restos recuperados en el Sitio Chenque I. El mismo es un cementerio utilizado por grupos cazadores-recolectores durante el Holoceno Tardío final, que contiene dos unidades bien delimitadas: la Unidad Superior, en la cual los restos óseos presentan un alto grado de fragmentación y mezcla, y la Unidad Inferior, que contiene numerosas estructuras de inhumación bien delimitadas. Se evaluarán los niveles de prevalencia de las manifestaciones de artritis de los restos de ambas unidades, teniendo en cuenta las características específicas de cada una de ellas.

  6. Microstructural characterization of archaeological samples coming from La Venta park, Tabasco, Mexico; Caracterizacion microestructural de muestras arqueologicas procedentes del parque La Venta Tabasco, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa P, M.F.; Rodriguez L, V.; Martinez, G. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1997-07-01

    The Olmec culture was the first meso american civilization it presents its main establishment at the Veracruz and Tabasco states in Mexico. Owing to in time and to the weathering factors of the region as warmth, acid rain and that great humidity existing in the environment among others that have been provoked great erosion and damage on the pre hispanic monuments. Through Sem technique it was achieved the microstructural characterization of materials which conform the samples that correspond to those monuments where fundamentally feldspars have been found. It was determined the elemental composition of samples through Emission dispersive X-ray diffraction technique, the crystalline phases existing in samples were determined mainly finding feldspars, so of this way it was corroborated those obtained results through Sem. The materials characterization that are part of these pre hispanic monuments of La Ve nta park is essential for its conservation minimizing so the damage to pre hispanic pieces. (Author)

  7. Variedades de batatinha (Solanum tuberosum L.. I - Comportamento de 12 variedades procedentes da Holanda, Alemanha e Suécia Behavior of twelve potato varieties from European sources

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1956-01-01

    Full Text Available No presente trabalho são relatadas experiências com 12 variedades de batatinha (Solanum tuberosum L., recebidas da Holanda (Prinslander, Irene, Froma e Barima, Alemanha (Merkur, Sabina, Linda e Concordia e Suécia Konsuragis, Eigenheimer, Voran e Jätte-Bintje. Essas experiências, em número de seis, das quais três no chamado período "da sêca" (março-julho e três no "das águas" (setembro-janeiro, foram executadas nas localidades de Campinas, Louveira o Capão Bonito, no Estado de São Paulo. Ficou evidenciado o seguinte: a dado o bom estado de brotação dos tubérculos, as porcentagens de falhas no plantio "da sêca" foram baixas; já no plantio "das águas", as variedades de brotação lenta, como "Voran" e "Sabina", falharam muito; b "Prinslander" e "Konsuragis" resistiram bem à sêca prolongada, e "Barima" o "Linda" mostraram ser muito sensíveis; c "Linda", "Voran" e "Merkur", principalmente a primeira destas, apresentaram boa resistência a Phytophthora infestans, e "Jätte-Bintje" foi muito suscetível; "Voran", "Irene", "Prinslander" e "Barima" não ofereceram resistência a Alternaria solani; d "Merkur" e "Konsuragis" foram as mais produtivas para as duas épocas de plantio, sendo que "nas águas", "Eigenheimer", "Barima", "Concordia" e Jätte-Bintje", também produziram bem. Outros aspectos relacionados com variedades foram estudados.Twelve potato varieties imported from Holland (Prinslander, Irene, Froma, and Barima, Germany (Merkur, Sabina, Linda, and Concordia, and Sweden (Konsuragis, Eigenheimer, Voran, and Jätte-Bintje were compared in six experiments carried out at three different localities in the state of São Paulo (Campinas, Louveira, and Capão Bonito. The experiments were planted twice a year, once during the so-called dry season (March lo July, and another time during the rainy season (September to March. The following results were obtained: a plantings made in the dry season had a good stand, whereas this was poor in the rainy season for the late varieties, Voran and Sabina; b Prinslander and Konsuragis showed good drought resistance, but Barima and Linda did not; c Linda, Voran, and Merkur showed resistance to Phytophthora blight, the first-mentioned variety being the most resistant; Bintje was susceptible to the same disease. The varieties Voran, Irene, Prinslander, and Barima were susceptible to early blight; d Merkur and Konsuragis were the highest yielders in the two planting seasons, but iu plantings made in the rainy season Eigenheimer, Barhna, Coueordia, and Jiitte-Bintje yielded as well as them.

  8. Application of sewage sludges in cultivates; Aplicacion de lodos digeridos procedentes de una E.D.A.R de lechos bacterianos en cultivos horticolas

    Energy Technology Data Exchange (ETDEWEB)

    Manas Ramirez, P.; Castro Barrilero, E.; Hera de las Ibanez, J.; Sanchez Tebar, J. C.

    2001-07-01

    In general, wastewater sewage sludge contains a great proportion of water, organic matter and mineral elements and can be used in agriculture as organic amendment. Nitrogen, phosphorous and potassium use to appear in most sewage sludge but in several cases heavy metals can be found in their chemical composition primarily when they come from industrial wastewater. The toxicity risk will depend on the heavy metals concentration and mobility. The wastewater depuration plant of Albacete is based on biological percolation filters and process daily about 48.000 m''3 of water 6.000 m''3 of which is industrial wastewater. The goal of this paper is to determine the agricultural aptitude of the digested sludge of this depuration plant using as control Lactuca sativa L. Results obtained showed significant differences among lettuce plants that were fertilized with three sludge dose and control. (Author) 26 refs.

  9. Structural recycled concrete: utilization of recycled aggregate from construction and demolition wastes; Hormigon reciclado estructural: utilizacion de arido reciclado procedente de escombros de hormigon

    Energy Technology Data Exchange (ETDEWEB)

    Alaejos Gutierrez, P.; Sanchez de Juan, M.

    2015-07-01

    This paper aims to present the main results of CEDEX research works concerning the use of recycled aggregates for structural concretes. By way of conclusion, recommendations on the requirements of the recycled aggregates have been established, providing information about the influence of these aggregates on the properties of structural concrete. (Author)

  10. Desarrollo y utilización de habilidades: el caso de los migrantes en León, Guanajuato, procedentes de la Ciudad de México

    OpenAIRE

    Ricardo Sabatés Aysa

    2007-01-01

    En este artículo se presenta una investigación sobre el desarrollo y el uso de habilidades de los migrantes provenientes de la Ciudad de México que radican en León, Guanajuato. Los datos del Censo General de Población y Vivienda 2000 relativos a los habitantes de León revelan que los migrantes provenientes de los grandes centros urbanos tienen, en promedio, mayores niveles de ingreso, educativos y ocupacionales que el resto de quienes ahí residen. Esto nos lleva a investigar si la experien...

  11. Nota sobre an Vaso Campaniense de Imitación Procedente del Poblado Ilergeta de «El Castillo», en Chalamera (Huesca

    Directory of Open Access Journals (Sweden)

    Enrique SANMARTÍ

    2009-10-01

    Full Text Available Muy cerca de la localidad de Chalamera, en la provincia de Huesca, existe un núcleo, habitado en la antigüedad, conocido como «El Castillo»; este poblado se halla enclavado en la cima del promontorio que domina a aquella población, sobre la orilla derecha del río Cinca y la izquierda de Alcanadre, en un punto que por dominar la llanura y elevaciones circundantes goza de unas condiciones estratégicas extraordinarias, evidenciadas, no sólo por los restos de un poblamiento prerromano, romano y medieval, sino también por la existencia en la cumbre de fortificaciones adaptadas al terreno y poco sobresalientes de él, que posiblemente debieron ser construidas en el siglo xvm, y de abundantes trindheras que permiten suponer una utilización militar de este punto durante la última guerra civil.

  12. Desarrollo y utilización de habilidades: el caso de los migrantes en León, Guanajuato, procedentes de la Ciudad de México

    Directory of Open Access Journals (Sweden)

    Ricardo Sabatés Aysa

    2007-01-01

    ahí residen. Esto nos lleva a investigar si la experiencia laboral en los grandes centros urbanos está relacionada con el desarrollo de habilidades que ocasionan la diferenciación socioeconómica obtenida por los datos censales. Tras un estudio de campo que se llevó a cabo en la ciudad de León se identificó que la eficiencia, la eficacia, la resilencia, y la seguridad son las principales habilidades desarrolladas por los migrantes que proceden de la Ciudad de México. Solamente 40% de los hombres y 25% de las mujeres migrantes enfrentaron barreras para la utilización de habilidades; entre éstas destacan ciertas actitudes de las empresas locales, la existencia de estructuras organizacionales rígidas y los mercados laborales poco desarrollados.

  13. Elaboration of building materials from industrial waste from solid granular diatomaceous earth; Elaboracion de material de construccion a partir de residuos industriales solidos granulares procedentes de tierras diatomaceas

    Energy Technology Data Exchange (ETDEWEB)

    Del Angel S, A.

    2015-07-01

    In this work the initial characterization of granular solid industrial waste from diatomaceous earth was carried out using techniques of Scanning Electron Microscopy and X-ray Diffraction. In a second stage leaching of the material was undertaken to the US Patent Number 5, 376,000 and 5, 356,601 obtaining the samples M1-S ph 2, M1-L ph, M1-S ph 10 and M1-L ph 10. In the third stage a new characterization of the samples obtained with the techniques of Scanning Electron Microscopy, X-ray Diffraction and Atomic Absorption Spectrometry was performed, the latter in order to determine the efficiency percentage of the leaching process. In the fourth stage the specimens for performing mechanical, physical and chemical tests were manufactured, using molds as PVC pipes of 1 inch in diameter and 2 inches in length, with a composition of 50% of diatomaceous earth and 50% of cement produced in each. Finally, in the fifth stage mechanical testing (compression resistance), physical (moisture absorption rate) and chemical (composition and structure of the material) are performed. In the last stage, when conducting mechanical testing with the test specimens, the presence of bubbles enclosed in each obtaining erroneous results noted, so it was necessary to develop the specimens again, obtaining in this occasion concentrations of 20:80, 40:60, 60:40 and 80:20 of diatomaceous earth with the cement. These results were analyzed to determine if the used material is suitable for the production of building materials such as bricks or partitions, being demonstrated by the tests carried out if they are eligible. (Author)

  14. Characterization of solid wastes from two different hot-dip galvanizing processes; Caracterizacion de residuos solidos procedentes de dos procesos distintos de galvanizado en caliente por inmersion

    Energy Technology Data Exchange (ETDEWEB)

    Delvasto, P.; Casal-Ramos, J. a.; Gonzalez-Jordan, O.; Duran-Rodriguez, N. C.; Dominguez, J. R.; Moncada, P.

    2012-11-01

    Zinc dust and zinc ash from hot-dip galvanizing industries located in Venezuela were characterized using atomic spectroscopy, scanning electron microscopy, X-Ray diffraction and infrared spectroscopy. Dust was formed during the high-pressure drying process of the galvanized pieces, in a plant that uses a steel kettle to hold the molten zinc. Ash identified as A came from the same plant as the dust, while ash identified as B came from a hot-dip galvanizing plant which use a ceramic lined galvanizing furnace. Dust contained 98 wt % Zn, in metallic form. Both ash samples contained: Zn and ZnO, while Zn{sub 5}(OH){sub 8}Cl{sub 2}×H{sub 2}O and ZnCl{sub 2} were only found in ash B. Globally, ash “A” and ash “B” contain 71 and 75 wt % Zn, respectively. (Author)

  15. Genética y Arqueología : Análisis molecular de ADN procedente de restos esqueléticos.

    Directory of Open Access Journals (Sweden)

    N. Izaguirre

    1998-01-01

    Full Text Available La recuperación de moléculas de ADN mitocondrial (ADNmt de   muestras esqueléticas de diversa antigüedad, permite estudiar la   variabilidad genética de los grupos humanos del pasado. El análisis del ADNmt en tejido antiguo presenta una ventaja fundamental frente al nuclear, debido a su alto número de copias por célula. Los principales problemas metodológicos descritos en este tipo de   análisis, han podido resolverse en aquellos casos en que las   muestras presentaban buenas condiciones de preservación. Estos han sido fundamentalmente : 1.- inhibición de la amplificación,2.- autentificación de los resultados y 3.- detección y   eliminación de la contaminación. La variabilidad en el éxito de la amplificación entre individuos de un mismo yacimiento, indica que las condiciones individuales de cada inhumación son más importantes que la antigüedad. Por otro lado, las piezas dentarias han demostrado ser el material más adecuado para el estudio del ADNmt antiguo. La interpretación de los datos a nivel poblacional sólo es posible en aquellos yacimientos que presentan un amplio número de individuos, dado el relativamente bajo rendimiento de la metodología.

  16. In vitro development of buds from tubers of (Solanum tuberosum L.); Desarrollo in vitro de yemas procedentes de tuberculos de patata (Solanum tuberosum L.) tratados por radiacion GAMMA

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Gonzalez, J; Garcia Collantes, M A

    1976-07-01

    The present work studies the in vitro development of buds from potato tubers subjected to gamma radiation at doses of 3, 6, 9 and 12 Krad. Ths effect of radiation was dependent on the dormant stage of the buds. Intermediate doses (6-9 Krad) did inhibit mitotic division but not cellular elongation. When irradiation is carried out at the end of the resting period, there is an apparent sprouting due to the elongation of previously formed cells. (Author) 17 refs.

  17. The role of lipooligosaccharide phosphorylcholine in colonization and pathogenesis of Histophilus somni in cattle

    Directory of Open Access Journals (Sweden)

    Elswaifi Shaadi F

    2012-06-01

    Full Text Available Abstract Histophilus somni is a Gram-negative bacterium and member of the Pasteurellaceae that is responsible for respiratory disease and other systemic infections in cattle. One of the bacterium’s virulence factors is antigenic phase variation of its lipooligosaccharide (LOS. LOS antigenic variation may occur through variation in composition or structure of glycoses or their substitutions, such as phosphorylcholine (ChoP. However, the role of ChoP in the pathogenesis of H. somni disease has not been established. In Haemophilus influenzae ChoP on the LOS binds to platelet activating factor on epithelial cells, promoting bacterial colonization of the host upper respiratory tract. However, ChoP is not expressed in the blood as it also binds C-reactive protein, resulting in complement activation and killing of the bacteria. In order to simulate the susceptibility of calves with suppressed immunity due to stress or previous infection, calves were challenged with bovine herpes virus-1 or dexamethazone 3 days prior to challenge with H. somni. Following challenge, expression of ChoP on the LOS of 2 different H. somni strains was associated with colonization of the upper respiratory tract. In contrast, lack of ChoP expression was associated with bacteria recovered from systemic sites. Histopathology of cardiac tissue from myocarditis revealed lesions containing bacterial clusters that appeared similar to a biofilm. Furthermore, some respiratory cultures contained substantial numbers of Pasteurella multocida, which were not present on preculture screens. Subsequent biofilm experiments have shown that H. somni and P. multocida grow equally well together in a biofilm, suggesting a commensal relationship may exist between the two species. Our results also showed that ChoP contributed to, but was not required for, adhesion to respiratory epithelial cells. In conclusion, expression of ChoP on H. somni LOS contributed to colonization of the bacteria to the

  18. Swamp Buffalo in South Kalimantan : Problem, Disease and Control

    Directory of Open Access Journals (Sweden)

    Lily Natalia

    2006-12-01

    Full Text Available In recent years, several studies have been carried out to evaluate and investigate the important diseases of swamp buffaloes (Bubalus carabanensis in Kalimantan . More attention has been focused on the case of acute infectious diseases and sudden death in the buffaloes . Fasciolosis black disease, acute enteritis, especially fatal enterotoxaemia haemorrhagic septicaemia . and trypanosomiasis (Surra, are some of the important diseases found in these animals . Black disease caused by toxigenic Clostridium novyi occurs in the presence of the organism in the liver and the degree of liver fluke Fasciola gigantica infestation . In regions where black disease is enzootic, Cl. novvi can be isolated from livers of normal healthy animals . In Hulu Sungai Utara district, South Kalimantan, the prevalence of fasciolosis caused by Fasciola gigantica in swamp buffalo was 77% in 1991 . A gross sudden change in diet due to seasonal changes could induce rumen and intestinal stasis, which provide a favourable environment for the rapid proliferation of commensal toxigenic Clostridium perfringens in the small intestine . Subsequent absorption of the toxin produced through the gut wall and its generalized dissemination culminated in a fatal enterotoxaemia . Haemorrhagic septicaemia (HS is an acute, fatal disease affecting swamp buffalo, and caused by Pasteurella multocida B : 2 . The swamp buffalo is particularly susceptible for HS, and the reported greatest losses of swamp buffalo in Kalimantan due to HS is recorded in 1980s. The clinical signs of Surra in swamp buffalo were also found in certain areas in Danau Panggang area . Hulu Sungai Utara district . Vaccination is the accepted method for controlling Black disease, enterotoxaemia and HS. Multi component vaccine, alum adjuvant containing at least 5 types of clostridial toxoids and P. multocida B2 bacterin have been used and provide good protection to the animals . Control and treatment of liver fluke infestation

  19. Pericardite em suínos ao abate no Rio Grande Sul: avaliação de agentes bacterianos e lesões associadas

    Directory of Open Access Journals (Sweden)

    Carolini F. Coelho

    2014-07-01

    Full Text Available O objetivo do presente estudo foi identificar a frequência de lesões macroscópicas e microscópicas e dos agentes bacterianos envolvidos em pericardites em suínos no abate no Estado do Rio Grande do Sul. As amostras foram coletadas em frigoríficos de suínos com Serviço de Inspeção Federal (SIF entre fevereiro a outubro de 2010 e a condenação por pericardite dos animais acompanhados foi de 3,9% (299/7.571. No total foram investigados 91 casos de pericardites, 89% deles foram classificados como crônicos por histopatologia e pleurite crônica foi observada em 47% dos pulmões correspondentes, todavia não houve associação significativa entre as duas lesões. Os agentes bacterianos isolados a partir dos corações foram Streptococcus spp., Pasteurella multocida, Haemophilus parasuis e Streptococcus suis. DNA bacterianos mais detectados pela PCR foram de Mycoplasma hyopneumoniae e Actinobacillus pleuropneumoniae. Houve associação significativa entre isolamento de P. multocida e Streptococcus sp. nos corações e pulmões correspondentes. Esses resultados sugerem que a infecção no pulmão possa ter servido de porta de entrada para a colonização do pericárdio adjacente. Apesar de M. hyopneumoniae ter sido o agente detectado com maior frequência pela PCR em corações e pulmões correspondentes, não houve associação significativa da detecção dos agentes nos órgãos. Isto sugere que as infecções foram eventos independentes. Os demais agentes investigados não apresentaram associação significativa entre isolamento ou detecção de DNA em coração e pulmão correspondente. Outro achado importante foi a presença de coinfecções bacterianas em 2% dos corações e por PCR foi detectado DNA bacteriano de dois ou mais agentes em 16,5% dos corações. Esses resultados sugerem que as coinfecções em pericardites precisam ser melhor estudadas.

  20. Antioxidant, antimicrobial, antitumor, and cytotoxic activities of an important medicinal plant (Euphorbia royleana from Pakistan

    Directory of Open Access Journals (Sweden)

    Aisha Ashraf

    2015-03-01

    Full Text Available The aim of present study was to evaluate antioxidant, antimicrobial, and antitumor activities of methanol, hexane, and aqueous extracts of fresh Euphorbia royleana. Total phenolic and flavonoid contents were estimated as gallic acid and querectin equivalents, respectively. Antioxidant activity was assessed by scavenging of free 2,2′- diphenyl-1-picrylhydrazyl radicals and reduction of ferric ions, and it was observed that inhibition values increase linearly with increase in concentration of extract. The results of ferric reducing antioxidant power assay showed that hexane extract has maximum ferric reducing power (12.70 ± 0.49 mg gallic acid equivalents/g of plant extract. Maximum phenolic (47.47 ± 0.71 μg gallic acid equivalents/mg of plant extract and flavonoid (63.68 ± 0.43 μg querectin equivalents/mg of plant extract contents were also found in the hexane extract. Furthermore, we examined antimicrobial activity of the three extracts (methanol, hexane, aqueous against a panel of microorganisms (Escherichia coli, Bacillus subtillis, Pasteurella multocida, Aspergillus niger, and Fusarium solani by disc-diffusion assay, and found the hexane extract to be the best antimicrobial agent. Hexane extract was also observed as to be most effective in a potato disc assay. As hexane extract showed potent activity in all the investigated assays, it was targeted for cytotoxic assessment. Maximum cytotoxicity (61.66% by hexane extract was found at 800 μg/mL. It is concluded that investigated extracts have potential for isolation of antioxidant and antimicrobial compounds for the pharmaceutical industry.

  1. Avaliação de bacterina e Lactobacillus plantarum frente à infecção experimental por Vibrio harveyi em pós-larvas de Litopenaeus vannamei

    Directory of Open Access Journals (Sweden)

    Celso Carlos Buglione

    2008-12-01

    Full Text Available This study aimed to verify the effect of probiotics and inactivated cells of bacterias such as Vibrio alginolyticus, Aeromonas salmonicida and Pasteurella multocida in larvae survival of Litopenaeus vannamei, in stress test and experimental infection with Vibrio harveyi. Conic tanks of 30 L, were stocked with 400 post-larvae stage five. Four experimental treatments with triplicates consisted of: 1: commercial feed (control, 2: commercial feed plus bacterin by oral administration in artemia, 3: commercial feed plus bacterin by immersion administration, 4: commercial feed with Lactobacillus plantarum inoculation. Bacterin application was conducted 6h before the infection and stress test, while probiotic administration was for 15 days before challenges. In stress test, post-larvae of treatment 4 (commercial feed supplemented with Lactobacillus plantarum with reached the highest survival rate (87,86 ± 2,35% followed by the ones of treatment 3 and 2 (bacterim by immersion and bacterim by oral administration in artemia with 81,54±1,50% and 80,16 ± 2,15%, respectively, which were superior to the control treatment (72,63 ± 3,34%. Next to V. harveyi challenge, animals from treatment 3 presented the highest survival rate (79,60 ± 7,12% followed by treatments 4 (69,60 ± 10,43%, 2 (65,60 ± 5,18% and control (56,4 ± 5,58%. All treatments were different from control. The present results demonstrate the possible use of L. plantarum and bacterin as promoters in survival rates of L. vannamei post-larvae in the stress tests and challenges with Vibrio harveyi.

  2. Avian Cholera emergence in Arctic-nesting northern Common Eiders: using community-based, participatory surveillance to delineate disease outbreak patterns and predict transmission risk

    Directory of Open Access Journals (Sweden)

    Samuel A. Iverson

    2016-12-01

    Full Text Available Emerging infectious diseases are a growing concern in wildlife conservation. Documenting outbreak patterns and determining the ecological drivers of transmission risk are fundamental to predicting disease spread and assessing potential impacts on population viability. However, evaluating disease in wildlife populations requires expansive surveillance networks that often do not exist in remote and developing areas. Here, we describe the results of a community-based research initiative conducted in collaboration with indigenous harvesters, the Inuit, in response to a new series of Avian Cholera outbreaks affecting Common Eiders (Somateria mollissima and other comingling species in the Canadian Arctic. Avian Cholera is a virulent disease of birds caused by the bacterium Pasteurella multocida. Common Eiders are a valuable subsistence resource for Inuit, who hunt the birds for meat and visit breeding colonies during the summer to collect eggs and feather down for use in clothing and blankets. We compiled the observations of harvesters about the growing epidemic and with their assistance undertook field investigation of 131 colonies distributed over >1200 km of coastline in the affected region. Thirteen locations were identified where Avian Cholera outbreaks have occurred since 2004. Mortality rates ranged from 1% to 43% of the local breeding population at these locations. Using a species-habitat model (Maxent, we determined that the distribution of outbreak events has not been random within the study area and that colony size, vegetation cover, and a measure of host crowding in shared wetlands were significantly correlated to outbreak risk. In addition, outbreak locations have been spatially structured with respect to hypothesized introduction foci and clustered along the migration corridor linking Arctic breeding areas with wintering areas in Atlantic Canada. At present, Avian Cholera remains a localized threat to Common Eider populations in the

  3. Occurrence of antimicrobial resistance in bacteria from diagnostic samples from dogs.

    Science.gov (United States)

    Pedersen, Karl; Pedersen, Kristina; Jensen, Helene; Finster, Kai; Jensen, Vibeke F; Heuer, Ole E

    2007-10-01

    To study the occurrence of antimicrobial resistance among common bacterial pathogens from dogs and relate resistance patterns to data on consumption of antimicrobials. The antimicrobial susceptibility patterns of 201 Staphylococcus intermedius, 37 Streptococcus canis, 39 Pseudomonas aeruginosa, 25 Pasteurella multocida, 29 Proteus spp. and 449 Escherichia coli isolates from clinical submissions from dogs were determined by a broth-dilution method for determination of minimal inhibitory concentration. Data for consumption of antimicrobials were retrieved from VetStat, a national database for reporting antimicrobial prescriptions. The majority of the antimicrobials prescribed for dogs were broad-spectrum compounds, and extended-spectrum penicillins, cephalosporins and sulphonamides + trimethoprim together accounted for 81% of the total amount used for companion animals. Resistance to cephalosporins and amoxicillin with clavulanic acid was very low for all bacterial species examined, except for P. aeruginosa, and resistance to sulphonamides and trimethoprim was low for most species. Among the S. intermedius isolates, 60.2% were resistant to penicillin, 30.2% to fusidic acid and 27.9% to macrolides. Among E. coli isolates, the highest level of resistance was recorded for ampicillin, sulphonamides, trimethoprim, tetracyclines and streptomycin. Certain differences in resistance patterns between isolates from different sites or organs were noticed for E. coli, S. intermedius and Proteus isolates. This investigation provided data on occurrence of antimicrobial resistance in important pathogenic bacteria from dogs, which may be useful for the small animal practitioner. Resistance was low to the compounds that were most often used, but unfortunately, these compounds were broad-spectrum. Data on resistance and usage may form a background for the establishment of a set of recommendations for prudent use of antimicrobials for companion animals.

  4. Aquatic bird disease and mortality as an indicator of changing ecosystem health

    Science.gov (United States)

    Newman, Scott H.; Chmura, Aleksei; Converse, Kathy; Kilpatrick, A. Marm; Patel, Nikkita; Lammers, Emily; Daszak, Peter

    2007-01-01

    We analyzed data from pathologic investigations in the United States, collected by the USGS National Wildlife Health Center between 1971 and 2005, into aquatic bird mortality events. A total of 3619 mortality events was documented for aquatic birds, involving at least 633 708 dead birds from 158 species belonging to 23 families. Environmental causes accounted for the largest proportion of mortality events (1737 or 48%) and dead birds (437 258 or 69%); these numbers increased between 1971 and 2000, with biotoxin mortalities due to botulinum intoxication (Types C and E) being the leading cause of death. Infectious diseases were the second leading cause of mortality events (20%) and dead birds (20%), with both viral diseases, including duck plague (Herpes virus), paramyxovirus of cormorants (Paramyxovirus PMV1) and West Nile virus (Flavivirus), and bacterial diseases, including avian cholera (Pasteurella multocida), chlamydiosis (Chalmydia psittici), and salmonellosis (Salmonella sp.), contributing. Pelagic, coastal marine birds and species that use marine and freshwater habitats were impacted most frequently by environmental causes of death, with biotoxin exposure, primarily botulinum toxin, resulting in mortalities of both coastal and freshwater species. Pelagic birds were impacted most severely by emaciation and starvation, which may reflect increased anthropogenic pressure on the marine habitat from over-fishing, pollution, and other factors. Our study provides important information on broad trends in aquatic bird mortality and highlights how long-term wildlife disease studies can be used to identify anthropogenic threats to wildlife conservation and ecosystem health. In particular, mortality data for the past 30 yr suggest that biotoxins, viral, and bacterial diseases could have impacted >5 million aquatic birds.

  5. Antimicrobial Susceptibility of Bordetella bronchiseptica Isolates from Swine and Companion Animals and Detection of Resistance Genes.

    Directory of Open Access Journals (Sweden)

    Sandra Prüller

    Full Text Available Bordetella bronchiseptica causes infections of the respiratory tract in swine and other mammals and is a precursor for secondary infections with Pasteurella multocida. Treatment of B. bronchiseptica infections is conducted primarily with antimicrobial agents. Therefore it is essential to get an overview of the susceptibility status of these bacteria. The aim of this study was to comparatively analyse broth microdilution susceptibility testing according to CLSI recommendations with an incubation time of 16 to 20 hours and a longer incubation time of 24 hours, as recently proposed to obtain more homogenous MICs. Susceptibility testing against a panel of 22 antimicrobial agents and two fixed combinations was performed with 107 porcine isolates from different farms and regions in Germany and 43 isolates obtained from companion animals in Germany and other European countries. Isolates with increased MICs were investigated by PCR assays for the presence of resistance genes. For ampicillin, all 107 porcine isolates were classified as resistant, whereas only a single isolate was resistant to florfenicol. All isolates obtained from companion animals showed elevated MICs for β-lactam antibiotics and demonstrated an overall low susceptibility to cephalosporines. Extension of the incubation time resulted in 1-2 dilution steps higher MIC50 values of porcine isolates for seven antimicrobial agents tested, while isolates from companion animals exhibited twofold higher MIC50/90 values only for tetracycline and cefotaxime. For three antimicrobial agents, lower MIC50 and MIC90 values were detected for both, porcine and companion animal isolates. Among the 150 isolates tested, the resistance genes blaBOR-1 (n = 147, blaOXA-2, (n = 4, strA and strB (n = 17, sul1 (n = 10, sul2 (n = 73, dfrA7 (n = 3 and tet(A (n = 8 were detected and a plasmid localisation was identified for several of the resistance genes.

  6. Retrospective Analysis of Bacterial and Viral Co-Infections in Pneumocystis spp. Positive Lung Samples of Austrian Pigs with Pneumonia.

    Directory of Open Access Journals (Sweden)

    Christiane Weissenbacher-Lang

    Full Text Available Aim of this study was the retrospective investigation of viral (porcine circovirus type 2 (PCV2, porcine reproductive and respiratory syndrome virus (PRRSV, torque teno sus virus type 1 and 2 (TTSuV1, TTSuV2 and bacterial (Bordetella bronchiseptica (B. b., Mycoplasma hyopneumoniae (M. h., and Pasteurella multocida (P. m. co-infections in 110 Pneumocystis spp. positive lung samples of Austrian pigs with pneumonia. Fifty-one % were positive for PCV2, 7% for PRRSV, 22% for TTSuV1, 48% for TTSuV2, 6% for B. b., 29% for M. h., and 21% for P. m. In 38.2% only viral, in 3.6% only bacterial and in 40.0% both, viral and bacterial pathogens were detected. In 29.1% of the cases a co-infection with 1 pathogen, in 28.2% with 2, in 17.3% with 3, and in 7.3% with 4 different infectious agents were observed. The exposure to Pneumocystis significantly decreased the risk of a co-infection with PRRSV in weaning piglets; all other odds ratios were not significant. Four categories of results were compared: I = P. spp. + only viral co-infectants, II = P. spp. + both viral and bacterial co-infectants, III = P. spp. + only bacterial co-infectants, and IV = P. spp. single infection. The evaluation of all samples and the age class of the weaning piglets resulted in a predomination of the categories I and II. In contrast, the suckling piglets showed more samples of category I and IV. In the group of fattening pigs, category II predominated. Suckling piglets can be infected with P. spp. early in life. With increasing age this single infections can be complicated by co-infections with other respiratory diseases.

  7. Evaluation of Phenolic Compounds and Antioxidant and Antimicrobial Activities of Some Common Herbs

    Directory of Open Access Journals (Sweden)

    Muhammad Abdul Qadir

    2017-01-01

    Full Text Available The study was designed to evaluate the phenolic, flavonoid contents and antioxidant and antimicrobial activities of onion (Allium cepa, garlic (Allium sativum, mint (Mentha spicata, thyme (Thymus vulgaris, oak (Quercus, aloe vera (Aloe barbadensis Miller, and ginger (Zingiber officinale. All extracts showed a wide range of total phenolic contents, that is, 4.96 to 98.37 mg/100 g gallic acid equivalents, and total flavonoid contents, that is, 0.41 to 17.64 mg/100 g catechin equivalents. Antioxidant activity (AA was determined by measuring reducing power, inhibition of peroxidation using linoleic acid system, and 2,2-diphenyl-1-picrylhydrazyl radical (DPPH scavenging activity. Different extracts inhibited oxidation of linoleic acid by 16.6–84.2% while DPPH radical scavenging activity (IC50 values ranged from 17.8% to 79.1 μg/mL. Reducing power at 10 mg/mL extract concentration ranged from 0.11 to 0.84 nm. Furthermore the extracts of these medicinal herbs in 80% methanol, 80% ethanol, 80% acetone, and 100% water were screened for antimicrobial activity by disc diffusion method against selected bacterial strains, Staphylococcus aureus, Escherichia coli, Bacillus subtilis, and Pasteurella multocida, and fungal strains, Aspergillus niger, Aspergillus flavus, Rhizopus solani, and Alternaria alternata. The extracts show better antimicrobial activity against bacterial strains as compared to fungal strains. Results of various assays were analyzed statistically by applying appropriate statistical methods.

  8. Plasma concentrations resulting from florfenicol preparations given to pigs in their drinking water.

    Science.gov (United States)

    Gutiérrez, L; Vargas, D; Ocampo, L; Sumano, H; Martinez, R; Tapia, G

    2011-09-01

    Florfenicol administered through the drinking water has been recommended as a metaphylactic antibacterial drug to control outbreaks of respiratory diseases in pigs caused by strains of Actinobacillus pleuropneumoniae and Pasteurella multocida, yet it is difficult to pinpoint in practice when the drug is given metaphylactically or therapeutically. Further, pigs are likely to reject florfenicol-medicated water, and plasma concentrations of the drug are likely to be marginal for diseases caused by Escherichia coli, Klebsiella pneumoniae, and Staphylococcus aureus. The reported minimal inhibitory concentration (MIC) values for these organisms show a breakpoint of 2 to 3 μg/mL. An experiment was conducted during September and October 2009. One hundred twenty healthy crossbred pigs (Landrace-Yorkshire), weighing 23 ± 6.2 kg, were used in this trial. They were randomly assigned to 5 groups, with 3 replicates of 8 animals/group. Two commercial preparations of florfenicol were administered through the drinking water at 2 concentrations (0.01 and 0.015%). Water intake was measured before and after medication, and plasma concentrations of florfenicol were determined by HPLC. Considerable rejection of florfenicol-medicated water was observed. However, plasma florfenicol concentrations were of a range sufficient for a methaphylaxis approach to preventing disease by bacteria, with MIC breakpoints of ≤ 0.25 μg/mL. Decreased efficacy as a metaphylactic medication should be expected for bacteria with MIC >0.25 μg/mL, considering the reported existence of bacteria resistant to florfenicol and the natural resistance of Streptococcus suis or E. coli to this drug.

  9. Cryostored autologous skull bone for cranioplasty? A study on cranial bone flaps' viability and microbial contamination after deep-frozen storage at -80°C.

    Science.gov (United States)

    Chan, David Yuen Chung; Mok, Yi Tan; Lam, Ping Kuen; Tong, Cindy See Wai; Ng, Stephanie Chi Ping; Sun, Tin Fung David; Poon, Wai Sang

    2017-08-01

    Craniectomy is a life-saving procedure. Subsequent cranioplasty with autologous skull bone has a bone resorption rate from 4% to 22.8% and an infection rate from 3.3% to 26%. There are concerns with their viability and the potential microbial contamination as they were explanted for a long period of time. Eighteen cranial bone flaps stored at Prince of Wales Hospital Skull Bone Bank during the period from June 2011 to March 2016 were identified. Ethics approval was obtained. Bone chips and deep bone swabs were collected for osteoblast culture and microbial culture. Skull Bone Bank was kept at -80°C under strict aseptic technique during the study period. The storage period ranged from 4months to 55months. For the osteoblast culture, all eighteen bone flaps had no viable osteoblast growth. For the bacterial culture, five had positive bacteria growth (27.8%). Three were Pasteurella multocida and two were Methicillin-resistant Staphylococcus aureus. The mean duration of storage of the infected bone flap was 32.9months (±15.1months) versus 19.9months (±17.9months) of those bone flaps with no bacterial growth (p=0.1716). The mean size of the infected versus non-infected bone flaps was 117.7cm 2 (±44.96cm 2 ) versus 76.8cm 2 (±50.24cm 2 ) respectively (p=0.1318). Although in this study statistical significance was not reached, it was postulated that infected bone flaps tended to be larger in size and had a longer duration of storage. In conclusion, cryostored skull bone flaps beyond four months showed no viable osteoblasts. Bacterial contamination rate of bone flaps was 27.8% in this study. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  10. Huellas digitales de cepas de Acinetobacter baumannii procedentes de pacientes hospitalizados en la Caja Petrolera de Salud de Obrajes, mediante el método de Pulsed Field Gel Electrophoresis (PFGE, La Paz, Bolivia. Marzo 2015

    Directory of Open Access Journals (Sweden)

    García-Rada Giovanni

    2017-08-01

    Full Text Available Acinetobacter baumannii, worldwide is considered an opportunistic microorganism, present in several cases of hospital-acquired infections. In the Caja Petrolera de Salud of Obrajes Hospital was made the isolation of four Acinetobacter baumannii strains. Identification was confirmed by biochemical tests. Then, the PFGE molecular technique was applied for the identification of genomic fingerprints using Apa I restriction en-zyme.

  11. Podridão peduncular e qualidade de mangas 'Tommy atkins' procedentes do mercado atacadista de Campina Grande-PB Stalk rot and quality of 'Tommy atkins' mangos from the wholesale market of Campina Grande-PB, Brazil

    Directory of Open Access Journals (Sweden)

    Erbs Cintra de Souza Gomes

    2010-12-01

    Full Text Available O Brasil destaca-se no cenário mundial como um dos maiores produtores de manga (Mangifera indica L.. No entanto, perdas significativas são observadas em todas as etapas da cadeia produtiva, sobretudo na comercialização varejista, sendo estas correlacionadas em quase sua totalidade à incidência de doenças fúngicas. Neste sentido, objetivou-se com este trabalho determinar a incidência natural de Lasiodiplodia theobromae, agente causal da podridão peduncular, e aspectos da qualidade pós-colheita de mangas 'Tommy Atkins', comercializadas no mercado atacadista da Empresa Paraibana de Abastecimento e Serviços Agrícolas (EMPASA de Campina Grande-PB. Para a determinação da incidência natural da doença, coletaram-se 40 frutos no estádio de maturação 'de vez', de quatro diferentes estabelecimentos de comercialização, que foram encaminhados ao Laboratório de Fitopatologia (CCA/UFPB. Após sanificação, os frutos foram mantidos sob condições ambientes (28 ± 2 ºC e UR 75 ± 6% por oito dias, determinando-se o aparecimento dos primeiros sintomas e sinais do patógeno. As características de qualidade foram determinadas através da coleta de 10 frutos de cada estabelecimento de comercialização da EMPASA. Os frutos foram transportados ao Laboratório de Biologia e Tecnologia Pós-Colheita (CCA/UFPB, onde foram avaliados quanto aos teores de Sólidos Solúveis (SS, Acidez Titulável (AT, Relação SS/AT e pH. Os dados foram submetidos à análise de variância, e as médias, comparadas pelo teste de Tukey, a 5% de probabilidade. A manga comercializada no mercado atacadista da EMPASA de Campina Grande apresentou baixo conteúdo de SS e elevada AT, caracterizando fruto no início da maturação. Os frutos apresentaram 88,9% de incidência natural de podridão peduncular no oitavo dia de armazenamento, o que compromete a qualidade do produto no varejo, constituindo-se em uma causa das elevadas perdas pós-colheita.Brazil stands out as one of the largest producers of mango (Mangifera indica L. in the world. However, significant losses are observed in all stages of production chain, mainly in the retail market, which are correlated almost entirety to incidence of fungal diseases. In this way, the objective of this study was to determine the incidence of natural infection of Lasiodiplodia theobromae, causal agent of stem-end rot, and postharvest quality of 'Tommy Atkins' mangos, traded in the wholesale market of the Central de Abastecimento (EMPASA from Campina Grande, Paraíba State, Brazil. To determine natural incidence of the disease it was collected 40 fruits at mature-green maturity stage from four different wholesale marketing stores at EMPASA that were sent to Laboratory of Phytopathology (CCA/UFPB. After sanitization, fruits were kept at room conditions (28 ± 2 ºC and RH 75 ± 6% during eight days, determining first symptoms and signals of the pathogen. The characteristics of quality were determined by collecting 10 fruits from each wholesale marketing store. Fruits were transported to the Laboratory of Biology and Postharvest Technology (CCA/UFPB, where it was evaluated Soluble Solids (SS, Titratable Acidity (TA, SS/TA, and pH. Data were subjected to variance analysis of and means compared by the Tukey test at 5% of probability. Mango commercialized in the wholesale market of EMPASA, Campina Grande, showed low SS and high TA contents characterizing fruit at the beginning of maturation. Fruits showed 88.9% of natural incidence of stalk rot in the eighth day of storage, which is deleterious for retail quality of fruits, characterizing a causal factor for the higher postharvest losses.

  12. Producciones de cerámica Celtibérica procedentes del sistema Ibérico Central (España: Caracterización química y petrográfica

    Directory of Open Access Journals (Sweden)

    Saiz, M. E.

    2013-02-01

    Full Text Available As part of an extended program on archaeometric research of the Celtiberian production centres situated along the Central Iberian Range, ceramic fragments of different vessel types from two selected Celtiberian workshops were analyzed: La Rodriga (Guadalajara, Spain and Allueva II (Teruel, Spain, dated from the 3nd to the 2st centuries BC. The characterization was focused on the chemical analysis by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS, and subjected to commonlyused multivariate statistical methods to distinguish between ceramic materials and to discriminate among different compositional groups in each production centre. The analysis was completed by performing petrographic characterization, textural observations, colour measurement and mineralogical analysis of the pieces by means of XRD. The compositional variations from major, minor and trace elements allowed to establish two subgroups in La Rodriga and one ceramic group in Allueva II. The chemical composition differences were confirmed by the petrographic characteristics and the mineralogical composition of the ceramic fabrics. These results enabled us to complete the preliminary archaeometric study in order to improve the knowledge on cultural and commercial influences in this important Celtiberian territory.

    En el marco de un extenso programa de investigación arqueométrica de la producción de centros alfareros celtibéricos, ubicados en el Sistema Ibérico Central, se ha avanzado en el estudio de dos de estos alfares: La Rodriga (Guadalajara y Allueva II (Teruel. Se han analizado cuarenta y cuatro muestras representativas de distintos tipos de cerámicas de ambos talleres, cuya cronología de funcionamiento se centró entre los siglos III-II a. C. La caracterización se ha dirigido al análisis químico mediante Espectrometría de Masas con Plasma de Acoplamiento Inductivo (ICP-MS, realizando un tratamiento estadístico multivariante para diferenciar entre los materiales cerámicos y discriminar distintos grupos compositivos en cada centro alfarero. El estudio se ha completado con la caracterización petrográfica, observaciones texturales, medición del color de las cerámicas y el análisis mineralógico por DRX. A partir de las variaciones compositivas identificadas en sus elementos mayoritarios, minoritarios y trazas, se han establecido dos subgrupos para La Rodriga, discriminados frente al grupo constituido por las cerámicas de Allueva II. Estas variaciones son concordantes con las características petrográficas de las fábricas cerámicas y la composición mineralógica de las piezas. Los resultados obtenidos han permitido completar la investigación arqueométrica inicial y servirán de base para el estudio de las influencias culturales y comerciales en este importante territorio de la Celtiberia.

  13. Use of residual soapstock from the refining of edible vegetable oils to make biodiesel; Aprovechamiento de las oleinas residuales procedentes del proceso de refinado de los aceites vegetales comestibles, para la fabricaciond e biodiesel

    Energy Technology Data Exchange (ETDEWEB)

    Marin, P.; Barriga Mateos, F.; Alvarez Mateos, P. [Universidad de Sevilla (Spain)

    2003-07-01

    A procedure to obtain Biodiesel from Oiliness is studied. Biodiesel is a suitable product to replace diesel oil currently used to power the Diesel engines. It consists of a mixture of methyl esters of the fatty acids presents as triglycerides in vegetables oils (oil, sunflower, soya, rape oils). As a result of the refining of these oils for their use as food, a waste product is formed, the oleins (acidulated soapstock). The oiliness consist of a mixture of triglycerides and free fatty acids, the latter amounting to 50% or more of the mixture and are subject to a fluctuating market, therefore it exist at times a problem for their disposal. In our research work we have tried to obtain biodiesel from oiliness. The process resulting from our experimental work is as follows. 1. Scarification of the free fatty acids with methanol, by acid catalysis, centrifuging the reaction product and removal of the acid-methanol phase. Drying of the latter. At this stage we have a product containing about 70% of methyl esters. 2. Transesterification of the triglycerides present in the sterified product with methanol by alkaline catalysis, washing the reaction product with a water methanol solution. Centrifuging and removal of the water-methanol phase. At this stage a biodiesel products is obtained containing about 90% of methyl esters. 3. Fractional vacuum distillation of the 90% biodiesel gives a final product with a methyl esters content higher than 98%. (Author)

  14. El pH de la carne de cobayo (Cavia porcellus procedente del manejo deficiente del bienestar animal durante el sacrificio en la sierra central del Perú.

    Directory of Open Access Journals (Sweden)

    LUCAS JR

    2017-09-01

    Full Text Available En la región andina del Perú es común observar el sacrificio de los cobayos sin aturdimiento ni descanso ante mortem. El objetivo del presente estudio fue evaluar el pH de la carne de cobayo (Cavia porcellus resultante de este manejo. Se evaluó el pH de 60 canales a las 0, 1, 6, 12, y 24 h posteriores al sacrificio sin descanso ante mortem ni aturdimiento. El pH fue de 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 y 5.96 ± 0.11, a la 0, 1, 6, 12 y 24 horas post sacrificio respectivamente. La ecuación que representa la evolución del pH fue Y=6.7765-0.0231X-0.0005X2 (R2=0.996. SUMMARY. The pH of guinea pig (Cavia porcellus meat from the welfare-deficient slaughtering in the Peruvian central Andes. In Andean region of Peru is common to slaughter Guinea pig without lairage and stunning. The aim of this study was to evaluate the pH of meat of Guinea pig (Cavia porcellus from the unsuitable welfare practices during slaughtering in the Peruvian central Andes. The pH of 60 guinea pig carcasses were analyzed at 0, 1, 6, 12 and 24 hours after the end of the slaughter process. The pH was 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 and 5.96 ± 0.11 for 0, 1, 6, 12 y 24 h post slaughtering. The equation that graphs pH evolution was Y=6.7765-0.0231X-0.0005X2 (R2=0.996.

  15. Potentiality of a frit waste from ceramic sector as raw material to glass-ceramic material production; Potencialidad de un residuo de frita procedente del sector ceramico como materia prima para la produccion de material vitroceramico

    Energy Technology Data Exchange (ETDEWEB)

    Barrachina Albert, E.; Llop Pla, J.; Notari Abad, M. D.; Carda Castello, J. B.

    2015-10-01

    This work consists of studying the devitrification capacity of a residue from sodium-calcium frit, using the vitreous powder sintering method, which follows the traditional ceramic processing route, including a specific heat treatment to generate the appearance of crystals from the original glass phase. Initially the frit residue has been characterized by instrumental techniques such as XRF, XRD and DTA/TG. Furthermore, the chemical analysis (XRF) has allowed the prediction of devitrification potentiality of this residue by theoretical approaches represented by Gingsberg, Raschin-Tschetverikov and Lebedeva ternary diagrams. Then, this residue was subjected to traditional ceramic method, by changing the grinding time, the pressing pressure and prepared samples were obtained at different temperatures. In this part, the techniques for measuring particle size by laser diffraction and XRD and SEM to evaluate the generated crystalline phases, were applied. Finally, it has been found that this frit residue works as glass-ceramic precursor, devitrifying in wollastonite crystals as majority phase and without being subjected to the melting step of the glass-ceramic typical method. (Author)

  16. Grafitos sobre cerámica —ibéricos, latinos, griegos y signos— procedentes del yacimiento romanorrepublicano de La Cabañeta (El Burgo de Ebro, Zaragoza

    Directory of Open Access Journals (Sweden)

    Mínguez Morales, José Antonio

    2011-12-01

    Full Text Available This paper presents an interesting group of inscriptions made on pottery, unearthed during the archaeological excavations carried out in the site called La Cabañeta (El Burgo de Ebro, Zaragoza, from 1997 to 2009. Included are fourteen Iberian documents written in Paleohispanic script, twenty-two in Latin, two in Greek, eight signs and four difficult to identify marks, all of them dated between the second half of the II century B.C. and the destruction of the settlement in the decade of the 70s of the I century B.C.En este trabajo se presenta un interesante conjunto de inscripciones realizadas sobre cerámica, recuperadas durante las diferentes intervenciones arqueológicas practicadas en el yacimiento de La Cabañeta (El Burgo de Ebro, Zaragoza, desde el año 1997 hasta el 2009. En él se incluyen catorce documentos ibéricos escritos en signario paleohispánico, veintidós latinos, dos griegos, ocho signos y cuatro marcas de difícil adscripción, todos ellos fechables entre la segunda mitad del s. II a. C. y la destrucción del asentamiento en la década de los 70 del s. I a. C.

  17. Estudio de la recuperación del zinc presente en los baños agotados de decapado procedentes de las industrias de galvanizado de zinc en caliente mediante técnicas electroquímicas

    OpenAIRE

    Carrillo Abad, Jorge

    2014-01-01

    Actualmente, el 43% de la producción mundial de zinc se destina al proceso de galvanizado por inmersión en caliente. Previamente a la introducción de las piezas en el baño de zinc fundido, éstas necesitan una serie de tratamientos superficiales. Entre estos tratamientos cabe destacar la etapa de decapado, que consiste en la inmersión de las piezas en un baño de ácido clorhídrico para eliminar de su superficie cáscaras y restos de óxido, como la etapa más contaminante del p...

  18. Determinación de la composición fenólica y actividad antioxidante en brotes de clones de Pinus pinaster procedentes de tres orígenes contrastantes

    OpenAIRE

    Baizán González, Silvia

    2013-01-01

    Pinus pinaster es una especie de gran importancia económica y ecológica y que presenta una gran diversidad genética. En nuestro grupo de trabajo disponemos de una colección clonal representativa de toda el área de distribución natural de la especie. En una parcela que alberga un ensayo anidado de 10 procedencias x 5 familias x 5 clones x 8 copias y con distribución de bloques aleatorizados, se evaluó la variabilidad del color en base al Espacio de Color CIELAB de los brotes que emergen en pri...

  19. Modelo de cálculo de las emisiones difusas de gases de efecto invernadero procedentes del transporte. Análisis según variables de diseño urbanístico

    Directory of Open Access Journals (Sweden)

    Sergio Zubelzu-Mínguez

    2014-01-01

    Full Text Available Entre las medidas más relevantes para frenar el calentamiento global se encuentra el control de las denominadas emisiones difusas, siendo las emisiones derivadas de las fuentes móviles una de las componentes más importantes dentro de tales emisiones. En el presente trabajo se han estudiado las emisiones difusas en el marco del diseño urbanístico y se han desarrollado métodos para el cálculo de las emisiones derivadas del tráfico rodado en función de parámetros de diseño urbanístico; como los usos del suelo, la longitud de viales o la edificabilidad, obteniendo así expresiones no lineales que permiten predecir los niveles de emisiones para diferentes usos. Los resultados muestran coeficientes de determinación de 0,644 para el uso residencial, 0,591 para el uso industrial, 0,592 para el uso terciario y 0,591 para los equipamientos, cifras de las que se deduce una mayor capacidad explicativa del modelo predictivo de las emisiones para el uso residencial.

  20. Diagnósticos problemáticos, ausentes y estigmatizantes en las actuales clasificaciones de trastornos mentales: resultados de las encuestas globales de la OMS procedentes de la WPA y la IUPsyS

    Directory of Open Access Journals (Sweden)

    Rebeca Robles

    2014-01-01

    Full Text Available Se examinaron las opiniones de psicólogos y psiquiatras de habla inglesa y española acerca de los diagnósticos problemáticos, ausentes y estigmatizantes en la CIE-10 y DSM-IV, y de la necesidad de una clasificación nacional. Se llevó a cabo un análisis de contenido de las preguntas abiertas de las encuestas de WHO-WPA y WHO-IUPsyS. Se incluyeron a 3.222 participantes de 35 países. El grupo diagnóstico considerado más problemático fue trastornos específicos de la personalidad, especialmente entre psiquiatras, por la falta de validez y de especificidad. El trastorno por estrés postraumático complejo fue el diagnóstico que se sugirió incluir con mayor frecuencia, sobre todo por psicólogos, para dar cuenta de los procesos y consecuencias distintos del trauma complejo. La esquizofrenia fue el diagnóstico que se consideró más frecuentemente como estigmatizante, principalmente por psiquiatras, debido a la falta de conocimiento público. Del 14,4% que percibieron la necesidad de una clasificación nacional, dos tercios fueron de África o Latinoamérica. Las razones fueron que se deben considerar la diversidad socio-histórica en la expresión de psicopatología, las diferencias en la percepción de lo que es o no patológico y la existencia de síndromes culturales. Se discuten las implicaciones para el desarrollo y diseminación de la CIE-11.

  1. ESTIMACIÓN DE LA DEMANDA DE IMPORTACIONES DE LIMÓN PERSA (Citrus latifolia tanaka EN ESTADOS UNIDOS PROCEDENTES DE MÉXICO (1994-2008

    Directory of Open Access Journals (Sweden)

    Yolanda Sanchez Torres

    2011-07-01

    Full Text Available En 2008, México figuraba como el segundo productor mundial (14.94% de limones y el primero como exportador (20.5%, principalmente de limón persa, por lo que el objetivo de la investigación fue identificar y valorar aquellos factores que determinan la demanda de importaciones de limón persa en Estados Unidos, principal mercado destino (94.7%. Bajo el supuesto de que dicho mercado ofrece una capacidad real de expansión para los productores mexicanos de este cultivo, se formuló un modelo de regresión múltiple, considerando el ingreso, tipo de cambio (peso/dólar, precio unitario de importación y la demanda de importaciones,  estimado por el método de Mínimos Cuadrados Ordinarios (MCO; con datos anuales del  periodo 1994-2008, obteniendo también las elasticidades de la demanda. La variable de mayor  respuesta fue el ingreso con una elasticidad de  3.8, clasificando al limón persa como un bien normal superior; seguido del tipo de cambio  (0.83 y el precio (-0.666. Se concluyó, que es factible mantener el nivel de crecimiento actual de demanda de importaciones de limón persa, del 9.3% promedio anual, debido a que el incremento requerido en el ingreso real de Estados Unidos sería del 2.45% (ceteris paribus, contra el crecimiento observado del 2.9% en el periodo de estudio.

  2. Estudio de los niveles de emisión de dioxinas a la atmósfera procedentes de plantas cementeras que utilizan combustibles alternativos durante la producción de clínker

    Directory of Open Access Journals (Sweden)

    Esteban Abad

    2005-01-01

    Full Text Available El objetivo de este estudio fue la evaluación de la influencia en los niveles de dioxinas emitidos a la atmósfera como resultado de la utilización de diferentes residuos, tales como neumáticos usados o harinas animales como combustible alternativo durante la producción de clínker. Con este propósito se seleccionaron tres instalaciones que operan en España que fueron evaluadas en diferentes campañas de muestreo. Además, los diferentes residuos fueron evaluados por separado en cada una de las instalaciones. Así, la primera instalación incluyó la adición de harinas animales en la producción de cemento. En la segunda instalación se evaluaron neumáticos fuera de uso y en la tercera planta fueron incorporados los dos tipos de residuos simultáneamente. En todos los casos, los valores de emisión se mantuvieron por debajo de lo establecido por la Directiva Europea de 0,1 ng I-TEQ/Nm3 con valores que se mantuvieron entre 0,001 y 0,042 ng I-TEQ/Nm3. Además, no se encontraron diferencias significativas entre los valores encontrados en el presente estudio y los determinados en instalaciones que operan habitualmente con combustible convencional.

  3. Efectos de oferta sobre la economía andaluza de las ayudas procedentes de los fondos estructurales destinadas a infraestructuras: El Marco de Apoyo Comunitario 1994-1999

    Directory of Open Access Journals (Sweden)

    Simón Sosvilla Rivero

    2005-01-01

    Full Text Available El objetivo principal de este trabajo es analizar los efectos de oferta de las ayudas comunitarias recibidas por Andalucía, concretamente del Marco de Apoyo Comunitario 1994-1999 (MAC 94-99. En particular, se examinan los efectos derivados de una mayor y mejor dotación de recursos productivos e infraestructuras sobre la producción y el empleo de la región, mediante la estimación, mediante técnicas de cointegración con series temporales, de una función de producción agregada para el sector privado de la economía en la que el stock de capital público aparece como un factor productivo separado y diferente, así como de una demanda de trabajo derivada de dicha función. Las simulaciones realizadas sugieren que las inversiones en infraestructuras financiadas con cargo al MAC 94-99 habrían hecho posible que la economía andaluza creciera en términos reales durante el período 1994-2001 a una tasa acumulativa del 3,42%, frente al crecimiento del 3,15% que hubiese experimentado de no recibir dichas inversiones. En cuanto al mercado de trabajo, los resultados obtenidos indican que el MAC 94-99 habría generado o mantenido una media de 79.034 empleos durante el período 1994-2001, lo que habría contribuido a reducir la tasa de paro en unos 2,87 puntos porcentuales.

  4. Variabilidad genética según RAPD de árboles de guayabo 'Media China' procedentes de cuatro plantaciones y su respuesta morfológica a baja disponibilidad de nutrimentos

    Directory of Open Access Journals (Sweden)

    J. L. Domínguez Álvarez

    2005-01-01

    Full Text Available En la presente investigación se evaluó la variabilidad molecular y morfológica mediante marcadores tipo RAPD’s (Polimorfismos en el ADN Amplificados al Azar, de plantas de guayabo (Psidium guajava L. ‘Media China’ derivadas de semilla y sometidas a baja disponibilidad de Fe y Zn. Se establecieron asociaciones entre diecisiete caracteres morfológicos y 49 loci RAPD’s y la respuesta de las plantas al estrés nutrimental, mediante análisis de agrupamiento empleando el NTSYS, DARwin y χ2. El análisis de los patrones RAPD’s obtenidos de una muestra de 82 plantas indicó la existencia de variabilidad genética entre las mismas. De un total de 49 loci evaluados el 96 % fueron polimórficos, con un índice de diversidad promedio igual a 0.744. El análisis comparativo de la eficiencia de los marcadores RAPD’s derivados de 82 plantas contra marcadores morfológicos obtenidos de 72 plantas para definir y diferenciar grupos de genotipos con y sin síntomas de deficiencia de Fe y Zn, indicó que los marcadores RAPD’s son más eficientes para tal propósito. Los grupos de plantas sin síntomas se asociaron con la presencia de los loci RAPD’s A20-4, A20-2 y A20-1, con un peso molecular de 0.85, 1.4 y 1.6 kb y una frecuencia de 86.5, 78 y 89 %, respectivamente; mientras que la característica común para las plantas con síntomas fue la presencia de una banda A03-3, de 1.3 kb y una frecuencia de 74 %. Por la asociación de tres loci y el caracter ausencia de síntomas, se infiere que este caracter es poligénico, determinado por el efecto combinado de las bandas A20- 4, A20-2 Y A20-1, es necesaria esta combinación para la definición de los grupos sin síntomas por deficiencia de Fe y Zn. Al calcular la correlación, se encontró una asociación no significativa, con una r = 0.05743. Cuando el análisis se realizó integrando los dos tipos de marcadores en una sola matriz y utilizando el coeficiente χ2, no se encontró separación entre los grupos con y sin síntomas de deficiencia y el promedio de distancias para los RAPD’s fue de 8.09, con una varianza de 3.87; mientras que para los caracteres morfológicos la distancia promedio fue de 0.15 y la varianza de 0.4. Lo anterior confirma la eficiencia mayor de los marcadores RAPD’s para detectar variabilidad genética con relación a los marcadores morfológicos; también sugiere que los cambios que ocurren al nivel del genoma no siempre se corresponden con cambios en el fenotipo de la planta y es posible plantear que aun cuando la correlación detectada entre ambos tipos de marcadores es baja, es recomendable su evaluación simultánea dado que son complementarios: los marcadores RAPD’s son buenos descriptores de la variabilidad a nivel del genoma, mientras que la variabilidad morfológica permite conducir mejor el proceso de selección visual del fenotipo y presenta la ventaja de una mayor accesibilidad

  5. La ocupación paleolítica en los páramos del Duero. Nuevos datos procedentes de Valdecampaña (Olivares de Duero, Valladolid

    Directory of Open Access Journals (Sweden)

    Fernando DÍEZ MARTÍN

    2009-08-01

    Full Text Available RESUMEN: En este artículo se presentan los recientes trabajos de excavación arqueológica y de interpretación sedimentaria y kárstica que, junto a otros de prospección y documentación en superficie, se han acometido recientemente en el páramo de Valdecampaña (Olivares de Duero, Valladolid. El estudio llevado a cabo en Valdecampaña se enmarca dentro de un amplio proyecto de investigación de arqueología del paisaje que, desde 1996 y de forma continuada, estamos abordando en los páramos del Duero con el objetivo de ampliar nuestro conocimiento sobre la presencia paleolítica en estas planicies. En primer lugar, el estudio de las columnas estratigráficas de cuatro formaciones exokársticas nos ha permitido ampliar de forma considerable los conocimientos sobre la génesis del karst establecido en los páramos del Duero desde comienzos del Cuaternario, aporta datos de relevancia para la reconstrucción de las condiciones paleoambientales de estos entornos durante el Pleistoceno y permite enmarcar la presencia humana en estos ecosistemas alternativos a los cercanos ambientes fluviales. En segundo lugar, la excavación de la dolina denominada Valdecampaña 4 ha permitido, por primera vez en los páramos terciarios del Duero, y tras más de una decena de intervenciones dedicadas a este fin, documentar la existencia de materiales líticos en niveles no alterados por la acción mecánica del arado. Las características del conjunto lítico se enmarcan dentro de los rasgos ampliamente observados a lo largo de los páramos del Duero. La datación por TL de una cuarcita termoalterada ofrece una fecha de 143464 ± 10827 BP para este conjunto y aporta un referente cronológico para la ocupación paleolítica en estas plataformas precuaternarias que, a la luz de éstos y otros datos cronológicos, debe situarse en el tránsito Pleistoceno medio/superior y estar ligado al modelo de ocupación neandertal.ABSTRACT: In this paper, the results of an archaeological excavation, and the sedimentary and karstic studies carried out on the Valdecampaña plateaus (Olivares de Duero, Valladolid are introduced. The fieldwork undertaken in the Valdecampaña area is situated in the framework of a long-term landscape archaeology research project carried out since 1996 on the river Duero Tertiary plateaus. This project has the main goal of understanding the Palaeolithic occupation on these tablelands adjacent to the river Duero. Firstly, the analysis of the stratigraphic columns in four exo-karstic formations enlarges our present knowledge on karst genesis in the Duero plateaus, offers fresh data on the Pleistocene palaeo-environmental conditions in this area, and allows introducing a framework for the human presence in this particular ecosystem, alternative to the nearby fluvial contexts. Secondly, the excavation of the sinkhole known as Valdecampaña 4 has allowed, for the first time in the Duero Tertiary plateaus and after more than ten text-excavations devoted to fulfil this goal, to document a lithic aggregate preserved in levels non-disturbed by ploughing. The techo-typological traits of the lithic assemblage are similar to those already observed in the surface collections retrieved on the Duero platforms. TL dating of a burnt quartzite brackets this assemblage to 143464 ± 10827 BP, and offers a chronological framework for the Palaeolithic human occupation in this region. In line with the dating furnished by TL in this and other sites of these highlands, human occupation of the Duero plateaus must be situated during the Middle/Upper Pleistocene interface and, therefore, can be linked to the Neanderthal occupational models.

  6. Contenido de vitamina C en frutos de camu camu Myrciaria dubia (H.B.K) Mc Vaugh, en cuatro estados de maduración, procedentes de la Colección de Germoplasma del INIA Loreto, Perú

    OpenAIRE

    Sixto Imán Correa; Luz Bravo Zamudio; Víctor Sotero Solís; Carlos Oliva Cruz

    2011-01-01

    El objetivo del presente trabajo, fue determinar el contenido de vitamina C en diferentes partes d el fruto; pulpa, cáscara y pulpa más cáscara, en cuatro estados de maduración: verde, pintón, maduro y sobremaduro. Los frutos fueron obtenidos de la Colección de Germoplasma de la Estación Experimental Agraria San Roque del INIA Loreto, Perú. La técnica u tilizada para la determinación de contenido de vitamina C fue Cromatografía Líquida de Alta Eficiencia (HPLC) con columna de fase reversa. Lo...

  7. Experience the declassification of radioactive waste from Spanish nuclear power plants as an alternative route of administration; Experiencia de la desclasificacion de los residuos radiactivos procedentes de Centrales Nucleares Espanolas como alternativa de via de gestion

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Gomez, M. A.; Gonzalez Crespo, M.

    2011-07-01

    During the operation of the plants generated several slightly contaminated materials that can be managed conventionally by declassification. Declassification activity is incorporated into the Waste Management Plan of each plant considered a {sup g}ood practice{sup .} However experience to date demonstrates that there are difficulties to carry out the practice.

  8. AVALIAÇÃO PARASITOLÓGICA EM LACTUCA SATIVA (ALFACE E BRASSICA OLERACEA L. (COUVE PROCEDENTES DA CEASA NO MUNICÍPIO DE ANÁPOLIS – GO

    Directory of Open Access Journals (Sweden)

    Léa Resende Moura

    2016-06-01

    Full Text Available Objective: To investigate the occurrence of intestinal parasites of interest to health in vegetables sold in Central de Abastecimento de Goiás S.A (CEASA in the city of Anapolis (GO. Methods: 42 samples of lettuce and cabbage were collected during the second half of January 2012 and submitted to the spontaneous sedimentation technique. Results: There were 11.9% and 14.2% of samples of lettuce and cabbage contaminated respectively. Conclusions: The most prevalent enteroparasites were Endolimax nana (lettuce: 19% and cabbage: 14.2%, Entamoeba coli (lettuce: 0 % and cabbage: 9.2% and Ascaris lumbricoides (lettuce: 4.7% and cabbage: 0 %. Possibly the lack of supervision for observance of compliance with standards for implementation of marketing within the CEASAAnapolis (GO promotes non-compliance with such rules and compromises the quality of products.

  9. Determination of bitumen and rubber content in bituminous mixes containing crumb tyre rubber; Determinacion del contenido de betum y de caucho en las mezclas bituminosas que incorporan plvo de caucho procedente de neumaticos fuera de uso

    Energy Technology Data Exchange (ETDEWEB)

    Rubio Guzamn, B.; Jimenez Saez, R.

    2009-07-01

    In recent years the use of crumb rubber from scrap tyres as a component of hot bituminous mixes for road construction, has been officially promoted by the Public Administration in Spain, by issuing several publications of both informative and normative nature, aimed to spread knowledge and experiences on the subject and also to specify the requirement and regulate the working applications for this material. However, it also seems necessary to develop new test methods which, allows control of the rubber content in crumb rubber-added mixes, regardless of the process (wet or dry) followed for the mix production. This article describes a procedure reliable enough to determine both the soluble bituminous binder and the rubber contents in bituminous mixes based on two combined, previously standardized test methods: binder extraction with solvent and ignition. (Author) 7 refs.

  10. Presencia de Listeria monocytogenes en alimentos listos para el consumo, procedentes de plazas de mercado y delicatessen de supermercados de cadena, Bogotá, D.C, 2002-2008

    Directory of Open Access Journals (Sweden)

    Ana Isabel Muñoz

    2011-03-01

    Conclusión. Los resultados indican que estos alimentos son vehículos de transmisión del microorganismo, convirtiéndolos en potenciales alimentos de alto riesgo; deben ser vigilados y controlados por la autoridad competente. Se requieren programas para implementar la normativa sobre vigilancia, reducción y control de este microorganismo con miras hacia la prevención de las enfermedades transmitidas por alimentos.

  11. Calendario de vacunación en los nuevos médicos residentes procedentes de Perú: Hospital Universitario Ramón y Cajal Vaccine schedule in new resident physicians from Peru: Ramon y Cajal University Hospital

    Directory of Open Access Journals (Sweden)

    Gian C. Navarro Chumbes

    2011-03-01

    Full Text Available Introducción: En los últimos años España se ha convertido en un país receptor de inmigrantes y el personal sanitario no es una excepción. Al momento de valorar el estado vacunal de los médicos residentes de inicio es importante tener en cuenta su procedencia. Objetivo: Realizar una revisión sobre la vacunación existente en el Perú, antecedentes y seroprevalencia de las patologías inmunoprevenibles en el personal sanitario peruano; y en base a lo encontrado determinar las pautas de vacunación a seguir en caso no se aporte documentación de vacunación previa para aquellos médicos residentes de inicio que provengan del Perú. Material y Métodos: Revisión bibliográfica. Resultados: Los datos encontrados sugieren que no existe evidencia que nos indique una correcta pauta de vacunación en los médicos residentes que proceden de Perú. Conclusiones: A todo médico residente de inicio proveniente de Perú que no aporte cartilla de vacunación se le procederá a vacunar como si fuese un adulto no vacunado, siempre teniendo en cuenta que si existe documentación de dosis previas se completarán las pautas sin reiniciar o repetir las dosis.Introduction: In recent years, Spain has been receiving immigrants of all working sectors and health staff is not an exception. When evaluating a vaccine schedule of first year resident physicians, it is important to know where they are arriving from. Objective: Make a review about vaccination in Peru, background and seroprevalence of immunopreventable pathology in Peruvian health staff; and bearing in mind the information, determine a vaccine schedule for first year resident physicians from Peru whose information is not available because they do not have previous vaccination documents. Method and materials: We made a bibliographic review. Results: The information obtained suggests that there is no evidence of correct vaccination in first year resident physicians from Peru. Conclusions: All first year resident physicians from Peru who do not have vaccination documents will be vaccinated as if they were a non vaccinated adult. We will always bear in mind that if there is any document about previous doses, we will continue without beginning or repeating doses.

  12. Estudo comparativo da leishmaniose tegumentar americana em crianças e adolescentes procedentes das áreas endêmicas de Buriticupu (Maranhão e Corte de Pedra (Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Costa Jackson M.L.

    1998-01-01

    Full Text Available Analisou-se o comportamento da LTA em crianças e adolescentes na faixa etária de 0-15 anos, provenientes das áreas endêmicas de Buriticupu (MA e Corte de Pedra (BA. Nestas regiões, foram cadastrados 214 pacientes no periodo de 1982 a 1993, sendo 78 (36,4% oriundos de Corte de Pedra e 136 (63,6% de Buriticupu. Em Corte de Pedra a faixa etária predominante foi de 0-5 anos com 29 (37,2% casos. Destes, 62% pertenciam ao sexo masculino. Na região de Buriticupu, 88 (64,7% casos ocorreram na faixa etária de 11-15 anos, sendo 73,8% do sexo masculino. Nas regiões estudadas, houve predomínio da cor parda com 65,4% em Corte de Pedra, e 75% em Buriticupu. Vinte e seis (33,3% crianças provenientes de Corte de Pedra eram lavradores, sendo o sexo masculino maioria (57,7%, existindo diferença estatística significante (c2 = 11,21 p = 0,05. Vinte e um (80,8% casos da ocupação lavrador pertenciam a faixa etária de 11-15 anos. Em Buriticupu 37,5% das crianças eram estudantes, destes 30,2% foram lavradores, todos do sexo masculino (c2 = 32,3 p = 0,05. A maioria dos lavradores, 39 (44,3% casos eram da faixa etária de 11-15 anos. Tanto em Buriticupu como Corte de Pedra houve predomínio da lesão única, 57,7% e 53,7% dos casos, respectivamente. A duração das lesões destacou-se no período de 1 a 3 meses, com 54 (69,2% casos em Corte de Pedra e 83 (61% em Buriticupu (c2 = 11,82 p = 0,05. Quanto a localização das lesões, observou-se que nas duas regiões estudadas os MMII foram predominantes com 58,9% em Corte de Pedra e 77,2% em Buriticupu (c2 = 27,9 p = 0,05, havendo maior ocorrência de lesão ulcerada nas duas regiões. IDRM foi positiva em 61 (78,2% crianças provenientes de Corte de Pedra, não havendo diferença estatística significativa entre as faixas etárias e a positividade do teste (c2 = 0,0669 p = 0,05.

  13. Plan de negocio para una empresa importadora de bisutería a base de cristal y similares procedente desde China, y comercializada en la Ciudad de Guayaquil (Parroquia Tarqui)

    OpenAIRE

    Ávila Chávez, Bella

    2012-01-01

    Con la globalización y la eliminación gradual de las barreras y fronteras al comercio entre los países, se han ido explorando nuevas y diversas formas de estar involucrado en este mercado importador de bisutería. Debido a lo anterior, existe un problema claramente identificado en el mercado de bisutería en la Parroquia Tarqui de la Ciudad de Guayaquil. Dicho problema se resumen en no tener al momento en esta zona un lugar donde comprar piezas de bisuterías, nuevas, modernas y d...

  14. Sludge composting of waste water treatment plant. Compost plant of Vila-Seca (Tarragona); Compostaje de lodos procedentes de la depuracion de aguas residuales. Planta de compostaje de Vila- Seca

    Energy Technology Data Exchange (ETDEWEB)

    Marza Brillas, J.

    1995-12-01

    Composting is a very effective process in waste treatment. Very good results are obtained in mass and volume loss, moisture reduction, organic matter establization as well as making possible agricultural uses for the final product. Some parameters as nutrients (C/N ratio), pH, temperature and oxygen content are pointed as the most important for the process. Some composting systems are mentioned but finally tunnel system is shown as the best. Its great advantage is that measurements from main parameters are given continuously to the control computer, so process optimization is done at the moment. The Vila-Seca sludge composting plant is described. This plant can treat 30.000 tones/year from three water treatment plants. The expected 50% on organic matter reduction and 70% on dry matter content has been achieved after only 3 months since its starting up. Finally, in september 1995 will start the construction of another sludge composting plant were the same technology, belonging to GICOM and represented by G.T.R. in Spain, will be installed.

  15. Estudio de la influencia de la superfície específica de los materiales reciclados procedentes de RCDS, en la medida del impacto ambiental a través de procesos de lixiviación

    OpenAIRE

    Sarmiento Mantilla, Adriana Carolina

    2011-01-01

    Desde la perspectiva ambiental, la peligrosidad de un elemento no siempre obedece a la cantidad total presente de este en un residuo, sino a la movilidad o capacidad de disolverse en contacto con agua y otras sustancias. Esta capacidad de lixiviar está determinada por parámetros químicos, ambientales y físicos, y entre estos últimos el tamaño de partícula y su superficie específica. Mediante este trabajo se pretende analizar la variabilidad de los compuestos lixiviados y su comportam...

  16. Evaluación de los aportes de nitrógeno y fósforo al medio procedentes del engorde intensivo de pulpo común (Octopus vulgaris Cuvier)

    OpenAIRE

    Mazón Moya, María José

    2006-01-01

    Presentado como requisito parcial para la obtención del Tí­tulo de Máster Universitario Internacional en Acuicultura, otorgado por la Universidad de Las Palmas de Gran Canaria (ULPGC), el Instituto Canario de Ciencias Marinas (ICCM), y el Centro Internacional de Altos Estudios Agronómicos Mediterráneos de Zaragoza (CIHEAM)

  17. Estudio arqueométrico comparativo de muestras de pinturas con azul egipcio, procedentes de la tumba de Nefertari siglo XIII a.C. y del Balneum, termas romanas, siglos I a.C., I d.C.

    Directory of Open Access Journals (Sweden)

    Criado Portal, A. J.

    2011-06-01

    Full Text Available In the present work have studied two samples with the same pigment, Egyptian Blue, but from different sources. The difference between them is caused by the functionality. In the case of Nefertari´s tomb is decorating interior rooms carved into rock in which they would not suffer any damage since it does not accessed to that place anymore. In the case of Balneum´s baths is decorating very warm and humid rooms, and should resist deterioration resulting from human activity during the use of these baths.

    En el trabajo presentado se han estudiado dos muestras de pinturas con el mismo pigmento, azul egipcio, de distinta procedencia. Las diferencias entre ellas vienen causadas por la funcionalidad. En el caso de la tumba de Nefertari se trata de decorar estancias interiores excavadas en roca en las que no sufrirían deterioro alguno, dado que no se accedería a ese lugar nunca más. En el caso del Balneum se trata de pinturas que decoran ambientes muy húmedos y cálidos y que, además, deben resistir el deterioro derivado de la actividad humana en dichas termas.

  18. Study of the in-situ thermal transformations of Limonite used as pigment coming from Peru; Estudio in-situ de la transformacion termica de limonita utilizada como pigmento procedente de Peru

    Energy Technology Data Exchange (ETDEWEB)

    Romero-Gomez, P.; Gonzalez, J. C.; Bustamente, A.; Ruiz-conde, A.; Sanchez-Soto, P. J.

    2013-06-01

    It has been performed a kinetic study of the thermal transformation of Limonite [FeO(OH).nH{sub 2}O] by thermal gravimetric analysis (TGA), thermal X-ray Diffraction (XRD) and {mu}-Raman spectroscopy. The mineral was extracted from the Taraco District, Huancane Province, Puno region (Peru). Powdered XRD identify goethite phase as the main mineralogical component besides quartz. It was subjected to in-situ thermal treatment in the range of temperatures 100 to 500 degree centigrade in air and an inert atmosphere (nitrogen). The goethite phase remains stable from room temperature until 200 degree centigrade. From 250 degree centigrade there is a phase transformation {alpha}-FeO(OH) {yields}{alpha}-Fe{sub 2}O{sub 3} with 8 wt % weight loss and a chromatic change, i.e., the change of the hydroxylated goethite phase (yellow) to oxided hematite phase (red), as evidenced by the TGA and evolution of the XRD profiles. Moreover, the {mu}-Raman spectra of the in-situ thermal treatment corroborate that there is a transition at 290 degree centigrade by the transformation of the characteristic Raman bands of the goethite to hematite phase, in the frequency range from 200 to 1800cm{sup -}1. (Author) 11 refs.

  19. Características morfométricas, genéticas, alimenticias y vectoriales de Panstrongylus herreri procedentes de Jaén (Cajamarca y Cajaruro (Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Jenny Ancca

    2008-01-01

    Full Text Available Objetivo. Comparar las características morfológicas, alimenticias y genéticas de dos poblaciones de Panstrongylus herreri, de los distritos de Jaén (Cajamarca y Cajaruro (Amazonas. Materiales y métodos. Se colectó especímenes adultos de P. herreri, 42 (Jaén y 68 (Cajaruro. Se utilizó la morfometría geométrica para evaluar el dimorfismo sexual de tamaño y conformación. El perfil genómico se realizó por amplificación del espaciador interno transcrito del ADNr (ITS-2. La amplificación del espaciador intergénico del gen mini-exón, permitió la caracterización molecular de los trypanosomas aislados. Se utilizó la prueba de precipitina para conocer las fuentes de alimentación de los vectores y así poder asociarlos a posibles reservorios del parásito. Resultados. El análisis morfométrico demostró que el dimorfismo sexual de tamaño fue similar (p>0,05; no ocurrió lo mismo con el dimorfismo de la conformación; asimismo no se encontró diferencias de tamaño al comparar por separado hembras y machos de Jaén y Cajaruro. Por ITS-2, se evaluó cinco especímenes de cada distrito, en ellos se observó una banda de 960 pb aproximadamente. Sólo en Cajaruro se encontraron triatominos parasitados, que fue caracterizado como Trypanosoma cruzi TCI (350 pb. Se identificó al cobayo como la fuente de alimento más frecuente. Conclusiones. Ambas poblaciones de P. herreri por morfometría geométrica e ITS-2, no evidenció diferencias, indicando que se trataría de una misma población y por consiguiente de la misma procedencia. La sangre de cobayo fue la más frecuente fuente de alimento, pudiendo ser el principal reservorio para la enfermedad de Chagas en esta zona del Perú.

  20. Relación de la fijación de nitrógeno y la producción de auxinas en cepas de Gluconacetobacter diazotrophicus procedentes de diferentes cultivos

    Directory of Open Access Journals (Sweden)

    Marcia M. Rojas

    2009-01-01

    Full Text Available Se determinó la capacidad de fijar nitrógeno mediante la actividad reductora de acetileno para 8 cepas de G. diazotrophicus aisladas de diferentes ecosistemas empleando el medio LGI-P. Además, se determinó la producción de auxinas a través del método de Salkowski y se analizó la influencia del aminoácido triptófano y del AIA en la actividad de la nitrogenasa. El triptófano, al igual que otros aminoácidos y las diferentes concentraciones de AIA, inhiben en distinta medida la actividad de la enzima solo parcialmente. Se demostró que las condiciones de nitrofijación no afectan la producción de AIA en esta bacteria. Esta relación entre ambas capacidades fisiológicas beneficiosas para los cultivos agrícolas pudiera tener gran importancia ya que pueden desarrollarse paralelamente, y potenciar la acción beneficiosa hacia la planta, basada en la dinitrofijación y la producción de auxinas estimuladoras del crecimiento vegetal. The capacity to fix nitrogen of 8 strains of G. diazotrophicus from different ecosystems was determined by acetylene reduction assay using LGIP medium. Moreover, auxins production was determined by Salkowski’s method and the influence of triptophan and indoleacetic acid (IAA in the nitrogenase activity were analyzed. The triptophan as other aminoacids and different concentrations of IAA, inhibit at different levels the nitrogen fixation only partially. There were demonstrated that the nitrogen fixation conditions do not affect the auxins production of this bacteria. This relationship between both crop beneficial physiological capacities should be a great importance since they may be parallely developed, and enhance the beneficial action to the plant, based on dinitrogen fixation and stimulating plant growth auxins production.

  1. Función diastólica en sujetos con serología positiva para enfermedad de Chagas procedentes del estudio CHICAMOCHA Diastolic function in subjects with positive Chagas’ disease serology from the Chicamocha study

    Directory of Open Access Journals (Sweden)

    Ángel M Chaves

    2006-10-01

    Full Text Available Se presenta un estudio ecocardiográfico en 430 donantes de banco de sangre, de los cuales 120 fueron negativos para Trypanosoma cruzi (controles, 231 fueron seropositivos sin cambios en el electrocardiograma (estadio I y 79 fueron seropositivos con cambios en el electrocardiograma (estadio II. Se estudió la función diastólica y, a través del flujo mitral, se encontró un aumento significativo de la velocidad de la onda A con relación al grupo control (54 vs. 50,5 cm/seg. Con relación al flujo de las venas pulmonares, no hubo cambios significativos en las velocidades sistólicas pero sí aumento de las velocidades diastólicas de los sujetos estadio II con relación a los controles (48,7 vs. 46,7 cm/seg. El parámetro más significativo se halló en la duración de la onda A de las venas pulmonares, la cual aumentó en los sujetos estadio I y mucho más en los sujetos estadio II (0,13 seg para el grupo control, 0,14 seg para el grupo estadio I y 0,15 seg respectivamente. La diferencia entre la duración de la onda A mitral y la duración de la onda A de las venas pulmonares, mostró menor significancia en los sujetos estadio I y mayor aún (resultado negativo en los sujetos estadio II, expresando así un aumento de la presión capilar pulmonar de estos últimos (control 0,012 seg, estadio I 0,009 seg y estadio II-0,007. La relación entre la duración de la onda A de las venas pulmonares y de la onda A mitral (Ap/Am, mostró, igualmente, un aumento progresivo con respecto a los controles (control 0,94, estadio I 0,96 y estadio II 1,08. El tiempo de relajación isovolumétrica aumentó significativamente en los sujetos estadio II con relación al grupo control (0,084 seg vs. 0,076 seg. En lo que concierne a las velocidades del anillo mitral, se encontró un aumento significativo en la velocidad de la onda A en los sujetos estadio II con respecto a los controles (17,9 cm/seg vs. 15,9 cm/seg. No hubo diferencias significativas en la velocidad sistólica ni en la velocidad de la onda E del anillo. Cuando se observó el comportamiento de la propagación de flujo M-color, se encontró una disminución significativa en los sujetos estadio I y más aún en los sujetos estadio II con relación a los controles (72,7; 66,8 y 62,6 cm/seg respectivamente.An echographic study of 430 blood bank donors is presented. 120 were negative for Trypanosoma cruzi (controls, 231 were serum-positive without changes in the electrocardiogram (state I and 79 were positive with electrocardiographic changes (state II. The diastolic function was studied and through the mitral flow a significant increase in the A wave velocity in relation to the control group, was found (54 vs. 50.5 cm/s. In relation to the pulmonary veins’ flow, there were no significant changes in the systolic velocities but there was an increase in the diastolic velocity in state II subjects (48.7 vs. 46.7 cm/s. The most signifying parameter was that of the pulmonary veins’ A wave duration, that increased in state I subjects and even more in state II subjects (0.13 s for the control group, 0.14 s for state I group and 0.15 s for state II, respectively. The difference between the duration of the mitral A wave and the duration of the pulmonary veins’ A wave showed less significance in state I subjects and even less (negative in state II subjects, expressing in this way an increment in pulmonary capillary tension in these last ones (control: 0.012 s, state I: 0.09 s and state II: 1.08 s. The relation between the pulmonary veins’ A wave and that of the mitral A wave (Ap/Am showed a progressive increment as well, in regard to the control group (17.9 cm/s vs. 15.9 cm/s. There were no significant differences in the systolic velocity, or in the velocity of the E ring wave. When observing the M-colour flow propagation behaviour, a significant decrease was noticed in state I subjects and even more in state II subjects in relation to the control group (72.7, 66.8 and 62.6 cm/s respectively.

  2. Nutritional quality of the seed oil in thirteen Asphodeline species (Xanthorrhoeaceae) from Turkey; Calidad nutricional del aceite de semilla de trece especies Asphodeline (Xanthorrhoeaceae) procedentes de Turquía

    Energy Technology Data Exchange (ETDEWEB)

    Zengin, G.; Aktumsek, A.; Giron-Calle, J.; Vioque, J.; Megias, C.

    2016-07-01

    The fatty acid composition of the seed oil from 13 Turkish Asphodeline species was analyzed. The seed oil content ranged between 0.9% and 4.6%, and included 26 different fatty acids from C12:0 to C22:5. The most abundant saturated, monounsaturated, and polyunsaturated fatty acids were C16:0 (5.7% to 23.7% of their total fatty acid content), C18:1ω9 (11.3% to 30.3%), and C18:2ω6 (49.2% to 66.1%). A. tenuior subsp. tenuiflora, which had the highest content of unsaturated fatty acids, also had the best fatty acid profile from a nutritional point of view. Asphodeline seed oil composition was similar to that of local, related vegetables such as onion seeds. Asphodeline species, which are most frequently grown to use the leaves in salads, may also be a good source of seed oil with good nutritional properties. Results of a cluster analysis using data on the fatty acid composition are consistent with the taxonomic classification of genus Asphodeline. [Spanish] Se ha analizado la composición en ácidos grasos del aceite de las semillas de 13 especies deAsphodeline de Turquía. El contenido en aceite de las semillas osciló entre el 0.9% y el 4.6% e incluyó 26 ácidos grasos distintos entre C12:0 y C22:5. Los ácidos grasos saturados, monoinsaturados y poliinsaturados más abundantes fueron C16:0 (5.7% a 23.7%), C18:1ω9 (11.3% a 30.3%) y C18:2ω6 (49.2% a 66.1%). A. tenuior subsp. tenuiflora, que presentó el contenido más alto en ácidos grasos insaturados, también enía el mejor perfil en ácidos grasos desde un punto de vista nutricional. La composición del aceite de las semillas de Asphodeline fue similar a la de vegetales relacionados como la cebolla. Asphodeline, cuyas hojas son consumidas en ensaladas, puede representar también una buena fuente de aceite de las semillas con buenas propiedades nutricionales. Los resultados del análisis de grupos usando los datos de la composición en ácidos grasos son consistentes con la clasificación taxonómica del género Asphodeline.

  3. Variedades de batatinha (Solanum tuberosum L. procedentes da Holanda: parte II - resultados experimentais da segunda plantação, no país, com tubérculos importados em 1947

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1948-12-01

    Full Text Available This paper presents the results obtained from six replicated experimental plantings of Irish potatoes in the State of São Paulo, Brazil. The potatoes tubers employed as seed in these test plantings were selected from the crop produced from the original tubers introduced from Holland in 1947. The results obtained from plantings in February 1947 made of the original seed pieces were the subject of a previous publication. The current tests reported herein were carried out in the same areas as those previously reported. The date of the second planting was, September 1947 and the second crop was harvested in February and March of 1948. The results obtained from the second plantings were similar to those secured from the original tests. Phytopthora infection was prevailent and caused considerable damage to the Eersteling and Saskia varieties while the Alpha and Voran varieties appeared to have appreciably more resistance. Under the conditions tested, the Eersteling, Saskia, Doré, and Geelblon were found to be early maturing varieties, while Alpha, Voran, and Libertas, were late maturing varieties. The highest average yields per hectar were 16 tons with the variety Eigenheimer and 12.4 tons with the variety Bintje. The yields obtained from the second plantings were greater than those obtained from the first plantings. This difference in yield has been attributed to the more favorable distribution of rain in the second growing season.

  4. Variedades de batatinhas (Solanum tuberosum L. procedentes da Holanda: Parte I - Resultados experimentais da primeira plantação, no país, com tubérculos importados em 1947

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1948-12-01

    Full Text Available The author reports the results of six experiments with eight yellow fleshed potato varieties from Holland, conducted at six different locations in the State of São Paulo. Time of planting was February-March, less favorable than August-September, because of climatic conditions during the growth period (somewhat dry weather. For this reason, yields were not good. Observations were made on development; resistance, precocity and production of varieties, as well as specific gravety of tubers. Under the conditions of the experiments the varieties Voran and Alpha were the least susceptible to Phytpphthora while Eersteling, and Saskia were the most susceptible. The Doré, Eersteling, Saskia and Geelblon were found to be early maturing varieties while Alpha, Voran and Libertas were late maturing varieties. The varieties Eigenheimer and Bintje revealed themselves the better yielders, with about 7.3 metric tons of tubers per hectare. Yields of next experiments, conducted at September-October, are expected to be better.

  5. Biosecuestro de dióxido de carbono, procedente de gases de combustión, por Arthrospira jenneri “espirulina” y su influencia en la producción de biomasa microalgal en fotobiorreactor solar

    OpenAIRE

    Seijas Bernabé, Priscilla Alexandra

    2012-01-01

    The present investigation aims to reduce carbon dioxide emissions from combustion gases through CO2 sequestration by the microalga “spirulina” also producing biomass, employing a solar tubular photobioreactor designed through optimization of process production. It’s prepared the inoculum, which was initially grown in growth chambers 10 of 250 mL each; the culture contained as substrate 2% “vinasa”. After experimental system was implemented: Stationary combustion system of CO2, which consisted...

  6. Uranium Determination in Samples from Decommissioning of Nuclear facilities Related to the First Stage of Nuclear Fuel Cycle; Determinacion de Uranio en Muestras Procedentes del Desmantelamiento de Instalaciones de la Primera Parte del Cielo del Combustible Nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, A; Correa, E; Navarro, N; Sancho, C [Ciemat, Madrid (Spain); Angeles, A

    2000-07-01

    An adequate workplace monitoring must be carried out during the decommissioning activities, to ensure the protection of workers involved in these tasks. In addition, a large amount of waste materials are generated during the decommissioning of nuclear facilities. Clearance levels are established by regulatory authorities and are normally quite low. The determination of those activity concentration levels become more difficult when it is necessary to quantify alpha emitters such as uranium, especially when complex matrices are involved. Several methods for uranium determination in samples obtained during the decommissioning of a facility related to the first stage of the nuclear fuel cycle are presented in this work. Measurements were carried out by laboratory techniques. In situ gamma spectrometry was also used to perform measurements on site. A comparison among the different techniques was also done by analysing the results obtained in some practical applications. (Author)

  7. Measurement methodology of vegetable samples from an area affected by residual contamination due to uranium mining sterile; Metodologia de medida de muestras vegetales procedentes de un terreno afectado por contaminacion residual debida a esteriles de mineria de uranio

    Energy Technology Data Exchange (ETDEWEB)

    Navarro, N.; Suarez, J. A.; Yague, L.; Ortiz Gandia, M. I.; Marijuan, M. J.; Garcia, E.; Ortiz, T.; Alvarez, A.

    2013-07-01

    This paper presents the methodology established for radiological characterization of plant material generated during the first stage of the realization of a movement of land in an area of land affected by residual contamination due to the burial of sterile of uranium mining. (Author)

  8. Análisis y modelado del comportamiento de lixiviación de metales de sedimentos contaminados en contacto con fugas de CO2 procedentes de sistemas de captura y almacenamiento de carbono (CAC)

    OpenAIRE

    Payán Fraile, María de la Cruz

    2013-01-01

    RESUMEN: La Captura y Almacenamiento de Carbono (CAC)es una técnica objeto de intensivo estudio por la comunidad investigadora internacional debido a su potencial para reducir los gases de efecto invernadero. Es importante evaluar las consecuencias de las potenciales fugas de CO2 de sistemas CAC en sedimentos y en el fondo marino. Los metales y contaminantes orgánicos se liberarían de sedimentos contaminados debido a la acidificación del agua de mar. El objetivo de esta tesis es generar conoc...

  9. Materiales vitrocerámicos a partir de lodos procedentes de una estación de depuración de aguas residuales urbanas (en la Ciudad de El-Sadat, Egipto

    Directory of Open Access Journals (Sweden)

    Garcia-Valles, M.

    2011-10-01

    Full Text Available Urban wastewater security is a source of significant volumes of sludge which is to be managed. This paper presents the possibility of applying a management process based on vitrification and by which, in addition to inert contaminants in sludge, you get a ceramic material with a significant added value. As a base of different analysis of the sludges, chemical (XRF, mineralogical (XRD and thermal (DTA-TG, we obtain the original glass composition and its energy. By DTATG, dilatometry and SEM, it was determined the temperature of maximum nucleation rate, growth temperature and the morphology and size of developed nuclei, in this case are nanoscale. Briefly, it was found as the management of municipal solid waste by vitrification as an alternative to landfills and incineration.

    La depuración de las aguas residuales urbanas es fuente de importantes volúmenes de lodos los cuales es preciso gestionar. En este trabajo se expone la posibilidad de aplicarles un proceso de gestión basado en la vitrificación y mediante el cual, además de inertizar los elementos contaminantes presentes en los lodos, se obtiene un material vitrocerámico con un importante valor añadido. Partiendo de la caracterización química (FRX, mineralógica (DRX y térmica (ATD-TG de estos lodos, se determina la formulación del vidrio original y su poder energético. Mediante ATD-TG, dilatometría y MEB, se ha determinado la temperatura de máxima velocidad de nucleación y la temperatura de crecimiento así como la morfología y tamaño de los núcleos formados que, en este caso, son nanométricos. En definitiva, se ha comprobado como la gestión de los residuos sólidos urbanos mediante la vitrificación es una alternativa a los vertederos y a la incineración.

  10. Extracción mediante un SOXTEC® de la materia grasa de algodones procedentes de diferentes áreas productoras. Comparación extracción con diclorometano o sucesivas diclorometano-metanol.

    Directory of Open Access Journals (Sweden)

    Martínez, Mª J.

    1997-08-01

    Full Text Available The paper compares the fatty matter recovered from cotton when applying one extraction with dichloromethane or two successive extractions (the first with dichloromethane and the second one with methanol, more polar and the time required for the operation when using SOXTEC® System HT2 or the usual Soxhlet. Results showed that it is convenient to make successive extractions of 1 hr and 30 minutes, respectively, with SOXTEC®. The fatty matter extracted was homogeneous, with independence of its origin. Before the analysis of pesticides, samples should be purified by gas chromatography (ECD or MS.

    El trabajo compara la recuperación de materia grasa de algodón con una única extracción con diclorometano o dos extracciones consecutivas (la primera con diclorometano y la segunda con metanol, más polar y el tiempo necesario para la operación utilizando SOXTEC® System HT2 y el Soxhlet convencional. El resultado indica que deben hacerse dos extracciones sucesivas de una hora y 30 minutos, respectivamente, en SOXTEX®. Ello representa una considerable reducción con respecto al Soxhlet. La grasa extraída es relativamente homogénea, con independencia del origen de la materia prima. Antes del análisis de los pesticidas, la muestra debe someterse a una purificación previa mediante cromatografía gaseosa (ECD ó MS.

  11. Application of aerobic porous fixed packed towers for biological treatment of canned food industrial wastewater; Utilizacion de la arcilla expandida como relleno en lechos sumergidos aireados para el tratamiento de aguas residuales procedentes de la industria conservera

    Energy Technology Data Exchange (ETDEWEB)

    Garrido Escudero, A.; Torres Rojo, J. C.; Tejera de Torres, M.; Hontaria, E.; Osorio Robles, F.; Sabater Redondo, C.

    2005-07-01

    The main objective is to check the performance of aerobic porous fixed packed towers technology heavy COD duty in canned food industrial wastewater among the Murcia Region (South East Spain). The porous media used was an expanded clay manufactured by Optiroc-Filtralite with grain sizes form 2-5 mm and 3-7 mm. Waste water used for experiments was a COD content of 4.300 mg/l. A pilot plants was built to treat wastewater flows from 101/h to 80 l/h. The volumetric loads checked were from 7 to 140 COD kg/m''3/day. Different tower configurations were tested. Process was designed with different steps (up to 8 different). The results obtained in the phase with better yields shows to a mean performance of 83.05% for COD elimination. The obtained results indicated clearly the feasibility of the treatment for the application of aerobic porous fixed packet with expanded clay media for these heavy duty waste water. (Author) 11 refs.

  12. Characterization of fly ashes from a municipal solid waste incinerator to explore its using in construction; Caracterizacion de cenizas procedentes de plantas de incineracion de residuos solidos urbanos para su posible utilizacion en construccion

    Energy Technology Data Exchange (ETDEWEB)

    Alaejos Gutierrez, M. P.

    2002-07-01

    The paper describes the physical and chemical characterization of fly ashes from municipal solid waste incinerator. The objective is to explore potential applications of this residue in construction products. The results show the no pozzolanic nature of the fly ashes, so its utilization as mineral admixture is discarded. however, the study reveals the expansive character of the fly ashes when are mixed with water. The results of X-ray diffraction confirm the presence of metallic aluminium in the fly ash as the origin of this expansion. This chemical reaction generates a considerable amount of hydrogen, inflammable gas. Three ways to avoid this reaction are proposed. On the other way, the expansive behaviour of the fly ashes allow to explore its possible application to produce cellular mortars, as the traditional production of these mortars have several similarities with the reaction of fly ash and water. (Author) 9 refs.

  13. Quantificação e classificação dos resíduos procedentes da construção civil e demolição no município de Pelotas, RS

    Directory of Open Access Journals (Sweden)

    Alessandra Buss Tessaro

    Full Text Available A construção civil é um dos setores econômicos de maior impacto no meio ambiente. Entre os impactos causados por essa atividade, pode-se citar o elevado volume de resíduos gerados, que, na maioria dos municípios brasileiros, são depositados irregularmente, intensificando os problemas de saneamento nas áreas urbanas. Em virtude disso, algumas ações vêm sendo tomadas pelo Governo Federal, entre as quais se pode citar a criação de uma resolução que estabelece a elaboração e implantação de um plano integrado de gerenciamento de resíduos da construção civil com base nas características de cada região. O objetivo do presente artigo é apresentar os resultados do diagnóstico qualitativo e quantitativo da produção de resíduos de construção e demolição (RCD no município de Pelotas-RS, elaborado com o auxílio de um software. O diagnóstico final resultante da pesquisa foi que são produzidos diariamente no referido município 315,08 m³ de RCD a uma taxa de geração per capita de 1,23 kg/hab.ano. A densidade dos RCD encontrada foi de 1,28 ton/m³, e a composição gravimétrica mostrou que 88% dos RCD produzidos referem-se aos resíduos classe A, os quais tem grande potencial para reutilização e reciclagem.

  14. Application of urban waste water sludge in revegetation of sanitary landfills; Aplicacion de lodos de depuradora procedentes de aguas residuales urbanas en la revegetacion de vertederos de RSU (II)

    Energy Technology Data Exchange (ETDEWEB)

    Ingelmo Sanchez, F.; Garcia Camarero, J.; Morenilla Martinez, J. J.; Bernacer Bonora, I.; Herrero Chamorro, O.; Amores Blasco, S.

    2000-07-01

    The use of forest soil for re vegetating sealed urban landfills is a practice leading to economic and environmental problems. Recently, it has been demonstrated a suitable technique for minimizing soil needs in the re-vegetation of a closed urban landfill which, the layer of fertile soil usually added for plants to settle and develop in such degraded substrate is replaced by a layer of the degraded soil amended with urban anaerobic sewage sludges. In this work we expose the firsts results of a pilot project for the re-vegetation with this procedure of a closed landfill of municipal solid wastes managed by the company Gestion Integral de Residuos in a collaborative research among the Centro de Investigaciones sobre Desertificacion, the Entidad Publica de Saneamiento de Aguas Residuales de la Comunidad Valenciana and the company Depuracion de Aguas del Mediterraneo. The closed landfill has a surface of 2,6 ha and its re-vegetation will be carried out by introducing native plants (annuals, busch and trees) after incorporation into the degraded soil of the anaerobic sewage sludge at the single dose of 60 tn/ha. (Author) 3 refs.

  15. Liberación de la teofilina a partir de matrices hidrófilas que contienen algfinato de sodio procedentes de Sargassum cymosum (Phaeofphyta Release of theophylline from hydrophilic matrices containing sodium alginate from seasonal Sargassum cymosum (Phaeophyta

    Directory of Open Access Journals (Sweden)

    Itamar Francisco Andreazza

    2009-08-01

    Full Text Available The sodium alginate extracted from seasonal Sargassum cymosum samples (autumn, winter, spring and summer in Paciência Beach (Penha- SC-Brazil showed a viscosity of 18.3, 33.5, 62.6 and 34.2 mPa·s, respectively. Theophylline tablets(60 mg containing 35 % of sodium alginate samples were analyzed by dissolution profile in a dissolution device at 100 rev×min-1 and 37 °C, using water as dissolution medium, during 6 h. Tablets with the lesser viscous sodium alginate sample (autumn showed a complete disintegration and drug release after 1 h. Despite all others tablets have exhibited the same drug release mechanism, by diffusion, the winter sodium alginate tablets released > 90 % of theophylline after 3 h, while spring and summer sodium alginate tablets showed similar dissolution profile with a release > 90 % of drug after 6 h. In general, the less viscous polymers showed a faster drug release, but probably other characteristics beside viscosity have played role in this process.El alginato de sodio extraído de muestras estacionales de Sargassum cymosum (otoño, invierno, primavera y verano en la Playa de la Paciencia (Penha-SC-Brasil mostró viscosidad de 18,3, 33,5, 62,6 y 34,2 mPa·s, respectivamente. Tabletas de teofilina (60 mg que contenían 35 % de muestras de alginato de sodio fueron analizadas a través del perfil de disolución, en un disolutor a 100 rev×min-1 y 37 ºC, utilizando agua como medio de disolución, durante 6 h. Las tabletas con la muestra de alginato de sodio menos viscosa (otoño mostraron completa desintegración y liberación del fármaco después de 1 h. A pesar de que todas las demás tabletas mostraron el mismo mecanismo de liberación del fármaco, por difusión, las tabletas con la muestra de alginato de sodio de invierno liberó > 90 % de la teofilina después de 3 h, mientras las tabletas de alginato de sodio de primavera y verano presentaron un perfil de disolución semejante con liberación > 90 % de fármaco después de 6 h. En general, los polímeros menos viscosos proporcionaron liberación más rápida del fármaco, pero otras características, además viscosidad probablemente desempeñaron alguna función en este proceso.

  16. Elaboración de abono orgánico a partir de plantas acuáticas: Elodea (Hydrilla verticillata) y Jacinto o Lirio de agua (Eichhornia crassipes), procedentes del Lago de Coatepeque y Lago de Güija

    OpenAIRE

    Reyes de Cabrales, Cecilia Elizabeth

    2009-01-01

    El presente estudio tiene por finalidad elaborar un abono orgánico bajo la técnica de compostaje, conocida como proceso de descomposición aeróbica. Se realizaron tres formulaciones de abono a partir de las plantas acuáticas Elodea (Hydrilla verticillata) y Jacinto de agua (Eichhornia crassipes) en las siguientes proporciones: Elodea 100%, Jacinto de agua 100% y mezcla de ambas en una proporción de 50:50. A los abonos obtenidos se les realizaron análisis químico con la finalidad de cuantificar...

  17. Contenido de vitamina C en frutos de camu camu Myrciaria dubia (H.B.K Mc Vaugh, en cuatro estados de maduración, procedentes de la Colección de Germoplasma del INIA Loreto, Perú

    Directory of Open Access Journals (Sweden)

    Sixto Imán Correa

    2011-01-01

    Full Text Available El objetivo del presente trabajo, fue determinar el contenido de vitamina C en diferentes partes d el fruto; pulpa, cáscara y pulpa más cáscara, en cuatro estados de maduración: verde, pintón, maduro y sobremaduro. Los frutos fueron obtenidos de la Colección de Germoplasma de la Estación Experimental Agraria San Roque del INIA Loreto, Perú. La técnica u tilizada para la determinación de contenido de vitamina C fue Cromatografía Líquida de Alta Eficiencia (HPLC con columna de fase reversa. Los resultados indican que los mayores contenidos de vitamina C se encuentran en la cáscara del fruto en estados de m aduración sobremaduro y maduro. E l contenido de vitamina C según estados de maduración se ajustan a una curva de regresión cúbica, tanto para pulpa, cáscara y pulpa más cáscara con 87%, 90% y 98 % de efectividad; respectivamente. Cuando se pasa de un estad o de maduración a otro, el contenido de vitamina C se incrementa en 515.43 mg en cada 100 g de muestra de cáscara. Los resultados obtenidos indican que e l camu camu es una fuente potencial de vitamina C, concentrada principalmente en la cáscara del fruto.

  18. Contenido de vitamina C en frutos de camu camu Myrciaria dubia (H.B.K) Mc Vaugh, en cuatro estados de maduración, procedentes de la Colección de Germoplasma del INIA Loreto, Perú

    OpenAIRE

    Imán Correa, Sixto; Bravo Zamudio, Luz; Sotero Solís, Víctor; Oliva Cruz, Carlos

    2011-01-01

    The objective of the present work was to determine the vitamin content C in different parts from the fruit; pulp, rind and pulp more rind, in four states of maturation: green, mature green, mature and over mature. The fruits were obtained from the Collection of Germoplasma of the Agrarian Experimental Station San Roque of the INIA Loreto, Peru. The technique used for the determination of vitamin content C was Liquid High Chromatography Performance (HPLC) with phase column reverse. The results...

  19. Microbial flora of odontogenic abscesses in pet guinea pigs.

    Science.gov (United States)

    Minarikova, A; Hauptman, K; Knotek, Z; Jekl, V

    2016-10-01

    Abscesses of odontogenic origin in guinea pigs pose a serious health problem and need to be treated with a combination of surgical and medical therapy. The aim of this prospective study was to describe the microbial flora of odontogenic abscesses associated with osteomyelitis in 24 pet guinea pigs, to perform antibiotic sensitivity testing, and to make recommendations for practitioners on the antibiotics of first choice. Inclusion criteria for the study included the animal being diagnosed with an odontogenic abscess which underwent surgery and was not pre-treated with an antibiotic. Inclusion criteria matched for 24 guinea pigs. Samples (pus, capsule and affected tooth/bone) for bacteriological examination were collected under sterile conditions during the surgical procedure. The most commonly isolated bacteria from abscesses of odontogenic origin were Bacteroides fragilis in 12.8 per cent (6/47) of cases, Pasteurella multocida in 10.6 per cent (5/47) and Peptostreptococcus anaerobius in 8.5 per cent (4/47). Aerobic bacterial species only were isolated in 29.2 per cent (7/24) of cases, anaerobic bacteria only were isolated in 33.3 per cent (8/24), and mixed infection with anaerobic and aerobic bacterial species was seen in 37.5 per cent (9/24). Aerobes (n=20) were sensitive to enrofloxacin and marbofloxacin in 100 per cent of samples, benzylpenicillin potassium (penicillin G, PNCG) in 90 per cent, cephalotin in 85 per cent, amoxicillin-clavulanate in 75 per cent, doxycycline in 70 per cent, gentamicin in 65 per cent and trimethoprim-sulfamethoxazole in 55 per cent. Anaerobes (n=27) were sensitive to amoxicillin-clavulanate in 100 per cent of cases, clindamycin in 96.3 per cent, metronidazole in 92.6 per cent, PNCG in 92.6 per cent and cephalotin in 74.1 per cent. As guinea pigs are strictly herbivorous animals, based on the results of this study the recommended antibiotic treatment for odontogenic abscesses is a combination of fluoroquinolones and metronidazole

  20. Antioxidant, antibacterial activity, and phytochemical characterization of Melaleuca cajuputi extract.

    Science.gov (United States)

    Al-Abd, Nazeh M; Mohamed Nor, Zurainee; Mansor, Marzida; Azhar, Fadzly; Hasan, M S; Kassim, Mustafa

    2015-10-24

    The threat posed by drug-resistant pathogens has resulted in the increasing momentum in research and development for effective alternative medications. The antioxidant and antibacterial properties of phytochemical extracts makes them attractive alternative complementary medicines. Therefore, this study evaluated the phytochemical constituents of Melaleuca cajuputi flower and leaf (GF and GL, respectively) extracts and their antioxidant and antibacterial activities. Radical scavenging capacity of the extracts was estimated using 2,2-diphenyl-2-picrylhydrazyl and Fe(2+)-chelating activity. Total antioxidant activity was determined using ferric reducing antioxidant power assay. Well diffusion, minimum inhibitory concentration, and minimum bactericidal concentration assays were used to determine antibacterial activity against eight pathogens, namely Staphylococcus aureus, Escherichia coli, Bacillus cereus, Staphylococcus epidermidis, Salmonella typhimurium, Klebsiella pneumonia, Streptococcus pneumoniae, and Pasteurella multocida. We identified and quantified the phytochemical constituents in methanol extracts using liquid chromatography/mass spectrometry (LC/MS) and gas chromatography (GC)/MS. This study reports the antioxidant and radical scavenging activity of M. cajuputi methanolic extracts. The GF extract showed better efficacy than that of the GL extract. The total phenolic contents were higher in the flower extract than they were in the leaf extract (0.55 ± 0.05 and 0.37 ± 0.05 gallic acid equivalent per mg extract dry weight, respectively). As expected, the percentage radical inhibition by GF was higher than that by the GL extract (81 and 75 %, respectively). A similar trend was observed in Fe(2+)-chelating activity and β-carotene bleaching tests. The antibacterial assay of the extracts revealed no inhibition zones with the Gram-negative bacteria tested. However, the extracts demonstrated activity against B. cereus, S. aureus, and S. epidermidis. In

  1. Pharmacokinetics (PK), pharmacodynamics (PD), and PK-PD integration of ceftiofur after a single intravenous, subcutaneous and subcutaneous-LA administration in lactating goats.

    Science.gov (United States)

    Fernández-Varón, Emilio; Cárceles-García, Carlos; Serrano-Rodríguez, Juan Manuel; Cárceles-Rodríguez, Carlos M

    2016-10-13

    Bacterial pneumonia in goats is usually caused by Mannheimia haemolytica and Pasteurella multocida. Another important infection disease in lactating goats is intramammary infection producing mastitis, usually associated with coagulase-negative Staphylococcus spp. However, treatment of bacterial pneumonia in goats not affected by mastitis problems should be restricted to antimicrobials with scant penetration to milk in order to avoid long withdrawal times. Ceftiofur is a third-generation cephalosporin antimicrobial with activity against various gram-positive and gram-negative, aerobic and anaerobic bacteria encountered by domestic animals. The objectives of the present study were to establish the serum concentration-time profile for ceftiofur in lactating goats after intravenous, subcutaneous and a SC-long-acting ceftiofur formulation; to determine ceftiofur penetration into milk; to determine in vitro and ex vivo activity of ceftiofur establishing MIC, MBC, MPC and time-kill profiles against field strains of M. haemolytica and finally to calculate the main surrogate markers of efficacy. The pharmacokinetics studies revealed an optimal PK properties for the SC-LA formulation tested. Ceftiofur was well absorbed following SC and SC-LA administration, with absolute bioavailabilities (F) of 85.16 and 84.43 %, respectively. After ceftiofur analysis from milk samples, no concentrations were found at any sampling time. The MIC, MBC and MPC data of ceftiofur against five M. haemolytica strains isolated from goats affected by pneumonia were tested showing excelent sensitivity of ceftiofur against this pathogen. For PK-PD analysis, ratios were calculated suggesting a high level of bacterial kill against the five strains of M. haemolytica tested. The systemic ceftiofur exposure achieved in lactating goats following IV, SC and especially with the SC-LA administration is consistent with the predicted PK-PD ratios needed for a positive therapeutic outcome for M. haemolytica

  2. A rapid minor groove binder PCR method for distinguishing the vaccine strain Brucella abortus 104M.

    Science.gov (United States)

    Nan, Wenlong; Qin, Lide; Wang, Yong; Zhang, Yueyong; Tan, Pengfei; Chen, Yuqi; Mao, Kairong; Chen, Yiping

    2018-01-24

    Brucellosis is a widespread zoonotic disease caused by Gram-negative Brucella bacteria. Immunisation with attenuated vaccine is an effective method of prevention, but it can interfere with diagnosis. Live, attenuated Brucella abortus strain 104M has been used for the prevention of human brucellosis in China since 1965. However, at present, no fast and reliable method exists that can distinguish this strain from field strains. Single nucleotide polymorphism (SNP)-based assays offer a new approach for such discrimination. SNP-based minor groove binder (MGB) and Cycleave assays have been used for rapid identification of four Brucella vaccine strains (B. abortus strains S19, A19 and RB51, and B. melitensis Rev1). The main objective of this study was to develop a PCR assay for rapid and specific detection of strain 104M. We developed a SNP-based MGB PCR assay that could successfully distinguish strain 104M from 18 representative strains of Brucella (B. abortus biovars 1, 2, 3, 4, 5, 6, 7 and 9, B. melitensis biovars 1, 2 and 3, B. suis biovars 1, 2, 3 and 4, B. canis, B. neotomae, and B. ovis), four Brucella vaccine strains (A19, S19, S2, M5), and 55 Brucella clinical field strains. The assay gave a negative reaction with four non-Brucella species (Escherichia coli, Pasteurella multocida, Streptococcus suis and Pseudomonas aeruginosa). The minimum sensitivity of the assay, evaluated using 10-fold dilutions of chromosomal DNA, was 220 fg for the 104M strain and 76 fg for the single non-104M Brucella strain tested (B. abortus A19). The assay was also reproducible (intra- and inter-assay coefficients of variation = 0.006-0.022 and 0.012-0.044, respectively). A SNP-based MGB PCR assay was developed that could straightforwardly and unambiguously distinguish B. abortus vaccine strain 104M from non-104M Brucella strains. Compared to the classical isolation and identification approaches of bacteriology, this real-time PCR assay has substantial advantages in terms of

  3. Using Inuit traditional ecological knowledge for detecting and monitoring avian cholera among Common Eiders in the eastern Canadian Arctic

    Directory of Open Access Journals (Sweden)

    Dominique A. Henri

    2018-03-01

    Full Text Available In recent decades, traditional ecological knowledge (TEK has played an increasing role in wildlife management and biodiversity conservation in Canada and elsewhere. This study examined the potential contribution that Inuit TEK (which is one aspect of Inuit Qaujimajatuqangit or Inuit traditional knowledge could offer to detect and monitor avian cholera and other disease-related mortality among Northern Common Eiders (Somateria mollissima borealis breeding in the eastern Canadian Arctic. Avian cholera is an infectious disease (Pasteurella multocida that has been a major conservation issue because of its potential to cause high rates of disease and mortality in several bird species in repeating epizootics; it has spread geographically in North America since the 1940s. In 2004, Inuit hunters from Ivujivik, Nunavik, Québec, were the first to detect avian disease outbreaks among Northern Common Eiders nesting in northeastern Hudson Bay and western Hudson Strait. Laboratory analysis of bird tissues confirmed avian cholera in that region. From 2007 to 2009, we collected Inuit TEK about mortality among Common Eiders and other bird species north and west of where the outbreaks were first detected. During interviews in the communities of Kimmirut, Cape Dorset, Coral Harbour, and Igloolik, Nunavut, Canada (n = 40, Inuit participants reported seeing a total of 8 Common Eiders and 41 specimens of other bird species either sick or dead in northern Hudson Strait, Hudson Bay, and Foxe Basin. Most of the observed disease and mortality events were at sea, on sea ice, or on small nesting islands. Such events probably would have gone undetected by biologists, who were mainly monitoring avian cholera outbreaks on large nesting islands in that region. Inuit participants readily recalled details about the timing, location, and numbers of sick and dead birds that they observed. Some reported signs of disease that were consistent with avian cholera. Inuit also revealed

  4. 21 CFR 520.2261b - Sulfamethazine powder.

    Science.gov (United States)

    2010-04-01

    ... and bovine respiratory disease complex (shipping fever complex) (Pasteurella spp.), colibacillosis... (F. necrophorum), acute mastitis (Streptococcus spp.), and acute metritis (Streptococcus spp.) (iii...

  5. 21 CFR 520.2170 - Sulfabromomethazine sodium boluses.

    Science.gov (United States)

    2010-04-01

    ... pneumonia and bovine respiratory disease complex (shipping fever complex) associated with Pasteurella spp.; acute metritis and acute mastitis caused by Streptococcus spp. (3) Limitations. Administer orally...

  6. 21 CFR 522.2630 - Tulathromycin.

    Science.gov (United States)

    2010-04-01

    .... multocida, Bordetella bronchiseptica, Haemophilus parasuis, and Mycoplasma hyopneumoniae; and for the control of SRD associated with A. pleuropneumoniae, P. multocida, and M. hyopneumoniae in groups of pigs..., Histophilus somni, and Mycoplasma bovis. For the control of respiratory disease in cattle at high risk of...

  7. Studies of the binding of ficolin-2 and ficolin-3 from the complement lectin pathway to Leptospira biflexa, Pasteurella pneumotropica and Diarrheagenic Escherichia coli

    DEFF Research Database (Denmark)

    Sahagún-Ruiz, Alfredo; Breda, Leandro Carvalho Dantas; Valencia, Mónica Marcela Castiblanco

    2015-01-01

    Ficolins recognize pathogen associated molecular patterns and activate the lectin pathway of complement system. However, our knowledge regarding pathogen recognition of human ficolins is still limited. We therefore set out to explore and investigate the possible interactions of the two main serum...

  8. Untitled

    African Journals Online (AJOL)

    cholera result in significant economic losses to susceptibility to ... standardized single disk method and minimal multocida .... using a panel of 16 reference antibodies against rhamnose .... horizontal transmission within the bacterial on our in ...

  9. Pharmacokinetics of Enrofloxacin and Danofloxacin in Plasma, Inflammatory Exudate, and Bronchial Secretions of Calves following Subcutaneous Administration

    Science.gov (United States)

    McKellar, Quintin; Gibson, Ian; Monteiro, Ana; Bregante, Miguel

    1999-01-01

    concentration-time curve/MIC ratios in plasma) for Pasteurella multocida (MIC of enrofloxacin, 0.06 μg/ml [24]; MIC of danofloxacin, 0.06 μg/ml [6]), enrofloxacin produced scores of 8.17 and 52.00, respectively, compared to those of danofloxacin, which were 4.02 and 23.05, respectively. With the dosing rates recommended in some markets by manufacturers, enrofloxacin and danofloxacin achieved concentrations above the MICs for important pathogenic organisms in plasma, tissue cage exudate, and bronchial secretion. Since fluoroquinolones display concentration-dependent activities, Cmax/MIC ratios may be critical to efficacy. In the United States enrofloxacin is currently the only fluoroquinolone licensed for food animals and dosages for acute respiratory disease are 2.5 to 5 mg/kg for 3 days or 7.5 to 12.5 mg/kg once. The higher dosages on a single occasion are likely to confer Cmax/MIC ratios that are associated with greater clinical efficacy. PMID:10428924

  10. APLICACIÓN AL ESTUDIO DE LA RESPUESTA MECÁNICA DE LA CAPA DE SUBBALASTO DE VÍAS FERROVIARIAS FORMADO POR UNA MEZCLA NO BITUMINOSA DE MATERIAL GRANULAR Y PARTÍCULAS PROCEDENTES DE NEUMÁTICOS FUERA DE USO.

    OpenAIRE

    Hidalgo Signes, Carlos

    2017-01-01

    Scrap tyres are a solid waste material which has been generated in large quantities over the last decades. In Spain, between 2000 and 2014 the number of vehicles increased by 30% and a further 3.5% increment is expected for the next fifteen years. Likewise, the number of scrap tyres is also expected to rise within the same order of magnitude. Taking into account the big volume of waste generated, proper disposal and reutilisation management is required, ever more so as scrap ty...

  11. Life cycle analysis of biodiesel production from flesh from the tannery industry Análisis del ciclo de vida de la producción de biodiésel a partir del descarne procedente de la industria de la curtiduría

    Directory of Open Access Journals (Sweden)

    Jose de Jesus Rodríguez Ibarra

    2012-11-01

    Full Text Available The tanning industry is a source of contamination by hazardous waste generation and special handling. One of these elements is the flesh, which help this study to determine if fleshing is able to add value to a source of employment and a reduction of pollution: production of biodiesel promises to be the sustainable alternative, economically and socially viable. The study was divided into 3 unit processes with a base of 1 kg of biodiesel: a flesh collection, b cooked and rendered, c esterification and transesterification. The impact categories evaluated were the primary energy consumption and the potential nonrenewable emissions of greenhouse gases. As a result of this article, it is had that the tanning is a source of biodiesel economically and environmentally feasible for the least environmental impact occurred. With the availability of annual flesh (79 200 000 kg can be reduced combustion emissions of CO2 from the air to 11 980 300 kg per year.La industria de la curtiduría es un foco de contaminación debido a la generación de residuos peligrosos y de manejo especial. Entre estos elementos se encuentra el descarne. Sobre este elemento, el actual estudio busca determinar si puede contar con un valor agregado para nuevas fuentes de empleo y la reducción de la contaminación: la producción de biodiésel promete ser la alternativa sustentable, económica y socialmente viable. El sistema de estudio se dividió en 3 procesos unitarios con una base de 1 kg de biodiésel: a recolección del descarne, b cocido y rendido, c esterificación y transesterificación. Las categorías de impacto evaluadas fueron el consumo de energía primaria no renovable y el potencial de emisiones de gases de efecto invernadero. Como resultado del estudio se tuvo que la curtiduría resulta ser una fuente de producción de biodiésel económica y ambientalmente viable gracias a su menor impacto ambiental producido. Con la disponibilidad de descarne anual (79 200 000 kg se pueden reducir las emisiones de combustión a 11 980 300 kg de CO2 en el aire anuales.

  12. Análisis de contexto y viabilidad para la producción de electricidad a partir de biogás como forma de valorización de residuos orgánicos procedentes del sector distribución

    OpenAIRE

    Fandiño Galan, Miguel

    2014-01-01

    1.- Análisis de la evolución en España de la producción eléctrica a partir de biogás como combustible. Potencia instalada. Situación actual del biogás. Comparativa con otros países Europeos. 2.- Análisis de marco legal y retributivo en España de la producción eléctrica a partir de biogás como combustible. Comparativa con otros países Europeos. 3.- Estudio de viabilidad para la instalación en España de una planta de biogás para producción de electricidad utilizando residuos orgánicos procedent...

  13. Análise dos óleos essenciais de três espécies de Piper coletadas na região do Distrito Federal (Cerrado e comparação com óleos de plantas procedentes da região de Paraty, RJ (Mata Atlântica

    Directory of Open Access Journals (Sweden)

    Miriam Cristina Leone Potzernheim

    Full Text Available Foi determinada a composição química dos óleos essenciais de 3 espécies do gênero Piper coletadas em Matas de Galeria no Cerrado, e comparada com composição dos óleos das mesmas espécies oriundas da Mata Atlântica. A composição química do óleo de Piper arboreum subsp arboreum, P. dilatatum e P. hispidum foi determinada por cromatografia gasosa em coluna capilar HP-5 e espectrometria de massas. As três espécies do Cerrado apresentaram predominância de sesquiterpenos. Piper arboreum subsp arboreum apresentou como constituintes majoritários biciclogermacreno (12,1%, 10-epi-g-eudesmol (11,6% e óxido de cariofileno (10,1%. Em P. dilatatum os constituintes em maior quantidade foram cis-b-ocimeno (19,6% e b-cariofileno (11,3% e em P. hispidum foram b-pineno (19,7%, a-pineno (9,0%.

  14. Impregnation/Agglomeration Laboratory Tests of Heavy Fuel from Prestige to Improve Its Manageability and Removal from Seawater Surface. (Physical Behaviour of Fuel Agglomates); Ensayos a Nivel de Laboratorio de Impregnacion/Aglomeracion del Fuel Procedente del Prestige para Facilitar su Manipulacion y Recogida en la Superficie del Mar (Comportamiento Fisico de los Aglomerados de Fuel)

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Frutos, F. J.; Rodriguez, V.; Otero, J.

    2002-07-01

    The handling and removal problems showed by heavy fuel floating in seawater could be improved or solved by using materials that agglomerate it. These materials must fulfill the following condition: be inert materials in marine environment, the agglomerated fuel/material should float and its application and removal should be done using simple technologies. Based on these requirements, clay minerals, pine chips, mineral coal and charcoal were selected. The preliminary results on impregnation/agglomeration with the materials mentioned above of heavy fuel from Prestige at lab scale are presented in this paper. The results have shown that only hydrophobic materials, such as mineral coal and charcoal, are able to agglomerate with fuel, which is also a hydrophobic substance. Whereas the agglomerates fuel/mineral coal sink, the agglomerates fuel/charcoal keep floating on water surface. It can be concluded that the addition of charcoal on dispersed fuel in seawater could improve its handling and removal. In this sense, pilot scale and eventually controlled in situ tests to study the feasibility of the proposed solution should be performed. (Author) 2 refs.

  15. Archaeometrical comparative study of paint samples with Egyptian Blue, from Nefertari's tomb (XIII Century BC) and Balneum (Roman baths, First Century BC and AD).; Estudio arqueometrico comparativo de muestras de pinturas con azul egipcio, procedentes de la tumba de Nefertari siglo XIII a.C. y del Balneum, termas romanas, siglos I a.C., I d.C.

    Energy Technology Data Exchange (ETDEWEB)

    Criado Portal, A. J.; Garcia Sanchez, L.; Penco Valenzuela, F.; Criado Martin, A. J.; Martinez, Garcia, J. A.; Chamon Fernandez, J.; Dietz, C.

    2011-07-01

    In the present work have studied two samples with the same pigment, Egyptian Blue, but from different sources. The difference between them is caused by the functionality. In the case of Nefertari's tomb is decorating interior rooms carved into rock in which they would not suffer any damage since it does not accessed to that place anymore. In the case of Balneum's baths is decorating very warm and humid rooms, and should resist deterioration resulting from human activity during the use of these baths. (Author) 38 refs.

  16. Management of Waste from the Use of Radioisotopes; Divers Aspects Resultant de l'Utilisation des Isotopes Radioactifs; 0423 0414 0410 041b 0415 041d 0418 0415 041e 0422 0425 041e 0414 ; Diversos Aspectos Relacionados con los Desechos Procedentes del Empleo de Radioisotopos

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, Lester R. [Radiation Safety Branch, Division of Licensing and Regulation, United States Atomic Energy Commission (United States)

    1960-07-01

    The author examines the origin and nature of radioactive waste generated in the use of radioisotopes in industry, medicine, agriculture and research and studies the relationship between types, quantities and uses of radioisotopes and disposal of the radioactive waste generated in their use. He also discusses the methods used for the disposal of such waste under the licensing controls of the United States Atomic Energy Commission. These methods include: 1. The controlled discharge of low concentrations of effluents into streams and into the atmosphere; 2. Controlled release of small quantities of soluble or readily dispersible waste products into sanitary sewage systems; 3. Burial, under controlled conditions, of small quantities of waste in the soil ; 4. Return to AEC installations of radioactive waste for storage or land burial ; 5. Treatment by incineration; and 6. Disposal of packaged waste at sea. The paper reviews the criteria and regulatory requirements applicable to cach method of disposal to accomplish the objective of preventing the waste from entering the food chain of man in hazardous quantities, or of adversely affecting the use of the environment by man. It goes on to discuss the limitations on the types, quantities, and methods of disposal for which private concerns can be licensed due to long-term responsibility for maintenance of burial grounds or storage facilities. (author) [French] L'auteur se propose d'examiner l'origine et la nature des dechets radioactifs resultant de l'utflisation des radioisotopes dans l'industrie, la medecine, l'agriculture et dans les laboratoires de recherche, et d'etudier les rapports qui existent entre les types, les quantites et les utilisations des radioisotopes, d'une part, et les dechets de leur production, d'autre part. Il etudie aussi les methodes utilisees pour l'elimination de ces dechets conformement aux mesures de controle appliquees par la Commission de l'energie atomique des Etats-Unis. Les methodes employees consistent: 1. A evacuer sous controle les effluents en concentration reduite, dans les cours d'eau et dans l'atmosphere; 2. A eyacuer sous controle, dans le systeme d'egouts, de petites quantites de dechets solubles ou susceptibles d'etre entraines rapidement; 3. A enfouir sous controle dans le sol de petites quantites de dechets; 4. A renvoyer les dechets radioactifs aux installations de la C.E.A. pour entreposage ou enfouissement dans la terre; 5. A les traiter par incineration; 6. A les evacuer dans la mer - contenus dans des recipients. L'auteur etudie ensuite les criteres et les normes applicables a chacune de ces methodes pour empecher que les dechets ne penetrent-dans la chaine de Inverted-Exclamation-Mark 'alimentation de l'homme en quantites dangereuses ou d'une maniere qui ait un effet defavorable sur l'utilisation de son milieu par l'homme. Suivant les types, les quantites et les methodes d'evacuation, l'auteur etablie les limitations dont il faut tenir compte en octroyant des autorisations aux entreprises privees, en raison des responsabilites a long terme qui resultent de la disposition de terrains d'enfouissement ou d'installations d'entreposage. (author) [Spanish] El autor analiza el origen y la naturaleza de los desechos radiactivos que se forman como consecuencia del empleo de radioisotopos en la industria, la medicina, la agricultura y la investigacion, y pasa revista a las relaciones existentes entre los tipos, cantidades y aplicaciones de los radioisotopos y los desechos correspondientes. En la memoria se examinan especialmente los metodos utilizados para evacuar, con arreglo a las normas de autorizacion de la Atomic Energy Commission de los Estados Unidos de America, los desechos radiactivos derivados del empleo de radioisotopos en las mencionadas esferas. Estos metodos abarcan: 1. La descarga controlada de efluentes diluidos en las corrientes de agua y en la atmosfera; 2. La descarga regulada, en los alcantarillados, de pequenas cantidades de desechos solubles o facilmente dispersables ; 3. La inhumacion en el suelo, en condiciones controladas, de pequenas cantidades de desechos; 4. El envio de los desechos radiactivos a las instalaciones de la Atomic Energy Commission para su almacenamiento o inhumacion; 5. El tratamiento por incineracion; 6. La evacuacion en el mar de desechos envasados. El autor examina los criterios y requisitos reglamentarios aplicables a cada metodo de evacuacion con el proposito de impedir que los desechos entren en la cadena alimentaria humana en cantidades peligrosas o afecten desfavorablemente la utilizacion del medio por el hombre. Estudia asimismo las limitaciones que se han de imponer a los tipos y metodos de evacuacion aplicados por las empresas privadas que, por su larga experiencia en Inverted-Exclamation-Mark el mantenimiento de terrenos de inhumacion o instalaciones de almacenamiento, pueden recibir autorizacion oficial para efectuar esta clase de operaciones. (author) [Russian] Budut obsuzhdeny voprosy proishozhdenija i haraktera radioaktivnyh othodov, obrazuemyh pri ispol'zovanii radioizotopov v promyshlennosti, medicine, sel'skom hozjajstve i nauchnyh issledovanijah. Budet rassmotrena svjaz' mezhdu tipami, kolichestvami i metodami ispol'zovanija radioizotopov i othodami, kotorye pri jetom obrazujutsja. Budut obsuzhdeny metody, primenjaemye dlja udalenija radioaktivnyh othodov, obrazuemyh pri ispol'zovanii radioizotopov v promyshlennosti, medicine, nauchnyh issledovanijah i sel'skom hozjajstve, na kotorye rasprostranjaetsja kontrol' Komissii po atomnoj jenergii. Jeti metody vkljuchajut: 1. Kontroliruemoe udalenie zhidkostej nizkoj koncentracii v reki i v atmosferu ; 2. Kontroliruemoe udalenie nebol'shih kolichestv rastvorjaemyh ili nahodjashhihsja v dispersionnom sostojanii produktov othoda v kanalizacionnye sistemy ; 3. Zahoronenie nebol'shih kolichestv othodov v zemlju pri kontroliruemyh uslovijah; 4. Vozvrashhenie radioaktivnyh othodov na ustanovki Komissii po atomnoj jenergii dlja hranenija ili zahoronenija; 5. Szhiganie othodov; i 6. Udalenie v morja othodov v kontejnerah. Budut rassmotreny kriterii i reglamentacionnye trebovanija, primenjaemye k kazhdomu metodu udalenija othodov dlja dostizhenija takogo polozhenija, chtoby predotvratit' popadanie opasnyh kolichestv radioaktivnosti v pishhu cheloveka ili neblagoprijatnoe vlijanie na ispol'zovanie chelovekom okruzhajushhej sredy. Budut obsuzhdeny ogranichenija tipov, kolichestv i metodov udalenija othodov, na kotorye chastnym koncernam neobhodimo imet' razreshenie v svjazi s dlitel'nym harakterom otvetstvennosti po soderzhaniju mest zahoronenija ili oborudovanija dlja hranenija radioaktivnyh othodov. (author)

  17. Genotype characterization of Haematobia irritans from different Brazilian geographic regions based on randomly amplified polymorphic DNA (RAPD analysis Caracterização genotípica de Haematobia irritans procedentes de diferentes regiões geográficas brasileiras baseada na análise do DNA polimórfico amplificado ao acaso (RAPD-PCR

    Directory of Open Access Journals (Sweden)

    Luciana G. Brito

    2007-01-01

    Full Text Available Blood-sucking diptera are important parasites in bovine production systems, especially regarding confinement conditions. Haematobia irritans, the horn fly, is one of the most troublesome species within bovine production systems, due to the intense stress imposed to the animals. An important aspect while studying the variability within a species is the study of the geographic structure of its populations and, attempting to find out the genetic flow of Brazilian populations of horn fly, the RAPD technique, which is suited for this purpose, has been used. The use of molecular markers generated from RAPD made it possible to identify the geographic origin of samples from different Brazilian geographic regions, as well as to estimate the genotypic flow among the different Brazilian populations of the horn fly.Dípteras hematófagos são importantes parasitas dentro de sistemas de produção de bovinos, especialmente em confinamento. Haematobia irritans, a mosca-dos-chifres, é uma das espécies que maiores problemas causa em sistemas de produção de bovinos, dado ao intenso estresse que impõe aos animais. Um importante aspecto quando se estuda a variabilidade genética dentro das espécies é o estudo da estrutura geográfica destas populações. Buscando-se estimar a similaridade genotípica das diferentes populações brasileiras da mosca do chifre utilizou-se a técnica do DNA polimórfico amplificado ao acaso (RAPD-PCR, que mostrou-se eficiente para tal propósito. A utilização dos marcadores moleculares gerados através da técnica de RAPD-PCR tornou possível a identificação da origem geográfica das amostras das diferentes regiões geográficas brasileiras, assim como, estimar o fluxo genotípico entre as diferentes populações brasileiras da mosca-dos-chifres.

  18. Population structure and sexual maturity of the calico box crab Hepatus epheliticus Linnaeus (Brachyura, Hepatidae from Yucatan Peninsula, Mexico Estructura poblacional y madurez sexual en el cangrejo caja moteado Hepatus epheliticus Linnaeus (Brachyura, Hepatidae procedente de la Península del Yucatán, México

    Directory of Open Access Journals (Sweden)

    Patricio Hernáez

    2012-07-01

    Full Text Available The calico box crab Hepatus epheliticus is an abundant species from shallow and continental shelf waters of the Atlantic coast of USA and Mexico. Information about population structure and sexual maturity is absent, even though this crab is caught to be used as bait for the octopus fishery in the Campeche Bank, Mexico. In order to achieve such information, a total of 768 individuals were collected from January to March 2010 through baited traps installed in the Yucatan Peninsula, Mexico. Our results showed that sex ratio is biased towards more males than females (1:0.55, contradicting to that reported in other brachyuran crabs. The absence of ovigerous females suggests that they did not enter into the traps during embryogenesis. Males reached a larger maximum size than females (64.0 ± 6.15 and 58.4 ± 5.60 mm carapace width, respectively. The general scheme of growth being positive allometric throughout ontogeny of both sexes. Males presented a transition phase from juveniles to adult corresponding to the puberty moult. The estimation of the onset of functional sexual maturity revealed a steady situation for the population, with 21.5 and 13.8% of males and females, respectively, morphologically immature at the time of catch. This study constitutes the first report on population structure and sexual maturity in a population of the calico box crab H. epheliticus.El cangrejo caja moteado Hepatus epheliticus es un abundante braquiuro perteneciente a la familia Hepatidae, distribuido desde aguas someras hasta la plataforma continental en la costa atlántica de Estados Unidos y México. La información sobre su demografía poblacional y madurez sexual es actualmente inexistente, aun cuando esta especie es intensamente capturada como carnada en la pesquería del pulpo del estado de Campeche, México. Entre enero y marzo de 2010, se colectaron 768 especímenes usando trampas instaladas en la Península de Yucatán, México. Los resultados mostraron una proporción sexual completamente inclinada hacia los machos (1:0,55, lo cual contradice el esquema general reportado en otras especies de braquiuros. La ausencia total de hembras ovígeras, sugiere su resistencia a ingresar a las trampas durante el periodo de incubación de los embriones. Los machos alcanzaron un tamaño promedio mayor que las hembras (64,0 ± 6,15 y 58,4 ± 5,60 mm de ancho del caparazón, respectivamente, siendo el crecimiento de tipo alométrico positivo a lo largo de la ontogenia de ambos sexos. Los machos presentaron una fase de transición desde juveniles a adultos correspondiente a la muda de pubertad. La estimación de la madurez sexual funcional mostró una situación normal para la población, con 21,5 y 13,8% de machos y hembras respectivamente, morfológicamente inmaduros al momento de ser capturados. Este estudio constituye la primera aproximación a la estructura poblacional y madurez sexual del cangrejo caja moteado H. epheliticus.

  19. Estudio citogenético y morfológico en productos de aborto espontáneo procedentes de diferentes servicios de ginecoobstetricia de la ciudad de Medellín Cytogenetic and morphologic study of spontaneous abortions products in Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Gonzálo Vásquez Palacio

    1998-04-01

    Full Text Available En el período comprendido entre septiembre 1° de 1996 y octubre 1° de 1997, se recolectó para estudios morfológico y citogenético un total de 84 productos de aborto espontáneo del 1° y 2° trimestres de la gestación, en diferentes servicios de ginecoobstetricia de la ciudad de Medellín. Dieciséis de los 84 se descartaron por contaminación o ausencia de tejidos apropiados para el estudio. De los 68 productos restantes en 60 (88,2% se establecieron cultivos para estudio citogenético, los cuales fueron exitosos en 34 casos (56, 7%. Diecisiete de los anteriores (50% mostraron un cariotipo anormal con las siguientes alteraciones cromosómicas: monosomía X, 10 (58,8%, mosaicismos 5 (29,4%, trisomías 1 (5,9% y tetraploidía 1 (5,9%. En 21 de los 68 productos (30,9% (3 embriones y 18 fetos fue posible el estudio morfológico. Doce de éstos, (2 embriones y 10 fetos; 57, 1 % mostraron alteraciones morfológicas externas o internas. El presente estudio citogenético y morfológico en productos de aborto espontáneo con edad gestacional menor de 20 semanas es el primero que se informa en nuestro medio y sus resultados son similares a los obtenidos en otros reportes que aparecen en la literatura. Eighty tour spontaneous abortion products, with gestational age under 20 weeks, were collected in ditterent obstetric and gynecologic services trom Medellin-Colombia between September 1996 and October 1997; they were studied both morphologically and cytogenetically. Sixteen of those products were discarded because of contamination or absence of suitable tissues for the study In 60 of the remaining 68 products (88°/~ cultures for cytogenetic studies were establishedJ and they were succesful in 34 cases (56J7%. Seventeen of. these (50% showed an abnormal karyotype with the following chromosomal anomalies: X monosomies 10 (58J8%, mosaicisms 5 (29,4%J trisomies 1 (5,9%, and tetráploidy 1 (5J9%. From the 68 products, a morphologic study was performed in 21 cases (3 embryos and 18 fetuses. Twelve products (2 embryos and 10 fetuses; 57 J 1 % had external and/or jnternal anomalies This study of spontaneous abortions with gestational age under 20 weeks is the first in our country, and its results are similar to those published from other centers.

  20. Aerobic bacterial microflora of Broad-snouted caiman (Caiman latirostris oral cavity and cloaca, originating from Parque Zoológico Arruda Câmara, Paraíba, Brazil Microflora bacteriana aeróbica da cavidade oral e cloaca de jacaré-de-papo-amarelo (Caiman latirostris procedentes do Zoológico de João Pessoa, PB, Brasil

    Directory of Open Access Journals (Sweden)

    J.S.A. Silva

    2009-03-01

    Full Text Available The objective of this study was to isolate and identify the aerobic bacterial microflora from the oral cavity mucosa and cloaca's samples, collected from Broad-snouted caiman (Caiman latirostris, born and bred in captivity at Parque Zoológico Arruda Câmara, João Pessoa, Paraíba, Brazil. The most common bacteria were Staphylococcus sp. (14.74%, Corynebacterium sp. (13.68%, Escherichia coli (13.68% and Shigella sp. (11.58%, and the less common were Citrobacter sp. (1.05%, Klebsiella pneumoniae (1.05% and Salmonella sp. (1.05%.This emphasizes the importance of these microorganisms' participation in infectious processes (sepsis and injuries caused by crocodilians.O presente estudo teve como objetivo isolar e identificar a microflora bacteriana aeróbica presente na mucosa da cavidade oral e da cloaca de exemplares de jacarés-de-papo-amarelo (Caiman latirostris nascidos e criados em cativeiro no Parque Zoológico Arruda Câmara, localizado na cidade de João Pessoa - PB. As bactérias mais freqüentes foram Staphylococcus sp. (14,74%, Corynebacterium sp.(13,68%, Escherichia coli (13,68% e Shigella sp. (11,58%, e as menos prevalentes foram Citrobacter sp.(1,05%, Klebsiella pneumoniae (1,05% e Salmonella sp. (1,05%. Ressalta-se a importância da participação desses microrganismos em processos infecciosos (septicemias e em feridas provocadas por crocodilianos.

  1. Polarographic determination of Iodide and Iodate, in Solutions Coming from Aerosols in Fission Products Containment Studies in Nuclear Power Stations; Determinacion Polarografica de Especies de Iodo (Ioduro y Iodato) en Soluciones Procedentes de Aerosoles, para Estudios de Contencion de Productos de Fision en Centrales Nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, M.; Ballesteros, O.; Fernandez, M.; Clavero, M.; Gonzalez, A. M. [Ciemat, Madrid (Spain)

    2000-07-01

    A polarographic method is described for the iodine species determination, iodide and iodate in water solutions. the iodate can be determined by differential pulse polarography. Calibration curves and the detection and determination limits have been obtained. Iodides is oxidized to iodate with sodium hypochlorite and the excess of oxidizing agent is destroyed with sodium sulphide. The concentration of iodide is calculated as the difference between the concentration of iodate in the sample before and after the oxidation. As an application, species of iodine in samples coming from the experimental plants GIRS (Gaseous Iodine Removal by Sprays) of Nuclear Fission Department of the CIEMAT, dedicated to fission products containment studies in nuclear power station, were determined. (Author) 10 refs.

  2. Disposal into the Sea and into Geological Structures of Wastes Resulting from the Peaceful Uses of Atomic Energy; Rejet en Mer et dans les Formations Geologiques de Dechets Provenant des Utilisations Pacifiques de l'Energie Atomique; 0423 0414 ; Eliminacion en el Mar y en Estructuras Geologicas de Desechos Procedentes del Uso Pacifico de la Energia Atomica

    Energy Technology Data Exchange (ETDEWEB)

    Carritt, Dayton E. [Department of Oceanography, Johns Hopkins University, Baltimore, MD (United States)

    1960-07-01

    Practices which lead to safe disposal of radioactive wastes permit the return of the wastes to man only at levels below maximum permissible concentrations, and do not prevent the development of resources which in the absence of disposal could make a significant contribution to man's well-being. The design of safe disposal procedures for any selected marine location is at present limited by our knowledge of several parts of the system which is involved in the return of radioactivity from the disposal site to man. Because of our present lack of knowledge, disposal procedures now being considered in the United States contain an unknown amount of ''over-design'' and, although they are believed to be conservative, are not unduly restrictive at present levels of waste generation. A better understanding of (a) turbulent mixing processes in the oceans, (b) the physical and chemical states of waste-product elements when in equilibrium with sea-water, and (c) the interaction of waste-product elements with the marine biota, their biological half-life, and the extent of their concentration or rejection by marine organisms in all trophic levels, will provide the basis for a more efficient and safer utilization of the marine environment for the disposal of radioactive wastes. (author) [French] Les pratiques qui assurent une elimination sans danger des dechets radioactifs ne permettent le retour de ces dechets a l'homme qu'a des activites d'un niveau inferieur aux concentrations maxima tolerees et n'empechent pas le developpement de ressources qui, en l'absence de toute elimination, pourraient constituer une contribution importante au bien-etre de l'homme. La mise au point de procedes d'evacuation pour tout endroit choisi de la mer est a present limitee par le niveau de nos connaissances en ce qui concerne plusieurs elements du processus par lequel la radioactivite des dechets retourne vers l'homme. Du fait qu'a l'heure actuelle ces connaissances sont insuffisantes, les procedures d'evacuation que l'on examine aux Etats-Unis sont elaborees pour faire face a un nombre inconnu d'eventalites, et, bien qu'elles soient considerees comme prudentes, elles ne sont pas restrictives outre mesure vu l'activite des dechets produits a l'heure actuelle. L'utilisation plus efficace et moins dangereuse du milieu marin pour l'evacuation des dechets radioactifs ne pourra etre realisee que grace a une connaissance de base plus approfondie: a) des processus de melange turbulent dans les mers; b) des etats physique et chimique des elements composant les dechets lorsqu'ils se trouvent en etat d'equilibre avec l'eau de mer; c) de l'interaction entre les elements de dechets et la faune et flore marines; des taux de concentration ou d'elimination de ces elements par les organismes marins a tous les niveaux trophiques ainsi que de leur periode biologique. (author) [Spanish] Gracias a los procedimientos de evacuacion sin riesgos de desechos radiactivos se consigue que estos lleguen al hombre en un grado de concentracion inferior al maximo admisible, y no se impide el desarrollo de recursos que podrian contribuir en gran medida al bienestar de la humanidad. Actualmente, la preparacion de procedimientos de evacuacion sin riesgos en una zona marina determinada se ve limitada por el escaso conocimiento que poseemos de algunas de las etapas del proceso mediante el cual la radiactividad pasa del lugar de la evacuacion al hombre. A consecuencia de ello, los procedimientos de evacuacion que se estudian en los Estados Unidos de America se caracterizan por un exceso de prudencia y aunque se les considera moderados, no son exageradamente restrictivos con respecto, al nivel actual de acumulacion de desechos. Para llegar a una utilizacion mas eficaz y sin riesgos del mar como lugar de evacuacion de desechos radiactivos sera preciso conocer mejor: a) los procesos de mezcla turbulenta en los oceanos, b) el estado fisico y quimico de los elementos constitutivos de los productos de desecho cuando estan en equilibrio con el agua del mar, y c) la accion reciproca de esos elementos con la fauna y la flora marina, el grado de concentracion o expulsion por organismos marinos en todos los niveles troficos, asi como el periodo biologico de los elementos. (author) [Russian] Praktika, svjazannaja s bezopasnym udaleniem radioaktivnyh othodov, dopuskaet ispol'zovanie chelovekom lish' takih othodov, kotorye imejut aktivnost' nizhe maksimal'no dopustimogo urovnja, i ne prepjatstvuet razvitiju takih resursov, kotorye pri otsutstvii neobhodimosti udalenija radioaktivnosti mogut prinesti cheloveku znachitel'nuju pol'zu. Process bezopasnogo udalenija othodov v ljubom morskom bassejne v nastojashhee vremja ogranichivaetsja nashimi poznanijami nekotoryh storon sistemy, kotoraja vkljuchaet vozvrat radioaktivnyh veshhestv iz mesta zahoronenija obratno v pol'zovanie cheloveka. Iz-za nedostatka neobhodimyh poznanij rassmatrivaemaja v Soedinennyh Shtatah procedura udalenija radioaktivnyh othodov soderzhit mnogo ''raschetov s bol'shim zapasom'' i, hotja jeta procedura schitaetsja konservativnoj, ona ne zrja javljaetsja ogranichitel'noj pri sushhestvujushhem urovne aktivnosti obrabatyvaemyh othodov. Luchshee ponimanie : a) processov turbulentnogo smeshenija v okeanah') fizicheskogo i himicheskogo sostojanija jelementov produktov othodov pri ravnovesii s morskoj vodoj i s) vzaimodejstvija jelementov produktov othoda s podvodnoj biosferoj, rasprostranenija koncentracii ili otrazhenija i biologicheskogo poluraspada jelementov s uchastiem podvodnyh zhivyh organizmov pri vseh troficheskih urovnjah - obespechat osnovu bolee jeffektivnogo i bezopasnogo ispol'zovanija podvodnoj sredy dlja udalenija radioaktivnyh othodov. (author)

  3. Desarrollo de un método analítico para la cuantificación de acrilamida en tostadas de tortillas de maíz procedentes de Monterrey (México) y estimación de la exposición dietética

    OpenAIRE

    Santos Lara, Mirna Elizabeth

    2017-01-01

    La acrilamida es una molécula muy polar altamente soluble en agua. Es un compuesto neurotóxico, genotóxico y carcinógeno, catalogado como probable carcinógeno para humanos por la Agencia Internacional de Investigación en Cáncer. En el 2002 se reportó presencia de niveles muy altos de acrilamida en alimentos ricos en carbohidratos cuando son sometidos al proceso de cocción por horneado, fritura, tostados o asado por encima de 120 °C. Este hallazgo generó gran preocupación a nivel mundial por e...

  4. Desarrollo de un método analítico para la cuantificación de acrilamida en tostadas de tortillas de maíz procedentes de Monterrey (México) y estimación de la exposición dietética /

    OpenAIRE

    Santos Lara, Mirna Elizabeth,

    2017-01-01

    Departament responsable de la tesi: Departament de Ciència Animal i dels Aliments. La acrilamida es una molécula muy polar altamente soluble en agua. Es un compuesto neurotóxico, genotóxico y carcinógeno, catalogado como probable carcinógeno para humanos por la Agencia Internacional de Investigación en Cáncer. En el 2002 se reportó presencia de niveles muy altos de acrilamida en alimentos ricos en carbohidratos cuando son sometidos al proceso de cocción por horneado, fritura, tostados o as...

  5. Determinación de elementos minoritarios, traza y ultratraza en biopsias procedentes de pacientes con diferentes patologías tumorales mediante ETAAS, ICP-OES e ICP-MS utilizando extracción asistida por ultrasonidos y multigestión de bajo volumen

    OpenAIRE

    Millos Alfeiran, Jorge

    2012-01-01

    El objetivo principal de esta tesis doctoral es la determinación de metales minoritarios, traza y ultratraza en tejidos tumorales humanos mediante el desarrollo de metodologías analíticas adecuadas y robustas que permitan obtener resultados precisos y exactos, de manera que puedan ser aplicadas al análisis de rutina. En este sentido, se ha buscado la solución óptima a cada uno de los problemas planteados. Para llevar a cabo este objetivo se han evaluado la extracción ácida asistida por ult...

  6. Aplicación de la técnica PIXE (Particle Induced X-Ray Emision a la caracterización no destructiva de una pieza de ajuar funerario (siglo I d.c. procedente de una excavación arqueológica (antiguo Hospital de las Cinco Llagas, Sevilla

    Directory of Open Access Journals (Sweden)

    Enrique Magariño, M. E.

    2002-12-01

    Full Text Available In this work, a non-destructive characterization of a burial-sample object dated S.I. a.C. (ring with an incrusted material coming from an archaeological excavation (former Hospital de las Cinco Llagas, Sevilla has been carried out. The glass or ceramic nature of this sample was unknown. Several non-destructive techniques have been applied: optical microscopy, SEM-EDX, XRD and XRF. In this particular case, the technique Particle Induced X-ray Emision (PIXE has been also applied. PIXE allows to obtain a fast information concerning chemical composition of trace elements using the object directly. The study of this interesting object indicates the extreme quality and accurance of the engrave observed on its surface, for instance a long-legged bird and a palm leaf despite their reduced size. Relief effects have been observed in the engrave using the own constitution of this particular material. The XRD phase analysis demonstrates that crystalline quartz as single phase constitutes the incrusted material of the ring considered as a gem: blue quartz. The chemical composition obtained from XRF analysis confirm the XRD result, with Si and O as main elements, although there are minoritary elements such as Ca and Fe (< 1,5 %, Na and Al (ca. 0,3 %. Other elements, such as Cl, K and P were detected in similar percentages (0.2-0,25 %, besides Mg and S (less than 0,08 %. However, the application of the PIXE technique based on ion beam analysis to this material allowed to demonstrate the presence of Ti and V, probably as ions in the quartz crystal structure which constitutes the gem. This experimental fact would then explain the blue colour observed in the gem. Consequently, PIXE as a non-destructive technique allows to find an important chemical difference between zones of the same object. There are some advantages, first of all that these chemical differences can not be accurately observed using other conventional techniques and secondly, the analysis is performed directly on the object, which is very interesting in studies on glass and ceramics samples of the Cultural Heritage.

    En el presente trabajo se ha realizado la caracterización de una pieza de ajuar funerario del Siglo I d.C. (anillo con pieza incrustada y grabada, encontrado en una excavación arqueológica en el antiguo Hospital de las Cinco Llagas de Sevilla, de la que inicialmente se desconocía su naturaleza cerámica o vítrea, utilizando las posibilidades que brindan una serie de técnicas instrumentales no destructivas ampliamente conocidas, como son microscopía óptica convencional, MEB-EDX, DRX y FRX. En este caso concreto se ha aplicado, además, la técnica de Emisión de Rayos X inducidos por partículas (Particle Induced X-ray Emision, PIXE. Dicha técnica permite extraer información de la composición química de una muestra para un análisis rápido de múltiples elementos traza. El estudio de esta interesante pieza pone de manifiesto la extrema calidad y precisión de la talla de las figuras o motivos, en particular algunos de ellos (garza y palma a pesar del tamaño reducido de la misma, con efectos de relieve en el tallado del material aprovechando su propia constitución. El análisis de fases por DRX indica que la única fase cristalina constituyente del material es cuarzo y puede considerarse la pieza estudiada como una gema: cuarzo azul. La composición química de la gema determinada por FRX ha permitido comprobar que además de los elementos mayoritarios (Si y O, existen otros minoritarios, como son Ca y Fe (< 1,5 %, Na y Al (próximos al 0,3 %; otros elementos como Cl, K y P aparecen en porcentajes similares (0.2-0,25 %, además de Mg y S en porcentajes inferiores (ca. 0,08 %. Sin embargo, la aplicación de la técnica PIXE basada en haces de iones ha permitido determinar la presencia de Ti y V en la gema, lo que explicaría su coloración azul. Estos elementos deben encontrarse en forma iónica formando parte de la estructura cristalina del cuarzo. En consecuencia, esta técnica no destructiva permite encontrar una diferencia química importante entre zonas de una misma pieza, que no se aprecian mediante la aplicación de técnicas convencionales, con la ventaja añadida de utilizar directamente el objeto del análisis.

  7. Manifestações cutâneo-mucosas da coccidioidomicose: estudo de trinta casos procedentes dos estados do Piauí e Maranhão Skin and mucous membrane manifestations of coccidioidomycosis: a study of thirty cases in the Brazilian states of Piauí and Maranhão

    Directory of Open Access Journals (Sweden)

    Antônio de Deus Filho

    2010-02-01

    Full Text Available FUNDAMENTOS: A coccidioidomicose é micose sistêmica usualmente manifesta como infecção benigna de resolução espontânea; porém, uma pequena proporção dos infectados desenvolve quadros progressivos potencialmente fatais, podendo atingir a pele com lesões pleomórficas disseminadas. OBJETIVOS: Identificar e descrever as manifestações cutâneo-mucosas da coccidioidomicose, as ocupações de risco relacionadas à doença e o quadro clínico associado. MÉTODOS: Estudo realizado entre os anos 2003 e 2006 em 30 pacientes portadores de coccidioidomicose provenientes dos estados do Piauí e Maranhão e diagnosticados por exame microscópico direto, cultivo do escarro ou sorologia de triagem de imunodifusão dupla em gel de ágar, aliados à anamnese e exame físico. RESULTADOS: Identificaram-se lesões extrapulmonares em 13 casos (43,3%, com predomínio de manifestações dermatológicas de hipersensibilidade: eritema nodoso (26,6%, exantema com lesões eritemato-escamosas (26,6% e eritema multiforme (23,3%, além de úlceras de língua (13,3% e lábio (6,6% e abscesso subcutâneo (3,3%. Tais manifestações foram observadas na fase aguda da doença. CONCLUSÕES: As manifestações cutâneas associadas à infecção respiratória aguda fortalecem a hipótese diagnóstica desta doença, especialmente, em caçadores de tatus ou pessoas expostas à escavação do solo.BACKGROUND: Coccidioidomycosis is a systemic mycosis that usually presents as a benign infection. Patients generally recover spontaneously; however, a small proportion of infected individuals develop progressive complications that may affect the skin in the form of disseminated pleomorphic lesions and may become fatal. OBJECTIVES: To identify and describe skin and mucous membrane manifestations of coccidioidomycosis, to identify occupational hazards associated with the disease and to determine its associated clinical presentation. METHODS: A study conducted between 2003 and 2006 involving 30 patients from the Brazilian states of Piauí and Maranhão with coccidioidomycosis diagnosed by direct microscopy, sputum culture or screening serology using agar gel double immunodiffusion, in association with anamnesis and physical examination. RESULTS: Extrapulmonary lesions were found in 13 cases (43.3%, consisting predominantly of dermatological manifestations of hypersensitivity: erythema nodosum (26.6%, exanthema with erythematosquamous lesions (26.6% and erythema multiforme (23.3%, as well as ulcerations of the tongue (13.3%, lip ulcers (6.6% and subcutaneous abscess (3.3%. These manifestations were seen during the acute phase of the disease. CONCLUSIONS: Skin manifestations associated with an acute respiratory infection reinforce the hypothesis of a diagnosis of coccidioidomycosis, particularly in individuals who hunt armadillos or in those exposed to soil excavation.

  8. The preparation of nucleotides uniformly labelled with carbon-14 by biosynthetic methods. Isolation of adenylic, uridylic, cytidylic,and guanylic acids, from the alkaline hydrolysate of escherichia coli RNA; Preparacion de nucleiotidos uniformemente marcados con 14{sup C}, por via biosintetica. Aislamiento de los acidos adenilico, uridilico, citidilico y guanilico, procedentes de la hidrolisis alcalina de RNA de escherichia Coli.

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Pineda, M D; Pacheco Lopez, J

    1978-07-01

    A method is described for the preparation and analysis of adenylic, uri dilic, cytidi- 11c and guanylic acids, labelled with 14{sup C}. Escherichia coli cells have been labelled by growing them in a medi dia containing glucose-14{sup C} as their only source of carbon. RNA is isolated from the cells, and after hydrolysis of the molecule the resulting nucleotides are separated by gel filtration and exchange chromatography. Chemical and radiochemical purity of the Isolated nucleotides is determined, and also its specific radioactivity. (Author) 30 refs.

  9. Identification of the source of histoplasmosis infection in two captive maras (Dolichotis patagonum from the same colony by using molecular and immunologic assays Identificación de la fuente de infección de histoplasmosis de dos maras (Dolichotis patagonum cautivas procedentes de la misma colonia, utilizando ensayos moleculares e inmunológicos

    Directory of Open Access Journals (Sweden)

    M. R. Reyes-Montes

    2009-06-01

    Full Text Available Histoplasma capsulatum was isolated from the spleen of a first infected mara (Dolichotis patagonum and from a second mara's liver and adrenal gland, both in the same colony at the Africam Safari, Puebla, Mexico. Studies of H. capsulatum isolates, using nested-PCR of a 100-kDa protein coding gene (Hcp100 fragment and a two-primer RAPDPCR method, suggest that these isolates were spreading in the environment of the maras' enclosure. By using a Dot- ELISA method, sera from mice inoculated with three homogenates of soil samples from the maras' enclosed space developed positive brown spot reactions to a purified H. capsulatum antigen, which identified the probable source of the maras' infection.Histoplasma capsulatum fue aislado del bazo de una primera mara (Dolichotis patagonum infectada y del hígado y la glándula suprarrenal de un segundo ejemplar, ambos de la misma colonia en el Africam Safari, Puebla, México. Los estudios de los aislamientos de H. capsulatum mediante PCR anidada para un fragmento del gen Hcp100 que codifica una proteína de 100 kDa y RAPD-PCR empleando doble iniciador sugieren que estos aislamientos estaban dispersos en el ambiente del refugio de las maras. Los sueros de ratones inoculados con tres homogenatos de muestras de suelo del refugio desarrollaron reacciones positivas a un antígeno purificado de H. capsulatum (manchas color castaño oscuro por el método de Dot-ELISA; con lo cual se identificó la probable fuente de infección de las maras.

  10. Production of glass-ceramic materials obtained from sewage sludge treatment plant for urban wastewater in El-Sadat city (Egypt); Materiales vitroceramicos a partir de lodos procedentes de una estacion de depuracion de aguas residuales urbanas (en la Ciudad de El-Sadat, Egipto).

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Valles, M.; Aly, M. H.; El-Fadaly, E.; Hafez, H. S.; Nogues, J.; Martinez, S.

    2011-07-01

    Urban wastewater security is a source of significant volumes of sludge which is to be managed. This paper presents the possibility of applying a management process based on vitrification and by which, in addition to inert contaminants in sludge, you get a ceramic material with a significant added value. As a base of different analysis of the sludges, chemical (XRF), mineralogical (XRD) and thermal (DTA-TG), we obtain the original glass composition and its energy. By DTATG, dilatometry and SEM, it was determined the temperature of maximum nucleation rate, growth temperature and the morphology and size of developed nuclei, in this case are nano scale. Briefly, it was found as the management of municipal solid waste by vitrification as an alternative to landfills and incineration. (Author)

  11. EVALUACION DEL POTENCIAL DE LOS BIOSÓLIDOS PROCEDENTES DEL TRATAMIENTO DE AGUAS RESIDUALES PARA USO AGRÍCOLA Y SU EFECTO SOBRE EL CULTIVO DE RABANO ROJO (Raphanus sativus L.. EVALUATION OF THE POTENTIAL FOR BIOSOLIDS OBTAINED FROM WASTEWATER TREATMENT FOR AGRICULTURAL USE AND THEIR EFFECT ON CULTIVATION OF RED RADISH (Raphanus sativus L.

    Directory of Open Access Journals (Sweden)

    Ramiro Ramírez Pisco

    2006-12-01

    Full Text Available El trabajo se adelantó en predios de la planta de tratamiento de aguas residuales “El Salitre”, en la ciudad de Bogotá, con el propósito de evaluar el potencial del subproducto del tratamiento de aguas residuales “biosólido”, para su aplicación en la agricultura por medio de la valoración del crecimiento, desarrollo y producción del cultivo de rábano rojo, y establecer una posible alternativa al problema de disposición final de 3900 toneladas de este material generado mensualmente en las planta de tratamiento de aguas. El diseño experimental empleado correspondió a bloques completos al azar, con cinco tratamientos y tres repeticiones, dispuesto en parcelas de 2 m x 2 m. Los tratamientos correspondieron a mezclas de biosólidos con suelo en las siguientes proporciones: 100 % biosólido (equivalente a 294 ton ha-1, 75 % biosólido (220 ton Ha-1, 50 % biosólido (147 ton ha-1, 25 % biosólido (73 ton ha-1 y 100 % suelo como control. Se sembró rábano rojo Raphanus sativus L. Las variables evaluadas fueron: porcentaje de germinación, peso seco de hojas y raíz, longitud de la planta, área foliar y producción. Además, se midió la acumulación de elementos traza en los rábanos cosechados, para determinar su riesgo para el consumo. Los resultados evidenciaron que los tratamientos 50 % biosólido y 25 % biosólido, son los que favorecen el crecimiento, desarrollo y producción del cultivo de rábano, mientras que los tratamientos 75 % biosólido y 100% suelo presentaron un menor desarrollo, crecimiento y producción del cultivo. El tratamiento 100% biosólido provoco una baja germinación, además no presentó acumulación en la raíz, que es el producto cosechable. Los niveles de acumulación de metales pesados sobrepasaron los máximos permitidos con el tratamiento 75 % biosólido. Se evidenció como, la utilización del biosólido en la agricultura puede acarrear un gran riesgo, ya que a pesar de presentar una gran cantidad de nutrientes (C, N, P, K, Ca, Na, Fe y Zn y materia orgánica, la presencia de metales pesados, o su inadecuada aplicación, puede ir en detrimento del crecimiento y producción de las plantas de rábano.This study was conducted in waste water treatment plant “The Salitre”, in Bogotá, to evaluate the potential of the waste water treatment subproduct “biosolids”, for application in agriculture by means of quantifying growth, development and production of cultivation of red radish, and to establish a possible alternative to the problem of final disposition of 3900 tons of this material generated monthly in the waste water treatment plant. The experimental design employed was a random blocks design, with five treatments and three replications, arranged in 2 m x 2 m plots. The treatments corresponded to mixtures of biosolids with soil in the following proportions: 100 % biosolid (equivalent to 294 ton Ha-1, 75 % biosolid (220 ton Ha-1, 50 % biosolid (147 ton ha-1, 25 % biosólido (73 ton ha-1 and 100 % soil. Red radish Raphanus sativus L. was planted. The variables evaluated were: germination percentage, dry weight of leaves and roots, plant length, foliar area and production. Also, the accumulation of trace was measured in the harvested radishes, to determine risks of consumption. The results showed that the 50 % biosolid and 25 % biosolid, treatments were those that most favored growth, development and production of cultivation radish, while the 75 % biosolid and 100 % biosolid treatments, showed lower development growth and production of the cultivar. The 100 % biosolid treatment resulted in low germination and also did not show root accumulation, that is the harvested product. The levels of accumulation of heavy metals surpassed the maximum levels with the 75 % biosolid and 100 % biosolid treatment. It was shown that the use of the biosolids in agriculture can produce a great risk, because despite having high nutrient (C, N, P, Ca, Na, Fe y Zn and organic matter content, it also may slow growth and production of radish plants.

  12. Methodology for solving the problem of contamination in pencils of Co-60 from the CNEA (Argentine) for the recharge of the gamma irradiator of the ININ; Metodologia para resolver el problema de contaminacion en lapices de Co-60 procedentes del CONEA (Argentina) para la recarga del irradiador gamma del ININ

    Energy Technology Data Exchange (ETDEWEB)

    Villarreal B, J.E.; Escobar A, L.; Angeles C, A.; Cruz G, H.S

    1992-07-15

    Presently report the methodology used to identify the source of contamination detected in a shipment with 5.0 X 10 Bq of Co-60 coming from Argentina is described, as well as the solution outlined to solve the problem. Its are presented by way of conclusion the experiences but outstanding learned in the process. (Author)

  13. Vitamina C, carotenoides, fenólicos totais e atividade antioxidante de goiaba, manga e mamão procedentes da Ceasa do Estado de Minas Gerais = Vitamin C, carotenoids, phenolic compounds and antioxidant activity of guava, mango and papaya from Ceasa of Minas Gerais State

    Directory of Open Access Journals (Sweden)

    Daniela da Silva Oliveira

    2011-01-01

    Full Text Available Este estudo teve como objetivo analisar o conteudo de compostos antioxidantes (acido ascorbico - AA, acido desidroascorbico - ADA, vitamina C total, licopeno, £]-caroteno, £]-criptoxantina e estimativa de compostos fenolicos e avaliar a atividade antioxidante, em goiaba, manga e mamao. A analise de carotenoides e vitamina C foi realizada por Cromatografia Liquida de Alta Eficiencia (CLAE. O teor de fenolicos totais foi determinado utilizando o reagente de Folin-Ciocalteu e leitura espectrofotometrica. A atividade antioxidante foi avaliada pelo Teste do 2,2-diphenil-2-picril-hidrazil (DPPH¡E e do Poder Redutor. A Anova (ƒÑ = 0,05 foi utilizada para a analise dos dados. Os teores dos constituintes antioxidantes diferiram entre as tres frutas, mas a goiaba foi a fruta que apresentou teores mais elevados de compostos fenolicos, vitamina C total, ADA e licopeno, alem dos maiores valores para atividade antioxidante. Foi constatada forte correlacao entre os testes que avaliaram a atividade antioxidante e o teor de fenolicos totais, demonstrando serem estes os principais compostos antioxidantes a contribuirem para a atividade antioxidante das frutas analisadas, em ambos os testes. E importante incentivar a utilizacao das frutas avaliadas neste estudo, tanto em nivel domestico quanto em estabelecimentos de alimentacao coletiva para aumentar o consumo de antioxidantes naturais pela populacao.This study aimed to analyze the content of antioxidant compounds (ascorbic acid - AA, dehydroascorbic acid - DHA, total vitamin C, lycopene, £]-carotene, £]-cryptoxanthin and phenolic compounds and to evaluate the antioxidant activity in guava, mango and papaya.The analysis of carotenoids and vitamin C was performed by high performance liquid chromatography (HPLC. The content of phenolic compounds was determined using the Folin-Ciocalteu reagent and spectrophotometric reading. Antioxidant activity was evaluated by testing the 2.2-diphenyl-2-picryl-hydrazil (DPPH¡E and reducing power. ANOVA was used for data analysis (ƒÑ = 0.05. The levels of antioxidant constituents differed among the three fruits; guava was the fruit that had the highest levels of phenolic compounds, totalvitamin C, lycopene and DHA, and the highest values for antioxidant activity. There was a strong correlation between tests that evaluated antioxidant activity and the content of phenolic compounds, demonstrating that these are the main antioxidant compounds tocontribute to antioxidant activity of fruits examined in both tests. It is important to encourage the use of fruits evaluated in this study, both at home and in food service establishments, in order to increase the intake of natural antioxidants by the population.

  14. "Hippolytvs": a study of a new fishing mosaic with an inscription found at Complutum, Alcalá de Henares, Madrid | "Hippolytvs": estudio de un nuevo mosaico del género de pesca y con inscripción procedente de Complutum, Alcalá de Henares, Madrid

    Directory of Open Access Journals (Sweden)

    Sebastián Rascón Marqués

    1998-12-01

    Full Text Available The House of Hippolytus is a building at Complutum outskirts, whose functional characters is yet unknown, but can be of leisure kind. The floor of the principal hall is a mosaic made by two different teams: one of Hispanic roots, that do the geometric ground, and the other of African source, that do the emblema. This one has one text with the author's name and his relationship with the Anios family: «Hipolito, who belong to the Anios, has made this mosaic». The emblema shows a picture about fishing, from the common African kind of III and IV centuries. We purpose for the mosaic the same date that for the rest of the building in this phase: end of III century or IV century A.D., like the one detected at most of the carved Complutum buildings. | La Casa de Hippolytus es un edificio de la periferia de Complutum, cuya funcionalidad aún por definir, apunta hacia un uso lúdico. Se presenta aquí el mosaico que pavimenta una gran sala de distribución, mosaico ejecutado por dos equipos distintos, uno de raigambre hispánica, autor del campo geométrico, y otro de formación norteafricana encargado de la confección del emblema, y del que conservamos una inscripción que indica la autoría del mosaico y la relación de dependencia del maestro musivario respecto a la familia de los Anios: «Hipólito, que pertenece a los Anios, ha teselado este mosaico». El emblema reproduce una escena de pesca, del tipo que es habitual en el Norte de África en los siglos III y IV. La cronología que proponemos para el mosaico es la misma que para el resto de la edificación en esta su segunda fase: finales del siglo III o siglo IV d.C., lo que coincide con la cronología detectada en la mayor parte de los establecimientos complutenses que se han excavado.

  15. Rapid diagnosis and identification by PCR of Yersinia ruckeri isolated of Oncorhynchus mykiss from Canta, Lima, Peru Diagnóstico e identificación rápidos por PCR de Yersinia ruckeri aislada de Oncorhynchus mykiss procedentes de Canta, Lima, Perú

    Directory of Open Access Journals (Sweden)

    Susana Sirvas-Cornejo

    2012-02-01

    Full Text Available Twenty individuals of rainbow trout were sampled (fry and juveniles from Acochinchan Fishfarm (Canta, Lima - Peru, and analyzed with the Polimerase Chain Reaction test (PCR in order to achieve a rapid identification of Yersinia ruckeri, which is the pathogen agent that causes the enteric red mouth disease (ERM and produces high rates of mortality. Nine fish samples were asymptomatic, while 11 of them showed signs of ERM. In addition, 22 bacterial strains were isolated from the liver, spleen and kidney. PCR and specific primers (16S rRNA, were used to amplified a specific 575 bp DNA fragment of Yersinia ruckeri. Nineteen strains were identified as Yersinia ruckeri by PCR in symptomatic and asymptomatic fishes. It was established a diagnosis time of 26 hours, compared with the 2 or 3 days that would take the diagnosis using biochemical tests.Se muestrearon 20 ejemplares (alevines y juveniles de trucha arco iris cultivados en la piscifactoría Acochinchán (Canta, Lima, Perú, y se les aplico la técnica de la Reacción en Cadena de la Polimerasa (PCR con la finalidad de obtener una identificación rápida del agente patógeno Yersinia ruckeri que produce la enfermedad entérica de la boca roja (ERM y genera elevadas tasas de mortalidad. Nueve ejemplares fueron asintomáticos mientras que 11 presentaron signos de ERM. Se aislaron 22 cepas bacterianas del hígado, bazo y riñón. Se empleó la técnica de la PCR para la amplificación y cebadores específicos (ARNr 16S, que permitieron amplificar un fragmento de ADN de 575 pb de Yersinia ruckeri. Diecinueve cepas fueron identificadas como Yersinia ruckeri mediante la PCR, tanto en peces sintomáticos como asintomáticos. Se estableció un tiempo de diagnóstico de 26 horas, en comparación con los 2 ó 3 días que duraría el diagnóstico empleando las pruebas bioquímicas.

  16. The Time Analysis and Frequency Distribution of Caesium-137 Fall-Out in Muscle Samples; Analyse en Fonction du Temps et Distribution des Frequences de Cesium 137 du aux Retombees de Cesium 137 Contenues dans des Echantillons de Tissu Musculaire; 0410 041d 0414 ; Analisis Temporal y Distribucion de Frecuencias del Cesio-137 Procedente de la Precipitacion Radiactiva en Muestras de Tejido Muscular

    Energy Technology Data Exchange (ETDEWEB)

    Ellett, W. H.; Brownell, G. L [Physics Research Laboratory, Massachusetts General Hospital, Boston 14, MA (United States)

    1964-11-15

    For low concentrations of artificial radioactivity in the body, detrimental effect will be most likely in that fraction of the population having many times the average amount. A meaningful evaluation of the nuclear fall-out hazard can only be made if the frequency distribution of radioactivity in the population is known. Attempts to determine the shape of the distribution curve from Kulp's data on strontium-90 concentration in children's bones have met limited success because of the small sample size and lack of strontium-90-calcium equilibrium in bone. To overcome these limitations, we have measured the caesium-137 content in approximately 900 muscle samples. These tissue samples were removed during post-mortem operations from January 1959 to August 1963. The use of caesium-137 as a fission product monitor assures that all members of the group, regardless of their age, were essentially in equilibrium with the radioactive environment at the time of death. The period of investigation coincides with the first weapon test moratorium and the resumption of large- scale testing in the fall of 1961. Average caesium-137 in the samples was relatively constant throughout 1959, decreased a factor of two during 1960, and remained relatively stable until the early summer of 1962. Since mid-1962 the average level of caesium-137 radioactivity in the sample population has steadily increased and was four times greater than the 1962 minimum by the summer of 1963. Time-independent histograms of the data have been assembled by fitting a polynomial to the raw data (sample radioactivity as a function of data of death). This pooled data has been tested statistically against normal, log-normal, and gamma frequency distributions. Results indicate that the experimental distribution is definitely not Gaussian and is best fitted by a gamma distribution. By using the empirically derived gamma distribution it is possible to predict the fraction of the population having N times the average activity for any level of fall-out. We have tested this model for the fourfold increase in activity since mid-1962 and have found it to predict accurately the present distribution of caesium-137 radioactivity between individual members of the sample population. (author) [French] Les faibles concentrations de radioactivite artificielle dans l'organisme risquent d'avoir des effets nuisibles dans une population surtout pour les individus chez qui cette concentration atteint une valeur plusieurs fois superieure a la moyenne. On ne peut estimer valablement les dangers dus aux retombees radioactives que si l'on connait la loi de frequence de la radioactivite dans la population. Les tentatives faites pour determiner la forme de la courbe de frequence a partir des donnees de Kulp sur la concentration du strontium 90 dans les tissus osseux d'enfants n'ont abouti qu'a des resultats limites en laison de la petite taille de'l'echantillon et de l'absence d'equilibre entre le strontium 90 et le calcium dans ces tissus. Pour y remedier, les auteurs ont dose le cesium 137 d'environ 900 echantillons de tissus musculaires. Ces echantillons avaient ete preleves a l'occasion d'autopsies pratiquees entre janvier 1959 et aout 1963. En utilisant le cesium 137 comme indicateur des produits de fission, on s'assure que tous les individus du'groupe, quel que fut leur age, etaient essentiellement en equilibre avec la radioactivite ambiante au moment de leur deces. L'enquete a ete faite pendant la periode correspondant a la premiere interruption des essais d'engins nucleaires et a la reprise en grand de ces essais a l'automne 1961. La teneur moyenne en cesium 137 des echantillons de tissus musculaires est restee relativement constante durant toute l'annee 1959, puis a diminue d'un facteur de deux en 1960 et est demeuree relativement stable jusqu'au debut de l'ete 1962. A partir de juillet 1962, le niveau moyen de la radioactivite due au cesium 137 dans la population d'echantillons a continuellement augmente et, en ete 1963, a atteint le quadruple du niveau minimum de 1962. On a etabli des histogrammes independants du temps en ajustant un polynome aux donnees brutes (radioactivite des echantillons en fonction de la date du deces). On a compare statistiquement les donnees ainsi ajustees a une distribution suivant la loi de Laplace-Gauss, a une distribution suivant la loi de Galton et a une distribution gamma. Les resultats indiquent que la distribution experimentale ne suit absolument pas la loi de Laplace-Gauss et qu'elle correspond le mieux a une distribution gamma. En utilisant la distribution gamma deduite empiriquement, on peut prevoir, pour n'importe quelle valeur de la retombee, quelle fraction de la population aura une charge corporelle egale a N fois la valeur moyenne. Les auteurs ont verifie ce modele pour l'augmentation quadruple de l'activite qui s'est produite depuis 1962 et ils ont constate qu'il permettait de prevoir avec precision la distribution actuelle de la radioactivite due au cesium 137 entre les differents membres de la population d'echantillons. (author) [Spanish] Cuando las concentraciones de radiactividad artificial en el cuerpo son bajas, el efecto perjudicial recaera sin duda en aquella parte de la poblacion en la cual la concentracion representa un multiplo del termino medio. Solamente puede evaluarse adecuadamente el riesgo que entranadla precipitacion radiactiva si se conoce la distribucion de frecuencias de la radiactividad en la poblacion. Los intentos para determinar la forma de la curva de distribucion, a partir de los datos de Kulo -sobre ia concentracion del estroncio-90 en los huesos de los ninos no han tenido mucho exito debido al reducido tamaflo de las muestras y a la falta de equilibrio en el hueso entre el estroncio-90 y el calcio. Para superar estas limitaciones, los autores han medido el contenido en cesio-137 de unas 900 muestras en musculos que fueron obtenidas en intervenciones post mortem entre enero de 1959 y agosto de 1963. El empleo del cesio-137 como monitor de los productos de fision aseguro que todos los componentes del grupo, sea cual fuese su edad, estuvieran esencialmente en equilibrio con el ambiente radiactivo que les rodeaba al tiempo de su muerte. El periodo de investigacion coincide con la primera moratoria en los ensayos de armas nucleares y la reanudacion de los mismos en gran escala durante el otofio de 1961. La concentracion media de cesio-137 en las muestras permanecio relativamente constante a lo largo de 1959, disminuyo a la mitad durante 1960 y se mantuvo bastante estable hasta principios del verano de 1962. Desde mediados de este ano, el nivel medio de la radiactividad debida al cesio-137 en la poblacion testigo aumento constantemente y era, en el verano de 1963, cuatro veces mayor que el minimo de 1962. Los histogramss de los datos, tomados con independencia del tiempo, se relacionaron entre sf mediante adecuacion de un polinomio a los datos iniciales (radiactividad de la'muestra en funcion de la fecha de la muerte). Los datos asi ponderados se comprobaron estadisticamente frente a distribuciones de frecuencia normal, logaritmica y gamma, indicando los resultados que la distribucion experimental no es ciertamente gaussiana, sino que se acomoda mejor a una distribucion gamma. Empleando esta distribucion gamma empiricamente deducida, es posible anticipar que fraccion de la poblacion tendra N veces el promedio de actividad para cualquier nivel de precipitacion radiactiva. Los autores han utilizado este modelo para explicar la cuadruplicacion de actividad registrada desde mediados del ano 1962 y comprobado que predice con exactitud la distribucion actual de la radiactividad debida al cesio-137 entre los individuos de la poblacion testigo. (author) [Russian] Pri nizkih koncentracijah iskustvennoj radioaktivnosti v organizme vrednye dlja zdorov'ja jeffekty, po vsej verojatnosti, mozhno obnaruzhit' u toj chasti naselenija, u-kotoroj kolichestvo radioaktivnosti vo mnogo raz prevyshaet srednij uroven'. Dostovernaja ocenka opasnosti ot vypadenija radioaktivnyh osadkov mozhet byt' sdelana tol'ko togda, kogda izvestna chastota raspredelenija radioaktivnosti u naselenija. Popytki opredelit' formu krivoj raspredelenija iz dannyh Kal'pa po koncentracii stroncija-90 v kostjah u detej imeli ogranichennyj uspeh iz-za malogo razmera obrazca i otsutstvija ravnovesija stroncij-90-kalij v kosti. Dlja preodolenija jetih nedostatkov avtory izmerjali soderzhanie cejeija-137 priblizitel'no v 900 obrazcah myshc. Obrazcy tkanej byli vzjaty vo vremja vskrytija trupov s janvarja 1959 po avgust 1963 goda. Ispol'zovanie cezija-137 v kachestve indikatora produktov delenija pokazyvaet, chto vse chleny gruppy, nezavisimo ot ih vozrasta, nahodjatsja v ravnovesii s radioaktivnoj sredoj vo vremja smerti. Period issledovanija sovpal so vremenem pervogo moratorija na ispytanija jadernogo oruzhija i vozobnovlenija ispytanij v bol'shom masshtabe osen'ju 1961 goda. Srednee soderzhanie cezija-137 v obrazcah bylo sravnitel'no postojannym na protjazhenii 1959 goda, ono sokratilos' na dcr porjadka v 1960 godu i ostavalos' sravnitel'no ustojchivym do nachala leta 1962 goda. S serediny 1962 goda srednij uroven' radioaktivnosti cejeija-137 v obrazcah, vzjatyh u naselenija, nepreryvno uvelichivalsja i k letu 1963 goda byl v chetyre raza vyshe minimuma 1962 goda. Byli sostavleny nezavisimye ot vremeni gistogrammy dannyh putem podborki mnogochlenov k priblizitel'nym dannym (obrazec radioaktivnosti kak funkcija daty smerti). Jeti sobrannye vmeste dannye proverjalis' statisticheski pri sravnenii s normal'noj, lognormal'noj i gamma-chastotoj raspredelenija. Rezul'taty pokazyvajut, chto jeksperimental'noe raspredelenie otnjud' ne javljaetsja gaussianom i bolee vsego soglasuetsja s gamma-raspredeleniem. S pomoshh'ju jeksperimental'no poluchennogo gamma-raspredelenija mozhno opredelit' tu chast' naselenija, kotoraja imeet v N chislo raz bol'shuju radioaktivnost', chem srednjaja aktivnost' dlja ljubogo urovnja radioaktivnyh osadkov. Avtory ispytali jetu model' pri chetyrehkratnom uvelichenii aktivnosti s serediny 1962 goda i obnaruzhili, chto mozhno tochno predskazat' sushhestvujushhee raspredelenie radioaktivnosti cezija-137 mezhdu otdel'nymi obrazcami, vzjatymi u naselenija. (author)

  17. Chemical and mineralogical analyses of Roman amphorae from Augustan period recovered at the production center of Sant Antoni de Calonge (Gerona, Spain); Analisis quimico y mineralogico de un conjunto de anforas romanas de epoca augustea procedentes del centro productor de Sant Antoni de Calonge (Gerona)

    Energy Technology Data Exchange (ETDEWEB)

    Vila Socias, L.; Prats Pico, N.; Buxeda Garrigos, J.

    2016-05-01

    Amphorae were the most popular transport vessels used to ship wine and other commodities in Antiquity. This paper reports the results of the analyses of 38 samples of several Roman amphorae types recovered at Calonge (Gerona, Spain). Chemical composition of individuals have been obtained by means of XRF. Equivalent firing temperatures have been estimated by XRD and further refiring experiments have been performed. The results suggest the existence of two different clay pastes among individuals analyzed, most of which were fired at the range 900-1000 degree centigrade. Moreover, it is argued that craftsmen did not follow highly standardized paste preparation process during the first activity period of the workshop. The results are discussed in terms of production technology and standardization. (Author)

  18. The diagnostic activity on wild animals through the description of a ...

    African Journals Online (AJOL)

    The diagnostic activity on wild animals through the description of a model case report (caseous lymphadenitis by Corynebacterium pseudotuberculosis associated with Pasteurella spp and parasites infection in an alpine ibex – Capra ibex )

  19. A Comparative Study of t