Ham radio for dummies

CERN Document Server

Silver, H Ward

2013-01-01

An ideal first step for learning about ham radio Beyond operating wirelessly, today's ham radio operators can transmit data and pictures; use the Internet, laser, and microwave transmitters; and travel to places high and low to make contact. This hands-on beginner guide reflects the operational and technical changes to amateur radio over the past decade and provides you with updated licensing requirements and information, changes in digital communication (such as the Internet, social media, and GPS), and how to use e-mail via radio. Addresses the critical use of ham radio for replacing downe

Parmas diskuteeriti sotsiaaltöö tuleviku üle / Marju Medar

Index Scriptorium Estoniae

Medar, Marju, 1957-

2007-01-01

15.-17. märtsil toimus Itaalias Parmas rahvusvaheline sotsiaaltöötajate konverents "Sotsiaalne muutus ja sotsiaalsed elukutsed", kus käsitleti sotsiaalseid muutusi ühiskonnas ja sotsiaaltöö elukutses. Vt. samas lk. 55-56: IFSW (Rahvusvaheline sotsiaaltöötajate föderatsioon - International Federation of Social Workers) Europe presidendi Hans van Ewijk ülevaade konverentsil käsitletud teemadest

The regional aerosol-climate model REMO-HAM

Directory of Open Access Journals (Sweden)

J.-P. Pietikäinen

2012-11-01

Full Text Available REMO-HAM is a new regional aerosol-climate model. It is based on the REMO regional climate model and includes most of the major aerosol processes. The structure for aerosol is similar to the global aerosol-climate model ECHAM5-HAM, for example the aerosol module HAM is coupled with a two-moment stratiform cloud scheme. On the other hand, REMO-HAM does not include an online coupled aerosol-radiation nor a secondary organic aerosol module. In this work, we evaluate the model and compare the results against ECHAM5-HAM and measurements. Four different measurement sites were chosen for the comparison of total number concentrations, size distributions and gas phase sulfur dioxide concentrations: Hyytiälä in Finland, Melpitz in Germany, Mace Head in Ireland and Jungfraujoch in Switzerland. REMO-HAM is run with two different resolutions: 50 × 50 km² and 10 × 10 km². Based on our simulations, REMO-HAM is in reasonable agreement with the measured values. The differences in the total number concentrations between REMO-HAM and ECHAM5-HAM can be mainly explained by the difference in the nucleation mode. Since we did not use activation nor kinetic nucleation for the boundary layer, the total number concentrations are somewhat underestimated. From the meteorological point of view, REMO-HAM represents the precipitation fields and 2 m temperature profile very well compared to measurement. Overall, we show that REMO-HAM is a functional aerosol-climate model, which will be used in further studies.

Effects of irradiation and fumaric acid treatment on the inactivation of Listeria monocytogenes and Salmonella typhimurium inoculated on sliced ham

Science.gov (United States)

Song, Hyeon-Jeong; Lee, Ji-Hye; Song, Kyung Bin

2011-11-01

To examine the effects of fumaric acid and electron beam irradiation on the inactivation of foodborne pathogens in ready-to-eat meat products, sliced ham was inoculated with Listeria monocytogenes and Salmonella typhimurium. The inoculated ham slices were treated with 0.5% fumaric acid or electron beam irradiation at 2 kGy. Fumaric acid treatment reduced the populations of L. monocytogenes and S. typhimurium by approximately 1 log CFU/g compared to control populations. In contrast, electron beam irradiation decreased the populations of S. typhimurium and L. monocytogenes by 3.78 and 2.42 log CFU/g, respectively. These results suggest that electron beam irradiation is a better and appropriate technique for improving the microbial safety of sliced ham.

Analysis of raw hams using SELDI-TOF-MS to predict the final quality of dry-cured hams

NARCIS (Netherlands)

Marcos, B.; Gou, P.; Serra, X.; Guardia, M.D.; Zhen, Z.Y.; Hortos, M.; Mach Casellas, N.; Pas, te M.F.W.; Keuning, E.; Kruijt, L.; Font I Furnols, M.; Arnau, J.

2013-01-01

The relationship between protein profiles of Gluteus medius (GM) muscles of raw hams obtained from 4 pure breed pigs (Duroc, Large White, Landrace, and Piétrain) with the final quality of the Semimembranosus and Biceps femoris muscles of dry-cured hams was investigated. As expected, Duroc hams

Suppurative otitis and ascending meningoencephalitis associated with Bacteroides tectus and Porphyromonas gulae in a captive Parma wallaby (Macropus parma) with toxoplasmosis.

Science.gov (United States)

Giannitti, Federico; Schapira, Andrea; Anderson, Mark; Clothier, Kristin

2014-09-01

A 6-year-old female Parma wallaby (Macropus parma) at a zoo in California developed acute ataxia and left-sided circling. Despite intensive care, clinical signs progressed to incoordination and prostration, and the animal was euthanized. At necropsy, the left tympanic cavity was filled with homogeneous suppurative exudate that extended into the cranium expanding the meninges and neuroparenchyma in the lateral and ventral aspect of the caudal ipsilateral brainstem and medulla oblongata. Microscopically, the brainstem showed regional severe suppurative meningoencephalitis with large numbers of neutrophils, fewer macrophages, and lymphocytes admixed with fibrin, necrotic cellular debris, hemorrhage, and mineralization, with numerous intralesional Gram-negative bacilli. Bacteroides spp. and Porphyromonas spp. were isolated on anaerobic culture from the meninges, and the bacteria were further characterized by partial 16S ribosomal RNA gene sequencing as Bacteroides tectus and Porphyromonas gulae. Bacterial aerobic culture from the meninges yielded very low numbers of mixed flora and Proteus spp., which were considered contaminants. Culture of Mycoplasma spp. from middle ear and meninges was negative. Additionally, Toxoplasma gondii cysts were detected by immunohistochemistry in the heart and brain, and anti-Toxoplasma antibodies were detected in serum. The genera Bacteroides and Porphyromonas have been associated with oral disease in marsupials; but not with otitis and meningoencephalitis. The results of the present work highlight the importance of performing anaerobic cultures in the diagnostic investigation of cases of suppurative otitis and meningoencephalitis in macropods. © 2014 The Author(s).

Volatile hydrocarbon profile of Iberian dry-cured hams. A possible tool for authentication of hams according to the fattening diet.

Science.gov (United States)

Narváez-Rivas, Mónica; Vicario, Isabel M; Alcalde, M Jesús; León-Camacho, Manuel

2010-06-15

The aims of this work were to carry out a comprehensive study of the volatile hydrocarbons of 34 Iberian dry-cured hams and to evaluate the efficiency of these compounds for discriminating hams according to the fattening system: "Montanera" (B) and "Cebo" (C). The samples of hams were obtained by mincing the semimembranosus and semitendinosus muscles from slices of dry-cured ham. The analyses were carried out by gas chromatography-mass spectrometry with a polar capillary column and after a previous extraction by Purge and Trap method. Forty-three volatile hydrocarbons were identified, 26 of them for the first time in Iberian dry-cured ham. Only five compounds showed significant differences between the two types of hams. Among the 33 volatile hydrocarbons, 22 of them allowed a complete discrimination of the two groups of hams according the fattening system.

Is HAM/3 (hydrogenic atoms in molecules, version 3 a semiempirical version of dft (density functional theory for ionization processes?

Directory of Open Access Journals (Sweden)

Takahata Yuji

2004-01-01

Full Text Available We calculated valence-electron vertical ionization potentials (VIPs of nine small molecules, plus uracil and C2F4, by several different methods: semiempirical HAM/3 and AM1 methods, different nonempirical DFT models such as uDI(B88-P86/cc-pVTZ and -epsilon(SAOP/TZP, and ab initio Hartree-Fock (HF /cc-pVTZ. HAM/3 reproduced numerical values more closely to those calculated by the nonempirical DFTs than to those obtained by HF method. Core-electron binding energies (CEBEs of aniline, nitrobenzene and p-nitro aniline, were also calculated by HAM/3 and nonempirical DFT using DE method. A nonempirical DFT model, designated as deltaE KS (PW86-PW91/TZP model, resulted accurate CEBEs (average absolute deviation of 0.14 eV with high efficiency. Although absolute magnitude of HAM/3 CEBEs has error as much as 3 eV, the error in the chemical shifts deltaCEBE is much smaller at 0.55 eV. While the CEBE results do not lead to any definite answer to the question in the title, the trends in valence-electron VIPs indicate that HAM/3 does not approximate DFT with accurate exchange-correlation potentials, but seems to simulate approximate functionals such as B88-P86.

9 CFR 319.310 - Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar...

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar products. 319.310 Section 319.310 Animals and....310 Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar...

Failure of irradiated beef and ham to induce genetic aberrations of Drosophila

International Nuclear Information System (INIS)

Mittler, S.

1979-01-01

Ham that had been irradiated by electrons and beef which had been exposed to gamma rays from 60 Co were fed to Drosophila melanogaster to determine whether meat sterilized by these methods would induce genetic aberrations. The results showed that for yB/sc 8 y + Y males, fed on irradiated ham or beef, thermally preserved beef or frozen beef for their entire larval life, there was no significant increase in the loss of X or Y chromosomes or non-disjunction of these chromosomes; there was also no significant increase in any of the broods. Similarly for the Oregon R males, there was no significant increase in yield of sex-linked recessive lethals. Thus feeding of irradiated ham and beef to Drosophila males did not induce significant increases in genetic aberrations. The present findings are discussed in relation to the conflicting results of previous studies. (U.K.)

Factors affecting dry-cured ham consumer acceptability.

Science.gov (United States)

Morales, R; Guerrero, L; Aguiar, A P S; Guàrdia, M D; Gou, P

2013-11-01

The objectives of the present study were (1) to compare the relative importance of price, processing time, texture and intramuscular fat in purchase intention of dry-cured ham through conjoint analysis, (2) to evaluate the effect of dry-cured ham appearance on consumer expectations, and (3) to describe the consumer sensory preferences of dry-cured ham using external preference mapping. Texture and processing time influenced the consumer preferences in conjoint analysis. Red colour intensity, colour uniformity, external fat and white film presence/absence influenced consumer expectations. The consumer disliked hams with bitter and metallic flavour and with excessive saltiness and piquantness. Differences between expected and experienced acceptability were found, which indicates that the visual preference of consumers does not allow them to select a dry-cured ham that satisfies their sensory preferences of flavour and texture. Copyright © 2013 Elsevier Ltd. All rights reserved.

Biochemical Basis of Fresh Ham Color Development

OpenAIRE

Stufft, Kristen Marie

2015-01-01

Commercial hams display variation in color uniformity across the cut surface, especially the semimembranosus (SM) muscle. This variation in fresh ham color, or two-toning, persists through further processing and contributes to production of a less desirable end product. In an attempt to understand the underlying source of this color variation, we evaluated the differences in muscle fiber-type composition and glycolytic metabolism in the SM muscle of fresh hams differing in color uniformity. F...

Evaluation of dried salted pork ham and neck quality

Directory of Open Access Journals (Sweden)

Simona Kunová

2015-12-01

Full Text Available The aim of the present study was analysed chemical and physical parameters of dried salted pork ham and neck. Dry-cured meat is a traditional dry-cured product obtained after 12 - 24 months of ripening under controlled environmental conditions.  Ham and neck was salted by nitrite salt mixture during 1 week. Salted meat products were dried at 4 °C and relative humidity 85% 1 week after salting. The quality of dry-cured meat is influenced by the processing technology, for example length of drying and ripening period. The average moisture of dried salted pork ham was 63.77% and dried salted pork neck was 59.26%. The protein content was 24.87% in dried salted pork ham and significantly lower (20.51% in dried salted pork neck. The value of intramuscular fat in dried salted pork ham was 4.97% and 14.40% in dried salted pork neck. The salt content was 5.39% in dried salted pork ham and 4.83% in dried salted pork neck. The cholesterol content was 1.36 g.kg-1 in dried salted pork ham and significant lower in dried salted pork neck (0.60 g.kg-1. The value of lightness was 44.36 CIE L* in dried salted pork ham and significantly lower in dried salted pork neck (40.74 CIE L*. The pH value was 5.84 in dried salted pork ham and 5.80 in dried salted pork neck. The shear work was 9.99 kg.s-1 in dried salted pork ham and 6.34 in dried salted pork neck. The value of water activity (aw was 0.929 in dried salted pork ham and similar 0.921 in dried salted pork neck. 

[The recent advances of HAM/TSP research].

Science.gov (United States)

Osame, M

1999-12-01

The ninth international conference on HTLVs and related disorders was held on April 5-9, 1999 at Kagoshima, Japan under the conference chairperson, Dr. Mitsuhiro Osame. In this meeting, world-wide epidemiological data on HTLV-I carriers, ATL patients, and HAM/TSP patients were summarized as shown in the table. The total number of them was supposed to be more than 2.2 millions, 1,200, and 3,000, respectively. To elucidate the localization of HTLV-I proviral DNA directly, double staining using immunohistochemistry and PCR in situ hybridization in the spinal cords of HAM/TSP patients were performed. HTLV-I proviral DNA was localized only to OPD 4-positive cells (Matsuoka et al, 1998). The localization of HTLV-I messenger RNA was the same (Moritoyo et al, 1996). A novel technique to detect HTLV-I tax protein was also developed. In HAM/TSP patients, 0.04-1.16% of the CSF cells and 0.02-0.54% of PBMCs were positive for HTLV-I tax protein (Moritoyo et al, 1999). It was also hypothesized that HLA alleles control HTLV-I proviral load and thus influence susceptibility to HAM/TSP. Two hundred and thirty-two cases of HAM/TSP were compared with 201 randomly selected HTLV-I seropositive asymptomatic blood donors. It was shown that, after infection with HTLV-I, the class I allele HLA-A*02 halves the odds of HAM/TSP (p doubled the odds of HAM/TSP in the absence of the protective effect of HLA-A*02 (Jeffery and Usuku et al, 1999).

Chemotropism and Cell Fusion in Neurospora crassa Relies on the Formation of Distinct Protein Complexes by HAM-5 and a Novel Protein HAM-14.

Science.gov (United States)

Jonkers, Wilfried; Fischer, Monika S; Do, Hung P; Starr, Trevor L; Glass, N Louise

2016-05-01

In filamentous fungi, communication is essential for the formation of an interconnected, multinucleate, syncytial network, which is constructed via hyphal fusion or fusion of germinated asexual spores (germlings). Anastomosis in filamentous fungi is comparable to other somatic cell fusion events resulting in syncytia, including myoblast fusion during muscle differentiation, macrophage fusion, and fusion of trophoblasts during placental development. In Neurospora crassa, fusion of genetically identical germlings is a highly dynamic and regulated process that requires components of a MAP kinase signal transduction pathway. The kinase pathway components (NRC-1, MEK-2 and MAK-2) and the scaffold protein HAM-5 are recruited to hyphae and germling tips undergoing chemotropic interactions. The MAK-2/HAM-5 protein complex shows dynamic oscillation to hyphae/germling tips during chemotropic interactions, and which is out-of-phase to the dynamic localization of SOFT, which is a scaffold protein for components of the cell wall integrity MAP kinase pathway. In this study, we functionally characterize HAM-5 by generating ham-5 truncation constructs and show that the N-terminal half of HAM-5 was essential for function. This region is required for MAK-2 and MEK-2 interaction and for correct cellular localization of HAM-5 to "fusion puncta." The localization of HAM-5 to puncta was not perturbed in 21 different fusion mutants, nor did these puncta colocalize with components of the secretory pathway. We also identified HAM-14 as a novel member of the HAM-5/MAK-2 pathway by mining MAK-2 phosphoproteomics data. HAM-14 was essential for germling fusion, but not for hyphal fusion. Colocalization and coimmunoprecipitation data indicate that HAM-14 interacts with MAK-2 and MEK-2 and may be involved in recruiting MAK-2 (and MEK-2) to complexes containing HAM-5. Copyright © 2016 by the Genetics Society of America.

Estimation of lean and fat composition of pork ham using image processing measurements

Science.gov (United States)

Jia, Jiancheng; Schinckel, Allan P.; Forrest, John C.

1995-01-01

This paper presents a method of estimating the lean and fat composition in pork ham from cross-sectional area measurements using image processing technology. The relationship between the quantity of ham lean and fat mass with the ham lean and fat areas was studied. The prediction equations for pork ham composition based on the ham cross-sectional area measurements were developed. The results show that ham lean weight was related to the ham lean area (r equals .75, P lean weight was highly related to the product of ham total weight times percentage ham lean area (r equals .96, P product of ham total weight times percentage ham fat area (r equals .88, P lean weight was trimmed wholesale ham weight and percentage ham fat area with a coefficient of determination of 92%. The best combination of independent variables for estimating ham fat weight was trimmed wholesale ham weight and percentage ham fat area with a coefficient of determination of 78%. Prediction equations with either two or three independent variables did not significantly increase the accuracy of prediction. The results of this study indicate that the weight of ham lean and fat could be predicted from ham cross-sectional area measurements using image analysis in combination with wholesale ham weight.

Nutritional composition in the chia seed and its processing properties on restructured ham-like products

Directory of Open Access Journals (Sweden)

Yi Ding

2018-01-01

Full Text Available Low-fat meat products always have harder texture, lower juiciness, and worse flavor. Due to their higher water-holding, water absorption, and organic molecule absorption, chia seeds (CHIA have been applied in powders, nutrition bars, breads, and cookies. Hence, the objectives of this study were to: (1 analyze the nutritional compositions in CHIA; and (2 look for the possible application of CHIA on restructured ham-like products. CHIA has high amounts of α-linolenic acid, crude polysaccharides, and also contains essential amino acids, minerals, and polyphenols. Regarding processing properties of CHIA, a combination of CHIA and carrageenan (CA increased (p<0.05 production yield of restructured ham-like products. A scanning electron microscope observation indicated that CHIA and CA addition can assist an emulsification in this ham-like product. Addition of 0.5% CA and 1.0% CHIA in this ham-like product showed the similar overall acceptance as products with added fat. Following storage at 4°C, higher (p<0.05 purge and centrifugation losses, as well as hardness of this ham-like product can be improved by adding CHIA and CA. CHIA addition also resulted in lower (p<0.05 lipid and protein oxidation, especially a 1.0% addition. In summary, due to both nutritional addition and improvements on physicochemical and sensorial properties of restructured ham-like products, CHIA seeds have great potential on the development of healthy and good-quality meat products.

SENSORY CHARACTERISTICS OF NATIVE CHICKEN QUEEN PINEAPPLE-CURED HAM

OpenAIRE

Dr. Lilibeth A. Roxas; Nikko A. Roxas

2015-01-01

The potential of Native Chicken to be processed into palatable ham was conducted making use of Queen Pineapple (QP) crude extract as one of the curing ingredients. Primarily, the main goal is to develop a protocol in the manufacture of processed native chicken ham and determine the organoleptic quality of native chicken ham product. The age of the bird and maturity of the fruit were considered for the best organoleptic quality of chicken ham. In this study, the combine injectio...

La costruzione e la decorazione della Sala Maria Luigia nella Biblioteca Palatina di Parma

Directory of Open Access Journals (Sweden)

Maria Carla Ramazzini Calciolari

2011-01-01

Full Text Available Si ripercorre la storia di una commissione pubblica, la nuova sala della Biblioteca Palatina di Parma, cercando di ricostruire i rapporti intercorsi tra il Bibliotecario Pezzana, l'architetto di Corte Nicolò Bettoli e il Direttore dell'Accademia di Belle Arti Paolo Toschi, e di individuare i modelli culturali, architettonici ed artistici di riferimento.

INTERNALISASI STANDAR HAM INTERNASIONAL DALAM PENGUJIAN UNDANG-UNDANG OLEH MAHKAMAH KONSTITUSI

Directory of Open Access Journals (Sweden)

Titon Slamet Kurnia

2016-06-01

Tulisan ini membahas isu proses internalisasi standar HAM internasional dalam forum domestik melalui mekanisme pengujian konstitusionalitas undang-undang oleh MKRI. Tulisan ini berargumen bahwa MKRI seyogianya mempertimbangkan standar HAM internasional dalam menguji konstitusionalitas undangundang berdasarkan Bab XA UUD NRI 1945. Argumen itu didasarkan pada preskripsi bahwa standar HAM internasional berlaku/mengikat kepada negara dan mensyaratkannya untuk menyesuaikan undangundang beserta tindakan pejabatnya dengan kaidah HAM internasional tersebut

High pressure as an alternative processing step for ham production.

Science.gov (United States)

Pingen, Sylvia; Sudhaus, Nadine; Becker, André; Krischek, Carsten; Klein, Günter

2016-08-01

As high pressure processing (HPP) is becoming more and more important in the food industry, this study examined the application of HPP (500 and 600MPa) as a manufacturing step during simulated ham production. By replacing conventional heating with HPP steps, ham-like texture or color attributes could not be achieved. HPP products showed a less pale, less red appearance, softer texture and higher yields. However, a combination of mild temperature (53°C) and 500MPa resulted in parameters more comparable to cooked ham. We conclude that HPP can be used for novel food development, providing novel textures and colors. However, when it comes to ham production, a heating step seems to be unavoidable to obtain characteristic ham properties. Copyright © 2016 Elsevier Ltd. All rights reserved.

Spent brewer's yeast extract as an ingredient in cooked hams.

Science.gov (United States)

Pancrazio, Gaston; Cunha, Sara C; de Pinho, Paula Guedes; Loureiro, Mónica; Meireles, Sónia; Ferreira, Isabel M P L V O; Pinho, Olívia

2016-11-01

This work describes the effect of the incorporation of 1% spent yeast extract into cooked hams. Physical/chemical/sensorial characteristics and changes during 12 and 90days storage were evaluated on control and treated cooked hams processed for 1.5, 2.0, 2.5 or 3h. Spent yeast extract addition increased hardness, chewiness, ash, protein and free amino acid content. Similar volatile profiles were obtained, although there were some quantitative differences. No advantages were observed for increased cooking time. No significant differences were observed for physical and sensorial parameters of cooked hams with spent yeast extract at 12 and 90days post production, but His, aldehydes and esters increased at the end of storage. This behaviour was similar to that observed for control hams. The higher hardness of cooked ham with 1% yeast extract was due to the stronger gel formed during cooking and was maintained during storage. This additive acts as gel stabilizer for cooked ham production and could potentially improve other processing characteristics. Copyright © 2016 Elsevier Ltd. All rights reserved.

Consumer satisfaction with dry-cured ham in five European countries.

Science.gov (United States)

Resano, H; Pérez-Cueto, F J A; Sanjuán, A I; de Barcellos, M D; Grunert, K G; Verbeke, W

2011-04-01

The objective is to investigate consumer satisfaction with dry-cured ham in five European countries. A logistic regression model has been fitted using data collected through a cross-sectional web-based survey carried out in Belgium, Germany, Denmark, Poland and Greece during January 2008 (n=2437 of which 2156 were dry-cured ham consumers). Satisfaction was evaluated as overall satisfaction, as well as specific satisfaction with healthfulness, price, convenience and taste. The findings show that the main determinant of overall satisfaction is taste satisfaction, hence, producers are recommended to focus on matching sensory acceptability of dry-cured ham. No significant between-country differences were found, reflecting the wide availability of this product in all countries. Consumer characteristics influenced their level of satisfaction. Men, older (age > 52 years) and frequent consumers of dry-cured ham consumption were more likely to be satisfied with dry-cured ham. Consumers trust the butcher's advice and they preferred purchasing dry-cured ham at a butcher shop rather than in a supermarket. © 2010 The American Meat Science Association. Published by Elsevier Ltd. All rights reserved.

Aroma components of American country ham.

Science.gov (United States)

Song, H; Cadwallader, K R

2008-01-01

The aroma-active compounds of American country ham were investigated by using direct solvent extraction-solvent assisted flavor evaporation (DSE-SAFE), dynamic headspace dilution analysis (DHDA), gas chromatography-olfactometry (GCO), aroma extract dilution analysis (AEDA), and gas chromatography-mass spectrometry (GC-MS). The results indicated the involvement of numerous volatile constituents in the aroma of country ham. For DHDA, 38 compounds were identified as major odorants, among them, 1-octen-3-one, 2-acetyl-1-pyrroline, 1-nonen-3-one, decanal, and (E)-2-nonenal were the most predominant, having FD-factors >or= 125 in all 3 hams examined, followed by 3-methylbutanal, 1-hexen-3-one, octanal, acetic acid, phenylacetaldehyde, and Furaneol. For the DSE-SAFE method, the neutral/basic fraction was dominated by 1-octen-3-one, methional, guaiacol, (E)-4,5-epoxy-(E)-decenal, p-cresol as well as 3-methylbutanal, hexanal, 2-acetyl-1-pyrroline, phenylacetaldehyde, and gamma-nonalactone. The acidic fraction contained mainly short-chain volatile acids (3-methylbutanoic acid, butanoic acid, hexanoic acid, and acetic acid) and Maillard reaction products (for example, 4-hydroxy-2,5-dimethyl-3(2H)-furanone). The above compounds identified were derived from lipid oxidation, amino acid degradation, and Maillard/Strecker and associated reactions. Both methods revealed the same nature of the aroma components of American country ham.

Salt distribution in dry-cured ham measured by computed tomography and image analysis

DEFF Research Database (Denmark)

Vestergaard, Christian Sylvest; Erbou, Søren G.; Thauland, T.

2005-01-01

Forty-seven hams were scanned four times by computed tomography (CT) while being manufactured into dry-cured hams. An image-processing algorithm measured CT values in the lean part of the hams and provided line profiles reflecting the magnitude and spatial location of salt gradients. At the end...... of manufacturing, seven entire hams were dissected and the salt content of the lean part determined. Likewise, in the remaining 40 hams, the lean meat of the slices corresponding to the CT images was dissected, analyzed chemically for NaCl and compared to the CT value. The salt content of entire dry-cured hams...... section were demonstrated. Line profiles illustrating the combined salt tribution and dehydration within a ham related to the physical characteristics of the ham as well as to the manufacturing process. These findings reveal that the effects of altered manufacturing practices can be followed non...

Elaboration and acceptability of restructured hams added with jabuticaba skin

Directory of Open Access Journals (Sweden)

Ana Paula de Carvalho ALVES

Full Text Available Abstract Jabuticaba skin flour (JSF, rich in antioxidants and fibre, was used in order to develop four restructured hams in different combinations with meat: 0% control – without the addition of JSF, with the addition of 0.5% JSF, 1.0% JSF and 1.5% JSF, meeting, therefore, the growing demand for meat products with functional appeal. Physicochemical characterizations and sensory analysis were performed, evaluating the impact of information on possible health benefits and the effect on storage. Restructured hams with JSF had higher contents of phenolic compounds; greater weight loss; a darker shade; texture profile with smaller parameters of stiffness, cohesiveness, adhesiveness, flexibility and chewiness (except the restructured ham with 0.5% JSF. Phenolic compounds, pH values, colour and TBARs did not differ with storage time, but were statistically different among JSF concentrations. Panellists preferred the restructured ham without JSF, however, the analysis of variance for overall aspect did not show a significant difference between the restructured ham “control” and those added with 0.5% and 1.0% JSF, after informing the panellists that they would possibly bring health benefits. It is concluded that it is possible to prepare and store restructured hams with JSF, at concentrations of 0.5% and 1.0% with good acceptance.

A validation analysis of two self-reported HAM-D6 versions

DEFF Research Database (Denmark)

Bech, P; Wilson, P; Wessel, T

2009-01-01

the unidimensionality of this administration form in patients with mild-to-moderate depression. METHOD: The item response theory analysis of Mokken was used to test the unidimensionality of both the Interactive Voice Recording System (IVRS) version of the HAM-D(6) and a paper-and-pencil self-reported version (S-HAM-D(6......OBJECTIVE: The six items of the clinician-administrated Hamilton Depression Scale (HAM-D(6)) cover the core items of depressive states reflecting the antidepressive effect of medication. In this study, the two self-reported versions of the HAM-D(6) have been psychometrically validated to ensure...

Muusikamaail. "Musica nova" Helsingis. Händeli festival Karlsruhes. Ooperikonkurss algas. Preemiaid ja tunnustusi. Ka Parmas uus ooperimaja. / Priit Kuusk

Index Scriptorium Estoniae

Kuusk, Priit, 1938-

2002-01-01

Soomes toimuvast uue muusika festivalist. Händeli festivalist Karlsruhes. Üle-euroopalisest noorte ooperilauljate konkursist. Ooperilaulja Doris Soffel sai Rootsi riigilt Kuningliku Põhjatähe ordeni. Sebastian Baumgarten sai ooperi "Tosca" eest noore režissööri preemia. Parmas valmis uus ooperimaja

HAM-D17 and HAM-D6 sensitivity to change in relation to desvenlafaxine dose and baseline depression severity in major depressive disorder

DEFF Research Database (Denmark)

Bech, P; Boyer, P; Germain, J-M

2010-01-01

INTRODUCTION: This retrospective analysis compared sensitivity to change on the 17-item and 6-item Hamilton Rating Scales For Depression (HAM-D (17) and HAM-D (6), respectively) in relation to antidepressant dose and baseline depression severity. METHODS: Data were derived from 6 randomized, double...

A gestão da Pedagogia do Bem Estar: apontamentos da política de creche de Parma-Itália - Management of Pedagogy of wellness: guidelines of the nursery policy of Parma - Italy

Directory of Open Access Journals (Sweden)

Eliane Gomes da Silva

2013-06-01

Full Text Available http://dx.doi.org/10.5007/1980-4512.2013n28p66   Como resultado de seminários de estudos e observações “in loco”, realizadas por um grupo de pesquisa da Universidade de São Paulo em creches italianas, o presente texto tem por objetivo destacar alguns pontos da proposta da cidade de Parma-Itália que consideramos importantes para pensarmos o atendimento à criança pequena. As observações e estudos por nós realizados, em certa medida, nos levaram a considerar, respeitadas as especificidades locais, algumas das repercussões da política educacional adotada envolvendo algumas ações verticalizadas e as parcerias público-privado presentes na proposta.  Por outro lado, a observação, a escuta, o cuidado com as emoções, a organização do espaço, os materiais utilizados, as atividades proporcionadas para as crianças, o quadro de funcionários, a relação administrativo-pedagógica e o trabalho da educadora nos revelou algumas das preocupações do poder público com o que se entende por Pedagogia do Bem Estar.   MANAGEMENT OF WELLNESS PEDAGOGY: GUIDELINES OF THE NURSERY POLICY OF PARMA- ITALY Abstract As a result from study seminars and observations “in loco”, realized by a research group of Universidade de São Paulo in Italian nurseries, the present text, aims to highlight some aspects of the proposal from the city of Parma-Italy, which we considered as important to reason attendance to young children. The observations and studies realized by our group, in some way, made us consider, respecting the local specificities, some of the repercussions of the educational policy adopted, involving some vertical actions and the public-private partners present on the proposal. On the other side, the observation, listening-in, care with emotions, space organization, the material employed, the activities provided to the children, the staff, the administrative-pedagogical relationship and the work of the educators has revealed some of

Hamming Code Based Watermarking Scheme for 3D Model Verification

Directory of Open Access Journals (Sweden)

Jen-Tse Wang

2014-01-01

Full Text Available Due to the explosive growth of the Internet and maturing of 3D hardware techniques, protecting 3D objects becomes a more and more important issue. In this paper, a public hamming code based fragile watermarking technique is proposed for 3D objects verification. An adaptive watermark is generated from each cover model by using the hamming code technique. A simple least significant bit (LSB substitution technique is employed for watermark embedding. In the extraction stage, the hamming code based watermark can be verified by using the hamming code checking without embedding any verification information. Experimental results shows that 100% vertices of the cover model can be watermarked, extracted, and verified. It also shows that the proposed method can improve security and achieve low distortion of stego object.

A Game Map Complexity Measure Based on Hamming Distance

Science.gov (United States)

Li, Yan; Su, Pan; Li, Wenliang

With the booming of PC game market, Game AI has attracted more and more researches. The interesting and difficulty of a game are relative with the map used in game scenarios. Besides, the path-finding efficiency in a game is also impacted by the complexity of the used map. In this paper, a novel complexity measure based on Hamming distance, called the Hamming complexity, is introduced. This measure is able to estimate the complexity of binary tileworld. We experimentally demonstrated that Hamming complexity is highly relative with the efficiency of A* algorithm, and therefore it is a useful reference to the designer when developing a game map.

Characterization of hams added with nut residual pastes from the mechanical extraction of oil

Directory of Open Access Journals (Sweden)

Juan José Luna Guevara

2013-06-01

Full Text Available Nuts contain in their composition nutrients and bioactive compounds that when consumed in sufficient amounts may provide health benefits. In this study was evaluated the influence of the addition of residual pastes (10%, obtained from the extraction of oil from walnut (Juglans regia L., pecan (Carya illinoinensis (Wangenh. K. Koch, variety Western Shley, and peanut (Arachis hypogaea, on the modification of some textural, proximate, physicochemical, microbiological and sensory characteristics of cooked hams. Hams were stored at 4 ° C for 21 days. Hams containing pastes significantly increased (P ≤ 0.05 the protein, fat, and total fiber content. Hams added with paste presented a less rigid structures (P ≤ 0.05. The color parameters (L*, a*, and b* of hams decrease slightly during the storage time, except for the ham added with walnut paste, which was darker. The nut pastes contributed significantly (P ≤ 0.05 to decrease the shelf life of hams. However, the yeast and mold counts in ham were less than 10 CFU/g at 21 days of storage. aw and pH decreased significantly (P ≤ 0.05 and syneresis increased during storage. Hams added with residual pastes were well sensory accepted regarding color, aroma, taste, appearance, and overall acceptability.

Fresh meat and further processing characteristics of ham muscles from finishing pigs fed ractopamine hydrochloride.

Science.gov (United States)

Boler, D D; Holmer, S F; Duncan, D A; Carr, S N; Ritter, M J; Stites, C R; Petry, D B; Hinson, R B; Allee, G L; McKeith, F K; Killefer, J

2011-01-01

Ractopamine hydrochloride (RAC) has consistently led to an advantage in carcass cutting yields of finishing pigs and remains a common feed additive in US finishing pig diets. Less is known about the effect of RAC on further processing characteristics. Some researchers have reported advantages in ultimate pH of the LM in pigs fed RAC. If a greater ultimate pH was also observed in hams, the increased pH could affect further processing characteristics and lead to better protein interaction and improved textural properties. The objective of this experiment was to determine if RAC-fed pigs yielded hams with a greater ultimate pH, and if so, whether or not that advantage improves textural properties and water retention of further processed hams. Two hundred hams from barrows and gilts fed RAC or control diets were selected based on HCW. Hams were fabricated into 5 separate pieces to determine cutting yields, and 6 muscles were evaluated for ultimate pH. Hams were processed to make cured and smoked hams. Ractopamine increased cutting yields of the whole ham (P processed ham characteristics.

9 CFR 381.171 - Definition and standard for “Turkey Ham.”

Science.gov (United States)

2010-01-01

... Ham.â 381.171 Section 381.171 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Standards of Identity or Composition § 381.171 Definition and standard for “Turkey Ham.” (a) “Turkey Ham... label shall show the word “Turkey” in the same size, style, color, and with the same background as the...

Effect of Particular Breed on the Chemical Composition, Texture, Color, and Sensorial Characteristics of Dry-cured Ham

Directory of Open Access Journals (Sweden)

Pil Nam Seong

2014-08-01

Full Text Available The present study demonstrates the impact of specific breed on the characteristics of dry-cured ham. Eighty thighs from Korean native pig (KNP, crossbreed (Landrace×Yorkshire♀×Duroc♂ (LYD, Berkshire (Ber, and Duroc (Du pig breeds (n = 10 for each breed were used for processing of dry-cured ham. The thighs were salted with 6% NaCl (w/w and 100 ppm NaNO2, and total processing time was 413 days. The effects of breed on the physicochemical composition, texture, color and sensory characteristics were assessed on the biceps femoris muscle of the hams. The results revealed that the highest weight loss was found in the dry-cured ham of LYD breed and the lowest weight loss was found in Ber dry-cured ham. The KNP dry-cured ham contain higher intramuscular fat level than other breed hams (p<0.05. It was observed that the dry-cured ham made from KNP breed had the lowest water activity value and highest salt content, while the LYD dry-cure ham had higher total volatile basic nitrogen content than the Ber and Du hams (p<0.05. Zinc, iron and total monounsaturated fatty acids levels were higher in KNP ham while polyunsaturated fatty acids levels were higher in Du ham when compared to other breed hams (p<0.05. Additionally, the KNP dry-cured ham possessed higher Commission International de l’Eclairage (CIE a* value, while the Du dry-cured ham had higher L*, CIE b* and hue angle values (p<0.05. Furthermore, breed significantly affected the sensory attributes of dry-cured hams with higher scores for color, aroma and taste found in KNP dry-cured ham as compared to other breed hams (p<0.05. The overall outcome of the study is that the breed has a potential effect on the specific chemical composition, texture, color and sensorial properties of dry-cured hams. These data could be useful for meat processors to select the suitable breeds for economical manufacturing of high quality dry-cured hams.

The motor evoked potential in aids and HAM/TSP State of the evidence El potencial evocado motor en SIDA y HAM/PET

Directory of Open Access Journals (Sweden)

Fidias E. Leon-Sarmiento

2009-12-01

Full Text Available OBJECTIVE: We aimed to better understand the involvement of the corticospinal tract, assessed by non-invasive transcranial stimulation, in order to determine the actual involvement of the motor system in patients with HAM/TSP and AIDS. METHOD: An exhaustive MEDLINE search for the period of 1985 to 2008 for all articles cross-referenced for "HTLV-I, HTLV-II, HTLV-III and HIV, HIV1, HIV2, evoked potential, motor evoked potential, high voltage electrical stimulation, transcranial magnetic stimulation, magnetic stimulation, corticomotor physiology, motor pathways, acquired immunodeficiency syndrome, AIDS, SIDA, tropical spastic paraparesis, HTLV-I-associated myelopathy, HAM, TSP, and HAM/TSP" were selected and analysed. RESULTS: Eighteen papers published in English, Spanish, Portuguese, French and Japanese were identified. Only the central motor conduction time has been analyzed in seropositive patients to human retroviruses. The investigations done on HAM/TSP support the involvement of the pyramidal tract mainly at lower levels, following a centripetal pattern; in AIDS, such an involvement seems to be more prominent at brain levels following a centrifugal pattern. CONCLUSION: The central motor conduction time abnormalities and involvement differences of the corticospinal tract of patients with AIDS and HAM/TSP dissected here would allow to re-orient early neurorehabilitation measures in these retroviruses-associated neurodegenerative disorders. Besides this, more sophisticated and sensitive non-invasive corticospinal stimulation measures that detect early changes in thalamocortical-basal ganglia circuitry will be needed in both clinically established as well as asymptomatic patients at times when the fastest corticospinal fibers remain uninvolved.OBJETIVO: Investigar el compromiso del tracto piramidal, evaluado por estimulación trascranial no invasiva, en pacientes afectados por SIDA y HAM/TSP. MÉTODO: Se realizó una búsqueda en la base de

Sensory quality, colour and oxidative stability of cured cooked ham with propolis extract

Directory of Open Access Journals (Sweden)

Miroslav Kročko

2014-02-01

Full Text Available The effect of 0.06% propolis ethanol extract on the sensory quality, colour and oxidative stability of cured cooked ham was evaluated. Half of the experimentally processed hams treated with 0.06% ethanolic extract of propolis with ascorbic acid (EEP, only with ascorbic acid (AA and control samples (C were sliced and vacuum packaged. Samples were kept at 4 °C 21 days (sliced respectively 20, 50 and 100 days (unsliced. The results revealed that all samples were characterized without any significant colour discrepancies. In general, the thiobarbituric acid value (mg malondialdehyde/kg increased gradually in all samples examined, with a significantly lower (P <0.05 level for treated samples than for controls. The significantly lowest (P <0.05 sensory parameters in comparison to unsliced hams were observed in sliced hams packaged in vacuum. Sliced hams with EEP were characterized with significantly lowest (P <0.05 intensity of characteristic aroma. Undesirable taste was detected in control sliced hams after storage period. Significantly (P <0.05 more desirable taste of sliced hams was observed in those with only ascorbic acid in comparison with EEP. In our study was demonstrated that 0.06% ethanol extract of propolis positive affected oxidation stability and not negative affected others technological (pH, colour and sensory characteristics of poultry meat product - cured cooked ham. Normal 0 21 false false false CS JA X-NONE

Applying Hamming Code to Memory System of Safety Grade PLC (POSAFE-Q) Processor Module

Energy Technology Data Exchange (ETDEWEB)

Kim, Taehee; Hwang, Sungjae; Park, Gangmin [POSCO Nuclear Technology, Seoul (Korea, Republic of)

2013-05-15

If some errors such as inverted bits occur in the memory, instructions and data will be corrupted. As a result, the PLC may execute the wrong instructions or refer to the wrong data. Hamming Code can be considered as the solution for mitigating this mis operation. In this paper, we apply hamming Code, then, we inspect whether hamming code is suitable for to the memory system of the processor module. In this paper, we applied hamming code to existing safety grade PLC (POSAFE-Q). Inspection data are collected and they will be referred for improving the PLC in terms of the soundness. In our future work, we will try to improve time delay caused by hamming calculation. It will include CPLD optimization and memory architecture or parts alteration. In addition to these hamming code-based works, we will explore any methodologies such as mirroring for the soundness of safety grade PLC. Hamming code-based works can correct bit errors, but they have limitation in multi bits errors.

Applying Hamming Code to Memory System of Safety Grade PLC (POSAFE-Q) Processor Module

International Nuclear Information System (INIS)

Kim, Taehee; Hwang, Sungjae; Park, Gangmin

2013-01-01

If some errors such as inverted bits occur in the memory, instructions and data will be corrupted. As a result, the PLC may execute the wrong instructions or refer to the wrong data. Hamming Code can be considered as the solution for mitigating this mis operation. In this paper, we apply hamming Code, then, we inspect whether hamming code is suitable for to the memory system of the processor module. In this paper, we applied hamming code to existing safety grade PLC (POSAFE-Q). Inspection data are collected and they will be referred for improving the PLC in terms of the soundness. In our future work, we will try to improve time delay caused by hamming calculation. It will include CPLD optimization and memory architecture or parts alteration. In addition to these hamming code-based works, we will explore any methodologies such as mirroring for the soundness of safety grade PLC. Hamming code-based works can correct bit errors, but they have limitation in multi bits errors

Sensory profiling of Dalmatian dry-cured ham under different temperature conditions

Directory of Open Access Journals (Sweden)

Zlatko Janječić

2010-01-01

Full Text Available To investigate the influence of the Dalmatian ham processing conditions on weight loss and sensory characteristics, 20 hams were processed following different temperature conditions during salting and ripening. For that purpose, hams were evaluated using quantitative descriptive analysis. The weight loss was higher and all sensory traits except presence of tyrosine and phenylalanine crystals were higher rated for hams processed at higher temperatures. The most significant (P<0.0001 influence of temperature was established on subcutaneous fat color, muscle color and presence of tyrosine and phenylalanine, whereas no influence was established on appearance, marbling, flavor and melting. This concludes that there is overall significant effect of higher temperature on sensory characteristics most likely due to the more intense proteolysis and lipolysis.

Artificial Radionuclides Database in the Pacific Ocean: HAM Database

Directory of Open Access Journals (Sweden)

Michio Aoyama

2004-01-01

Full Text Available The database “Historical Artificial Radionuclides in the Pacific Ocean and its Marginal Seas”, or HAM database, has been created. The database includes 90Sr, 137Cs, and 239,240Pu concentration data from the seawater of the Pacific Ocean and its marginal seas with some measurements from the sea surface to the bottom. The data in the HAM database were collected from about 90 literature citations, which include published papers; annual reports by the Hydrographic Department, Maritime Safety Agency, Japan; and unpublished data provided by individuals. The data of concentrations of 90Sr, 137Cs, and 239,240Pu have been accumulating since 1957–1998. The present HAM database includes 7737 records for 137Cs concentration data, 3972 records for 90Sr concentration data, and 2666 records for 239,240Pu concentration data. The spatial variation of sampling stations in the HAM database is heterogeneous, namely, more than 80% of the data for each radionuclide is from the Pacific Ocean and the Sea of Japan, while a relatively small portion of data is from the South Pacific. This HAM database will allow us to use these radionuclides as significant chemical tracers for oceanographic study as well as the assessment of environmental affects of anthropogenic radionuclides for these 5 decades. Furthermore, these radionuclides can be used to verify the oceanic general circulation models in the time scale of several decades.

Ham in Spacesuit

Science.gov (United States)

1961-01-01

Ham, a three-year-old chimpanzee, in the spacesuit he would wear for the second Mercury- Redstone (MR-2) suborbital test flight in January, 1961. NASA used chimpanzees and other primates to test the Mercury capsule before launching the fisrt American astronaut, Alan Shepard, in May 1961. The Mercury capsule rode atop a modified Redstone rocket, developed by Dr. Wernher von Braun and the German Rocket Team in Huntsville, Alabama.

Influence of pre-cure freezing of Iberian ham on proteolytic changes throughout the ripening process.

Science.gov (United States)

Pérez-Palacios, Trinidad; Ruiz, Jorge; Barat, Jose Manuel; Aristoy, María Concepción; Antequera, Teresa

2010-05-01

This work aimed to investigate the effect of pre-cure freezing Iberian hams on proteolysis phenomena throughout the ripening process. Non-protein nitrogen (NPN), peptide nitrogen (PN) and amino acid nitrogen (AN) as well as amino acid and dipeptide evolution followed the same trend in both refrigerated (R) and pre-cure frozen (F) Iberian hams during processing. At the different stages of ripening, there were no differences in the content of NPN and AN while F dry-cured hams had higher levels of PN than R hams at the final step. This seemed to be more related to the salt content (lower in F than in R hams) than to the pre-cure freezing treatment. Most amino acids and dipeptides detected showed higher concentrations in F than in R Iberian hams at the green stage, being rather similar at the intermediate phases. At the final stage, the effects of pre-cure freezing of Iberian hams were not well defined, higher levels of some amino acids and dipeptides were found in R than in F Iberian hams whereas other amino acids were lower in R than in F hams. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

Effect of Particular Breed on the Chemical Composition, Texture, Color, and Sensorial Characteristics of Dry-cured Ham.

Science.gov (United States)

Seong, Pil Nam; Park, Kuyng Mi; Kang, Sun Moon; Kang, Geun Ho; Cho, Soo Hyun; Park, Beom Young; Van Ba, Hoa

2014-08-01

The present study demonstrates the impact of specific breed on the characteristics of dry-cured ham. Eighty thighs from Korean native pig (KNP), crossbreed (Landrace×Yorkshire)♀×Duroc♂ (LYD), Berkshire (Ber), and Duroc (Du) pig breeds (n = 10 for each breed) were used for processing of dry-cured ham. The thighs were salted with 6% NaCl (w/w) and 100 ppm NaNO2, and total processing time was 413 days. The effects of breed on the physicochemical composition, texture, color and sensory characteristics were assessed on the biceps femoris muscle of the hams. The results revealed that the highest weight loss was found in the dry-cured ham of LYD breed and the lowest weight loss was found in Ber dry-cured ham. The KNP dry-cured ham contain higher intramuscular fat level than other breed hams (pham made from KNP breed had the lowest water activity value and highest salt content, while the LYD dry-cure ham had higher total volatile basic nitrogen content than the Ber and Du hams (pham while polyunsaturated fatty acids levels were higher in Du ham when compared to other breed hams (pham possessed higher Commission International de l'Eclairage (CIE) a* value, while the Du dry-cured ham had higher L*, CIE b* and hue angle values (phams with higher scores for color, aroma and taste found in KNP dry-cured ham as compared to other breed hams (pcolor and sensorial properties of dry-cured hams. These data could be useful for meat processors to select the suitable breeds for economical manufacturing of high quality dry-cured hams.

Color image segmentation to detect defects on fresh ham

Science.gov (United States)

Marty-Mahe, Pascale; Loisel, Philippe; Brossard, Didier

2003-04-01

We present in this paper the color segmentation methods that were used to detect appearance defects on 3 dimensional shape of fresh ham. The use of color histograms turned out to be an efficient solution to characterize the healthy skin, but a special care must be taken to choose the color components because of the 3 dimensional shape of ham.

The Ratios of Pre-emulsified Duck Skin for Optimized Processing of Restructured Ham.

Science.gov (United States)

Shim, Jae-Yun; Kim, Tae-Kyung; Kim, Young-Boong; Jeon, Ki-Hong; Ahn, Kwang-Il; Paik, Hyun-Dong; Choi, Yun-Sang

2018-02-01

The purpose of this study was to investigate the quality of duck ham formulated with duck skin through the pre-emulsification process. The experiments to investigate the quality characteristics of duck ham were carried out to measure proximate composition, cooking loss, emulsion stability, pH, color, texture profile analysis, apparent viscosity, and sensory characteristics. Duck ham was prepared with various ratios of duck skin in pre-emulsion as follows: Control (duct skin 30%), T1 (duck skin 20% + pre-emulsified duck skin 10%), T2 (duck skin 15% + pre-emulsified duck skin 15%), T3 (duck skin 10% + pre-emulsified duck skin 20%), and T4 (pre-emulsified duck skin 30%). As the ratio of duck skin to pre-emulsified skin changed, the quality of duck ham in terms of moisture content, fat content, cooking loss, emulsion stability, lightness, textural analysis, apparent viscosity, and overall acceptability changed. The moisture content of T2 was the highest ( p ham and 1:1 ratio of duck skin and pre-emulsified skin was the proper ratio to improve the quality characteristics of duck ham.

Pre-cure freezing affects proteolysis in dry-cured hams.

Science.gov (United States)

Bañón, S; Cayuela, J M; Granados, M V; Garrido, M D

1999-01-01

Several parameters (sodium chloride, moisture, intramuscular fat, total nitrogen, non-protein nitrogen, white precipitates, free tyrosine, L* a* b* values and acceptability) related with proteolysis during the curing were compared in dry-cured hams manufactured from refrigerated and frozen/thawed raw material. Pre-cure freezing increased the proteolysis levels significantly (pcured meat, although it does not significantly affect the sensory quality of the dry-cured ham.

Effects of marketing group on the quality of fresh and cured hams sourced from a commercial processing facility.

Science.gov (United States)

Arkfeld, E K; Wilson, K B; Overholt, M F; Harsh, B N; Lowell, J E; Hogan, E K; Klehm, B J; Bohrer, B M; Kroscher, K A; Peterson, B C; Stites, C R; Mohrhauser, D A; King, D A; Wheeler, T L; Dilger, A C; Shackelford, S D; Boler, D D

2016-12-01

The objective was: 1) to characterize the effect of marketing group on fresh and cured ham quality, and 2) to determine which fresh ham traits correlated to cured ham quality traits. Pigs raised in 8 barns representing 2 seasons (hot and cold) and 2 production focuses (lean and quality) were used. Three groups were marketed from each barn. A total of 7,684 carcasses were used for data collection at the abattoir. Every tenth carcass was noted as a select carcass for in-depth ham quality analyses. Leg primal weight and instrumental color were measured on 100% of the population. On the select 10% of the population, hams were fabricated into sub-primal pieces, and 3-piece hams were manufactured to evaluate cured ham quality and processing yield. Data were analyzed as a split-plot design in the MIXED procedure of SAS with production focus as the whole-plot factor, and marketing group as the split-plot factor. Pearson correlation coefficients between fresh and cured ham traits were computed. There were no differences ( ≥ 0.15) in instrumental color or ultimate pH ( ≥ 0.14) among fresh ham muscles from any marketing group. The only exception was the semimembranosus of marketing group 2 was lighter than marketing group 1 ( = 0.03) and the dark portion of the semitendinosus muscle from group 1 was lighter than from group 3 ( = 0.01). There were no differences ( ≥ 0.33) in ultimate pH of fresh ham muscles between production focuses, but several muscles from quality focus pigs were lighter in color than ham muscles from lean focus pigs. The lack of differences in fresh ham quality lead to few differences in cured ham quality. Cured hams from the quality focus pigs had greater lipid content ( marketing group 1 and 2 were 1.52 units lighter than hams from marketing group 3 ( 0.01). Overall, marketing group did not impact ham quality. Fresh ham quality was not strongly related to cured ham quality. Some correlations were present between fresh and cured ham traits, but

Nitrate reductase activity of Staphylococcus carnosus affecting the color formation in cured raw ham.

Science.gov (United States)

Bosse Née Danz, Ramona; Gibis, Monika; Schmidt, Herbert; Weiss, Jochen

2016-07-01

The influence of the nitrate reductase activity of two Staphylococcus carnosus strains used as starter cultures on the formation of nitrate, nitrite and color pigments in cured raw ham was investigated. In this context, microbiological, chemical and multivariate image analyses were carried out on cured raw hams, which were injected with different brines containing either nitrite or nitrate, with or without the S. carnosus starter cultures. During processing and storage, the viable counts of staphylococci remained constant at 6.5logcfu/g in the hams inoculated with starter cultures, while the background microbiota of the hams processed without the starter cultures developed after 14days. Those cured hams inoculated with S. carnosus LTH 7036 (high nitrate reductase activity) showed the highest decrease in nitrate and high nitrite concentrations in the end product, but were still in the range of the legal European level. The hams cured with nitrate and without starter culture or with the other strain, S. carnosus LTH 3838 (low nitrate reductase activity) showed higher residual nitrate levels and a lower nitrite content in the end product. The multivariate image analysis identified spatial and temporal differences in the meat pigment profiles of the differently cured hams. The cured hams inoculated with S. carnosus LTH 3838 showed an uncured core due to a delay in pigment formation. Therefore, the selection of starter cultures based on their nitrate reductase activity is a key point in the formation of curing compounds and color pigments in cured raw ham manufacture. Copyright © 2016 Elsevier Ltd. All rights reserved.

Degenerate quantum codes and the quantum Hamming bound

International Nuclear Information System (INIS)

Sarvepalli, Pradeep; Klappenecker, Andreas

2010-01-01

The parameters of a nondegenerate quantum code must obey the Hamming bound. An important open problem in quantum coding theory is whether the parameters of a degenerate quantum code can violate this bound for nondegenerate quantum codes. In this article we show that Calderbank-Shor-Steane (CSS) codes, over a prime power alphabet q≥5, cannot beat the quantum Hamming bound. We prove a quantum version of the Griesmer bound for the CSS codes, which allows us to strengthen the Rains' bound that an [[n,k,d

Reliabilität des Hamburger Auswahlverfahrens für Medizinische Studiengänge, Naturwissenschaftsteil (HAM-Nat [Reliability of a science admission test (HAM-Nat at Hamburg medical school

Directory of Open Access Journals (Sweden)

Hissbach, Johanna

2011-08-01

Full Text Available [english] Objective: The University Hospital in Hamburg (UKE started to develop a test of knowledge in natural sciences for admission to medical school in 2005 (Hamburger Auswahlverfahren für Medizinische Studiengänge, Naturwissenschaftsteil, HAM-Nat. This study is a step towards establishing the HAM-Nat. We are investigating Methods: 316 first-year students participated in the study in 2007. They completed different versions of the HAM-Nat test which consisted of items that had already been used (HN2006 and new items (HN2007. Four weeks later half of the participants were tested on the HN2007 version of the HAM-Nat again, while the other half completed the test of scientific reasoning. Within this four week interval students were offered a five day chemistry course.Results: Parallel forms reliability for four different test versions ranged from r=.53 to r=.67. The retest reliabilities of the HN2007 halves were r=.54 and r=.61. Correlations of the two HAM-Nat versions with the test of scientific reasoning were r=.34 und r=.21. The crash course in chemistry had no effect on HAM-Nat scores.Conclusions: The results suggest that further versions of the test of natural sciences will not easily conform to the standards of internal consistency, parallel-forms reliability and retest reliability. Much care has to be taken in order to assemble items which could be used interchangeably for the construction of new test versions. The test of scientific reasoning and the HAM-Nat are tapping different constructs. Participation in a chemistry course did not improve students’ achievement, probably because the content of the course was not coordinated with the test and many students lacked of motivation to do well in the second test.[german] Ziele: Die Universität Hamburg hat im Jahr 2005 begonnen, einen Naturwissenschaftstest zur Auswahl von Studienbewerbern zu entwickeln (Hamburger Auswahlverfahren für Medizinische Studiengänge, Naturwissenschaftsteil

Analysis of the bark beetle outbreak in the forest “Alta Val Parma” (Corniglio, Parma, Italy and strategies for its regeneration

Directory of Open Access Journals (Sweden)

Vignali G

2015-12-01

Full Text Available Analysis of the bark beetle outbreak in the forest “Alta Val Parma” (Corniglio, Parma, Italy and strategies for its regeneration. Norway spruce plantations located in the Foresta Demaniale Alta Val Parma (Corniglio, province of Parma - Italy experienced since 2004 a massive outbreak of Norway spruce bark beetle (Ips typographus. This outbreak has been triggered by the exceptionally warm and dry summer of 2003. In the following years bark beetle attacks repeated and spread, raising concern about the future of this kind of stands. A survey program has been carried out to help local administration to chose the correct managements strategies. Monitoring of Ips typographus population, carried out between 2007 and 2013, confirmed the presence of two generations per year, with values above the risk threshold in 2007 and just below though very high in 2011. In the affected area, six survey plots have been realized to test different management options with the aim of favoring a fast regeneration of the forest cover. The tested options showed the great difficulty in the establishment of natural generation either for the lack of mother plants in such pure stands or for competition with tall grasses. Sowing brought no significative results, while direct plantation of indigenous broadleaves was more effective, with almost half of the individuals still alive after three years. Our results confirm the great difficulty to rebuild the forest cover after strong ecological disturbances in these artificial forests. Hybrid management strategies and ad hoc silvicultural choices seem to be the only way to manage such kind of situations in a National park, where the priority is biodiversity conservation.

Simulation of Hamming Coding and Decoding for Microcontroller Radiation Hardening

OpenAIRE

Rehab I. Abdul Rahman; Mazhar B. Tayel

2015-01-01

This paper presents a method of hardening the 8051 micro-controller, able to assure reliable operation in the presence of bit flips caused by radiation. Aiming at avoiding such faults in the 8051 micro-controller, Hamming code protection was used in its SRAM memory and registers. A VHDL code has been used for this hamming code protection.

Reliability of a science admission test (HAM-Nat) at Hamburg medical school.

Science.gov (United States)

Hissbach, Johanna; Klusmann, Dietrich; Hampe, Wolfgang

2011-01-01

The University Hospital in Hamburg (UKE) started to develop a test of knowledge in natural sciences for admission to medical school in 2005 (Hamburger Auswahlverfahren für Medizinische Studiengänge, Naturwissenschaftsteil, HAM-Nat). This study is a step towards establishing the HAM-Nat. We are investigating parallel forms reliability, the effect of a crash course in chemistry on test results, and correlations of HAM-Nat test results with a test of scientific reasoning (similar to a subtest of the "Test for Medical Studies", TMS). 316 first-year students participated in the study in 2007. They completed different versions of the HAM-Nat test which consisted of items that had already been used (HN2006) and new items (HN2007). Four weeks later half of the participants were tested on the HN2007 version of the HAM-Nat again, while the other half completed the test of scientific reasoning. Within this four week interval students were offered a five day chemistry course. Parallel forms reliability for four different test versions ranged from r(tt)=.53 to r(tt)=.67. The retest reliabilities of the HN2007 halves were r(tt)=.54 and r(tt )=.61. Correlations of the two HAM-Nat versions with the test of scientific reasoning were r=.34 und r=.21. The crash course in chemistry had no effect on HAM-Nat scores. The results suggest that further versions of the test of natural sciences will not easily conform to the standards of internal consistency, parallel-forms reliability and retest reliability. Much care has to be taken in order to assemble items which could be used interchangeably for the construction of new test versions. The test of scientific reasoning and the HAM-Nat are tapping different constructs. Participation in a chemistry course did not improve students' achievement, probably because the content of the course was not coordinated with the test and many students lacked of motivation to do well in the second test.

Assessing the use of frozen pork meat in the manufacture of cooked ham

Directory of Open Access Journals (Sweden)

Francine Gomes Basso LOS

2016-01-01

Full Text Available This study aimed to evaluate the effects of slow (–18 °C and fast freezing (liquid nitrogen of pork meat, and the use of exudate released upon thawing, on the physicochemical, color, rheological, microbiological, histological, and sensory characteristics of cooked ham. The meat samples were frozen at –18 °C and thawed after 22 weeks for the production of cooked ham. No significant difference was observed regarding physicochemical, color and microbiological parameters or in sensory acceptance. The hardness and chewiness parameters showed significant differences when compared to the control sample (ham made from chilled meat. Light microscopy of cooked ham samples showed that changes in the tissues were caused by freezing and thawing the meat. The effect of exudate was significant on the sodium content and compression force parameters, but this difference was not perceived in the sensory analysis, confirming that frozen pork meat can be used to produce cooked ham without loss of quality.

Pork loin quality is not indicative of fresh belly or fresh and cured ham quality.

Science.gov (United States)

Arkfeld, E K; Wilson, K B; Overholt, M F; Harsh, B N; Lowell, J E; Hogan, E K; Klehm, B J; Bohrer, B M; Mohrhauser, D A; King, D A; Wheeler, T L; Dilger, A C; Shackelford, S D; Boler, D D

2016-12-01

The objective was to characterize the relationship between fresh loin quality with fresh belly or fresh and cured ham quality. Pigs raised in 8 barns representing 2 seasons [cold ( = 4,290) and hot ( = 3,394)] and 2 production focuses [lean ( = 3,627) and quality ( = 4,057)] were used. Carcass characteristics and other meat quality data were collected on 7,684 carcasses. All of the carcasses were evaluated for HCW, LM depth, tenth rib fat depth, leg (ham primal) weight, instrumental color on the gluteus medius and gluteus profundus of the ham face, and subjective loin quality. Instrumental loin color and ultimate pH (≥ 22 h postmortem) were collected on the ventral side of loins along with dimensions and firmness scores of fresh bellies from 50% of the carcasses. Ten percent of the boneless loins and fresh hams were evaluated for slice shear force (SSF) or cured ham characteristics. Correlation coefficients between traits were computed using the CORR procedure of SAS and considered significantly different from 0 at ≤ 0.05. Temperature decline, beginning at 31 min postmortem and concluding at 22 h postmortem, for the longissimus dorsi and semimembranosus muscles were evaluated on 10% of the carcasses. Ultimate loin pH was correlated with dimensional belly characteristics ( ≥ |0.07|; ham instrumental color ( ≥ |0.03|; ≤ 0.05), and semimembranosus ultimate pH ( = 0.33; hams. Instrumental L*on the ventral surface of the loin was related to L* on both muscles of the ham face ( ≤ 0.0001). Even though significant relationships between the loin, belly, and ham were detected, the variability in belly and ham quality explained by variability in loin quality was poor (≤ 22.09%). Compositional differences between the loin and belly may have contributed to those poor relationships. Additionally, differences in temperature declines during chilling between the loin and ham likely contributed to the weak nature of relationships. Equilibration of longissimus dorsi

Quantum algorithms on Walsh transform and Hamming distance for Boolean functions

Science.gov (United States)

Xie, Zhengwei; Qiu, Daowen; Cai, Guangya

2018-06-01

Walsh spectrum or Walsh transform is an alternative description of Boolean functions. In this paper, we explore quantum algorithms to approximate the absolute value of Walsh transform W_f at a single point z0 (i.e., |W_f(z0)|) for n-variable Boolean functions with probability at least 8/π 2 using the number of O(1/|W_f(z_{0)|ɛ }) queries, promised that the accuracy is ɛ , while the best known classical algorithm requires O(2n) queries. The Hamming distance between Boolean functions is used to study the linearity testing and other important problems. We take advantage of Walsh transform to calculate the Hamming distance between two n-variable Boolean functions f and g using O(1) queries in some cases. Then, we exploit another quantum algorithm which converts computing Hamming distance between two Boolean functions to quantum amplitude estimation (i.e., approximate counting). If Ham(f,g)=t≠0, we can approximately compute Ham( f, g) with probability at least 2/3 by combining our algorithm and {Approx-Count(f,ɛ ) algorithm} using the expected number of Θ( √{N/(\\lfloor ɛ t\\rfloor +1)}+√{t(N-t)}/\\lfloor ɛ t\\rfloor +1) queries, promised that the accuracy is ɛ . Moreover, our algorithm is optimal, while the exact query complexity for the above problem is Θ(N) and the query complexity with the accuracy ɛ is O(1/ɛ 2N/(t+1)) in classical algorithm, where N=2n. Finally, we present three exact quantum query algorithms for two promise problems on Hamming distance using O(1) queries, while any classical deterministic algorithm solving the problem uses Ω(2n) queries.

PM1 steganographic algorithm using ternary Hamming Code

Directory of Open Access Journals (Sweden)

Kamil Kaczyński

2015-12-01

Full Text Available PM1 algorithm is a modification of well-known LSB steganographic algorithm. It has increased resistance to selected steganalytic attacks and increased embedding efficiency. Due to its uniqueness, PM1 algorithm allows us to use of larger alphabet of symbols, making it possible to further increase steganographic capacity. In this paper, we present the modified PM1 algorithm which utilizies so-called syndrome coding and ternary Hamming code. The modified algorithm has increased embedding efficiency, which means fewer changes introduced to carrier and increased capacity.[b]Keywords[/b]: steganography, linear codes, PM1, LSB, ternary Hamming code

Evaluation of dried salted pork ham and neck quality

OpenAIRE

Simona Kunová; Juraj Čuboň; Ondřej Bučko; Miroslava Kačániová; Jana Tkáčová; Lukáš Hleba; Peter Haščík; Ľubomír Lopašovský

2015-01-01

The aim of the present study was analysed chemical and physical parameters of dried salted pork ham and neck. Dry-cured meat is a traditional dry-cured product obtained after 12 - 24 months of ripening under controlled environmental conditions.  Ham and neck was salted by nitrite salt mixture during 1 week. Salted meat products were dried at 4 °C and relative humidity 85% 1 week after salting. The quality of dry-cured meat is influenced by the processing technology, f...

Quality attributes and color characteristics in three-piece boneless hams.

Science.gov (United States)

McKeith, Russell O; Pringle, T Dean

2013-09-01

One hundred and fifty hams were selected on visual assessment of quality into normal (C) and two-tone (TT) groups. CIE LAB color and pH measurements were collected at the plant 48h postmortem on the gluteus medius (GM), gluteus profundus (GP), and rectus femoris (RF), and again at 72h on the semimembranosus (SM), biceps femoris (BF), semitendinosus (ST), and RF. Data were analyzed using GLM procedures of SAS, and correlations between color scores, pH, and drip loss were calculated. Plant and fabrication pH were lower (Phams compared with C. Muscles from TT hams had lower (Pcolor and pH are accurate predictors of pork quality attributes in the muscles of a three-piece boneless ham. Copyright © 2013 Elsevier Ltd. All rights reserved.

The Hamilton Depression Scale (HAM-D) and the Montgomery–Åsberg Depression Scale (MADRS)

DEFF Research Database (Denmark)

Bech, Per; Allerup, Peter; Larsen, Erik Roj

2014-01-01

The objective of this re-analysis of the European Genome-Based Therapeutic Drugs for Depression Study (GENDEP) was to psychometrically test the unidimensionality of the full Montgomery Åsberg Depression Rating Scale (MADRS10) and the Hamilton Depression Scale (HAM-D17) versus their respective...... subscales (MADRS5 and HAM-D6) containing the core symptoms of depression severity. Rasch analysis was applied using RUMM 2030 software to assess the overall fit for unidimensionality. Neither the MADRS10 nor the HAM-D17 was found to fit the Rasch model for unidimensionality. The HAM-D6 (containing the items...... of depressed mood, guilt, work and interests, psychomotor retardation, psychic anxiety, and somatic general) as well as the analogue MADRS5 were tested for unidimensionality by use of the RUMM 2030 programme, and only the HAM-D6 was accepted. When testing for invariance across rating weeks or centres, the RUMM...

Evolution of chemical-physical parameters and rheological characteristics of Sarda and Maltese goat dry hams

Directory of Open Access Journals (Sweden)

Rina Mazzette

2012-10-01

Full Text Available In Sardinia, goat farming is a very important resource. Sarda and Maltese breed are reared mainly for milk production and for suckling kids meat, while meat from adult goats is undervalued. The use of adult goat meat to obtain ripened ham will contribute to safeguard the Sardinian goat supply chain. The aim of the present study was to characterize Sarda and Maltese goat dry ham in order to evaluate the quality of autochthonous goat breed meat. Chemical-physical characteristics were determined dur-ing the production stages, while the rheological and colour parameters and the composition of the goat ham were determined at the end of ripening. The pH evolution during processing were similar to other cured meat products, e.g. sheep hams, even though the values were high, especially in the products from Sarda breed. The aw value regularly decreased during processing. Colour parameters (L*, a*, b* in the hams from Maltese goat breed were significantly (P<0.05 higher than in those from Sarda. The Sarda goat ham showed a significantly lower percentage of moisture (42% vs 52%, an higher protein content (44.35% vs 34.19%, while no differences were pointed out in the total fat content. Among the ham rheological properties, hardness parameters showed higher levels (13850.22±7589.92 vs 11073.99±6481.31, respectively in Sarda and Maltese hams in comparison to similar products from pork and sheep, while adhesiveness value was lower. The results show that the quality parameters of goat ripened hams are affected mainly by the charac-teristics of the goat meat, in relation on the breed and the breeding system, and, less, by the traditional technology.

The use of atmospheric pressure plasma as a curing process for canned ground ham.

Science.gov (United States)

Lee, Juri; Jo, Kyung; Lim, Yubong; Jeon, Hee Joon; Choe, Jun Ho; Jo, Cheorun; Jung, Samooel

2018-02-01

This study investigated the potential use of atmospheric pressure plasma (APP) treatment as a curing process for canned ground ham. APP treatment for 60min while mixing increased the nitrite content in the meat batters from 0.64 to 60.50mgkg -1 while the pH and the total content of aerobic bacteria in the meat batters were unchanged. The canned ground hams cured by the APP treatment for 30min displayed no difference in their physicochemical qualities, such as nitrosyl hemochrome, color, residual nitrite, texture, lipid oxidation, and protein oxidation, compared with those of canned ground hams cured with sodium nitrite or celery powder at 42mgkg -1 of nitrite. The canned ground hams cured by the APP treatment received a higher score in taste and overall acceptability than those cured with sodium nitrite. Canned ground ham can be cured by the APP treatment without nitrite additives. Copyright © 2017 Elsevier Ltd. All rights reserved.

Physicochemical and sensory properties of irradiated dry-cured ham

International Nuclear Information System (INIS)

Jin, Sang-Keun; Kim, Chul-Wook; Chung, Ki-Hwa; Jo, Kwang-Keun; Jeong, Jin-Yeon; Hur, In-Chul; Jung, Eun-Young; Joo, Seon-Tea; Yang, Han-Sul

2012-01-01

To determine the effect of different irradiation doses on ready-to-eat (RTE) dry-cured shoulder hams, physicochemical and sensory attributes were analyzed during 8 weeks of refrigerated storage. The results show that irradiation reduced the redness value and increased the 2-thiobarbituric acid-reactive substance (TBARS) value as well as the irradiation aroma during storage. However, ham samples irradiated with 2.5 and 5.0 kGy did not show significant changes in lightness values compared to the control sample during 8 weeks of storage. TBARS values were lower in the sample irradiated with 2.5 kGy than in the other irradiated samples. The total plate counts of the 5.0 kGy-irradiated samples were not measured after 0 weeks. Sensory panels found that the 2.5- and 5.0 kGy-irradiated samples had better overall acceptability scores than the other irradiated samples. It was concluded that treatments with lower levels of irradiation (≤5.0 kGy) can enhance the microbial safety and sensory acceptance of dry-cured shoulder hams. - Highlights: ► Effect of different irradiation doses on quality properties of dry-cured hams. ► The 2.5 kGy irradiated sample did not show any changes in lipid oxidation. ► Irradiation at 5.0 kGy has the potential to greatly decrease the TPC. ► Low-dose irradiation can improve the microbial safety and maintain the sensory acceptance.

Getting started with electronic projects

CERN Document Server

Pretty, Bill

2015-01-01

This book is aimed at hobbyists with basic knowledge of electronics circuits. Whether you are a novice electronics project builder, a ham radio enthusiast, or a BeagleBone tinkerer, you will love this book.

Impact of whey protein coating incorporated with Bifidobacterium and Lactobacillus on sliced ham properties.

Science.gov (United States)

Odila Pereira, Joana; Soares, José; J P Monteiro, Maria; Gomes, Ana; Pintado, Manuela

2018-05-01

Edible coatings/films with functional ingredients may be a solution to consumers' demands for high-quality food products and an extended shelf-life. The aim of this work was to evaluate the antimicrobial efficiency of edible coatings incorporated with probiotics on sliced ham preservation. Coatings was developed based on whey protein isolates with incorporation of Bifidobacterium animalis Bb-12® or Lactobacillus casei-01. The physicochemical analyses showed that coating decreased water and weight loss on the ham. Furthermore, color analysis showed that coated sliced ham, exhibited no color change, comparatively to uncoated slices. The edible coatings incorporating the probiotic strains inhibited detectable growth of Staphylococcus spp., Pseudomonas spp., Enterobacteriaceae and yeasts/molds, at least, for 45days of storage at 4°C. The sensory evaluation demonstrated that there was a preference for the sliced coated ham. Probiotic bacteria viable cell numbers were maintained at ca. 10 8 CFU/g throughout storage time, enabling the slice of ham to act as a suitable carrier for the beneficial bacteria. Copyright © 2018 Elsevier Ltd. All rights reserved.

Exploring consumer satisfaction with dry-cured ham in five European countries

DEFF Research Database (Denmark)

Resano, Helena; Perez-Cueto, Federico J. A.; Sanjuán, Ana

2011-01-01

This papers' objective is to investigate consumer satisfaction with dry-cured ham in five European countries. A logistic regression model has been fitted using data collected through a crosssectional web-based survey carried out in Belgium, Germany, Denmark, Poland and Greece during January 2008 (n......=2437 of which 2156 were dry-cured ham consumers). Satisfaction was evaluated as overall satisfaction, as well as specific satisfaction with healthfulness, price, convenience and taste. The findings show that the main determinant of overall satisfaction is taste satisfaction, hence, producers...... are recommended to focus on matching sensory acceptability of dry-cured ham. No significant between-country differences were found, reflecting the wide availability of this product in all countries. Consumer characteristics influenced their level of satisfaction. Men, older (age >52 years) and frequent consumers...

Effect of Oyster Shell Calcium Powder on the Quality of Restructured Pork Ham.

Science.gov (United States)

Choi, Jung-Seok; Lee, Hyun-Jin; Jin, Sang-Keun; Lee, Hyun-Joo; Choi, Yang-Il

2014-01-01

This study was conducted to evaluate the effects of oyster shell calcium powder (OSCP) as a substitute for phosphates in curing agent, on the quality of restructured pork ham. Restructured pork ham was processed under six treatment conditions: T1 (no additives), T2 (0.3% sodium tripolyphosphate), T3 (1.5% NaCl+0.5% whey protein), T4 (1.5% NaCl+0.5% whey protein+0.15% OSCP), T5 (1.5% NaCl+0.5% whey protein+0.3% OSCP), and T6 (1.5% NaCl+0.5% whey protein+0.5% OSCP). Addition of OSCP significantly increased the ash content and pH of restructured pork ham (pham. Addition of OSCP had no effect on Hunter a and b surface color values of restructured pork ham, but did decrease the Hunter L surface color value (pham, compared with the addition of phosphates (pham.

Analysis and classification of commercial ham slice images using directional fractal dimension features.

Science.gov (United States)

Mendoza, Fernando; Valous, Nektarios A; Allen, Paul; Kenny, Tony A; Ward, Paddy; Sun, Da-Wen

2009-02-01

This paper presents a novel and non-destructive approach to the appearance characterization and classification of commercial pork, turkey and chicken ham slices. Ham slice images were modelled using directional fractal (DF(0°;45°;90°;135°)) dimensions and a minimum distance classifier was adopted to perform the classification task. Also, the role of different colour spaces and the resolution level of the images on DF analysis were investigated. This approach was applied to 480 wafer thin ham slices from four types of hams (120 slices per type): i.e., pork (cooked and smoked), turkey (smoked) and chicken (roasted). DF features were extracted from digitalized intensity images in greyscale, and R, G, B, L(∗), a(∗), b(∗), H, S, and V colour components for three image resolution levels (100%, 50%, and 25%). Simulation results show that in spite of the complexity and high variability in colour and texture appearance, the modelling of ham slice images with DF dimensions allows the capture of differentiating textural features between the four commercial ham types. Independent DF features entail better discrimination than that using the average of four directions. However, DF dimensions reveal a high sensitivity to colour channel, orientation and image resolution for the fractal analysis. The classification accuracy using six DF dimension features (a(90°)(∗),a(135°)(∗),H(0°),H(45°),S(0°),H(90°)) was 93.9% for training data and 82.2% for testing data.

HAM-5 functions as a MAP kinase scaffold during cell fusion in Neurospora crassa.

Directory of Open Access Journals (Sweden)

Wilfried Jonkers

2014-11-01

Full Text Available Cell fusion in genetically identical Neurospora crassa germlings and in hyphae is a highly regulated process involving the activation of a conserved MAP kinase cascade that includes NRC-1, MEK-2 and MAK-2. During chemotrophic growth in germlings, the MAP kinase cascade members localize to conidial anastomosis tube (CAT tips every ∼8 minutes, perfectly out of phase with another protein that is recruited to the tip: SOFT, a recently identified scaffold for the MAK-1 MAP kinase pathway in Sordaria macrospora. How the MAK-2 oscillation process is initiated, maintained and what proteins regulate the MAP kinase cascade is currently unclear. A global phosphoproteomics approach using an allele of mak-2 (mak-2Q100G that can be specifically inhibited by the ATP analog 1NM-PP1 was utilized to identify MAK-2 kinase targets in germlings that were potentially involved in this process. One such putative target was HAM-5, a protein of unknown biochemical function. Previously, Δham-5 mutants were shown to be deficient for hyphal fusion. Here we show that HAM-5-GFP co-localized with NRC-1, MEK-2 and MAK-2 and oscillated with identical dynamics from the cytoplasm to CAT tips during chemotropic interactions. In the Δmak-2 strain, HAM-5-GFP localized to punctate complexes that did not oscillate, but still localized to the germling tip, suggesting that MAK-2 activity influences HAM-5 function/localization. However, MAK-2-GFP showed cytoplasmic and nuclear localization in a Δham-5 strain and did not localize to puncta. Via co-immunoprecipitation experiments, HAM-5 was shown to physically interact with NRC-1, MEK-2 and MAK-2, suggesting that it functions as a scaffold/transport hub for the MAP kinase cascade members for oscillation and chemotropic interactions during germling and hyphal fusion in N. crassa. The identification of HAM-5 as a scaffold-like protein will help to link the activation of MAK-2 cascade to upstream factors and proteins involved in this

A study of chemical profiles and appearance of white crystals in Istrian dry-cured ham: effect of desalting

Directory of Open Access Journals (Sweden)

Helga Medić

2010-01-01

Full Text Available In order to find out the effect on physical-chemical profile of Istrian dry-cured ham with particular regard to the appearance of white crystals in the muscles, raw salted legs were desalted by soaking the legs in cold water for 24 hours. The 20 raw hams taken from 10 slaughtered hogs (Swedish Landrace breed and processed in the traditional Istrian manner were used. After salting and pressing, the raw hams were divided into two groups: 1 the 10 left legs of each hog were desalted (D; 2 the 10 right legs were not desalted (N. Following this, both groups of legs were subjected to continuous processing. Samples for chemical analysis and counting of white spots were taken from the 20 legs (10 N and 10 D from 10 hogs, each weighing 12 to 15 kg. Chemical analysis of muscle tissue showed a highly significant difference (P<0.0001 in the salt quantity in the N (6.85% and D (5.31% dry-cured hams, as expected. Desalting affected the level of calcium which was higher (P=0.0124 in the D hams (0.27 g than in the N hams (0.22 g. Desalting did not affect the free amino acid content, with the exception of methionine which was lower (P=0.0041 in D (0.14 g than in N hams (0.17 g. Desalting affected the level of two free fatty acids as follows: heptadecanoic acid was higher (P=0.0203 in N (0.18% than in D hams (0.24% and DPA was higher (P=0.0373 in N (0.49% than in D hams (0.39%. By counting the white precipitates, it was established that the regularity of appearance of the precipitate was noted on both the D and N hams, such that where there was no precipitate on the right N ham, nor was their any on the left D ham of the same hog. However, desalting only lead to a slight decrease in the appearance of precipitates (average of 0.7 points, but it is certain that desalting reduces the salt content in the legs, which affects some physical- chemical changes in the ham tissues during processing.

The Graph, Geometry and Symmetries of the Genetic Code with Hamming Metric

Directory of Open Access Journals (Sweden)

Reijer Lenstra

2015-07-01

Full Text Available The similarity patterns of the genetic code result from similar codons encoding similar messages. We develop a new mathematical model to analyze these patterns. The physicochemical characteristics of amino acids objectively quantify their differences and similarities; the Hamming metric does the same for the 64 codons of the codon set. (Hamming distances equal the number of different codon positions: AAA and AAC are at 1-distance; codons are maximally at 3-distance. The CodonPolytope, a 9-dimensional geometric object, is spanned by 64 vertices that represent the codons and the Euclidian distances between these vertices correspond one-to-one with intercodon Hamming distances. The CodonGraph represents the vertices and edges of the polytope; each edge equals a Hamming 1-distance. The mirror reflection symmetry group of the polytope is isomorphic to the largest permutation symmetry group of the codon set that preserves Hamming distances. These groups contain 82,944 symmetries. Many polytope symmetries coincide with the degeneracy and similarity patterns of the genetic code. These code symmetries are strongly related with the face structure of the polytope with smaller faces displaying stronger code symmetries. Splitting the polytope stepwise into smaller faces models an early evolution of the code that generates this hierarchy of code symmetries. The canonical code represents a class of 41,472 codes with equivalent symmetries; a single class among an astronomical number of symmetry classes comprising all possible codes.

9 CFR 319.106 - “Country Ham,” “Country Style Ham,” “Dry Cured Ham,” “Country Pork Shoulder,” “Country Style Pork...

Science.gov (United States)

2010-01-01

... INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Cured Meats, Unsmoked and..., or from a single piece of meat from a pork shoulder. They are prepared in accordance with paragraph...Dry Cured Ham,â âCountry Pork Shoulder,â âCountry Style Pork Shoulder,â and âDry Cured Pork Shoulder.â...

6-Thioguanine, cytarabine, and daunorubicin (TAD) and high-dose cytarabine and mitoxantrone (HAM) for induction, TAD for consolidation, and either prolonged maintenance by reduced monthly TAD or TAD-HAM-TAD and one course of intensive consolidation by sequential HAM in adult patients at all ages with de novo acute myeloid leukemia (AML): a randomized trial of the German AML Cooperative Group.

Science.gov (United States)

Büchner, Thomas; Hiddemann, Wolfgang; Berdel, Wolfgang E; Wörmann, Bernhard; Schoch, Claudia; Fonatsch, Christa; Löffler, Helmut; Haferlach, Torsten; Ludwig, Wolf-Dieter; Maschmeyer, Georg; Staib, Peter; Aul, Carlo; Gruneisen, Andreas; Lengfelder, Eva; Frickhofen, Norbert; Kern, Wolfgang; Serve, Hubert L; Mesters, Rolf M; Sauerland, Maria Cristina; Heinecke, Achim

2003-12-15

To examine the efficacy of prolonged maintenance chemotherapy versus intensified consolidation therapy for patients with acute myeloid leukemia (AML). Eight hundred thirty-two patients (median age, 54 years; range, 16 to 82 years) with de novo AML were randomly assigned to receive 6-thioguanine, cytarabine, and daunorubicin (TAD) plus cytarabine and mitoxantrone (HAM; cytarabine 3 g/m2 [age or = 60 years] x 6) induction, TAD consolidation, and monthly modified TAD maintenance for 3 years, or TAD-HAM-TAD and one course of intensive consolidation with sequential HAM (S-HAM) with cytarabine 1 g/m2 (age or = 60 years) x 8 instead of maintenance. A total of 69.2% patients went into complete remission (CR). Median relapse-free survival (RFS) was 19 months for patients on the maintenance arm, with 31.4% of patients relapse-free at 5 years, versus 12 months for patients on the S-HAM arm, with 24.7% of patients relapse-free at 5 years (P =.0118). RFS from maintenance was superior in patients with poor risk by unfavorable karyotype, age > or = 60 years, lactate dehydrogenase level greater than 700 U/L, or day 16 bone marrow blasts greater than 40% (P =.0061) but not in patients with good risk by complete absence of any poor risk factors. Although a survival benefit in the CR patients is not significant (P =.085), more surviving patients in the maintenance than in the S-HAM arm remain in first CR (P =.026). We conclude that TAD-HAM-TAD-maintenance first-line treatment has a higher curative potential than TAD-HAM-TAD-S-HAM and improves prognosis even among patients with poor prognosis.

Multidimensional HAM-conditions

DEFF Research Database (Denmark)

Hansen, Ernst Jan de Place

Heat, Air and Moisture (HAM) conditions, experimental data are needed. Tests were performed in the large climate simulator at SBi involving full-scale wall elements. The elements were exposed for steady-state conditions, and temperature cycles simulating April and September climate in Denmark....... The effect on the moisture and temperature conditions of the addition of a vapour barrier and an outer cladding on timber frame walls was studied. The report contains comprehensive appendices documenting the full-scale tests. The tests were performed as a part of the project 'Model for Multidimensional Heat......, Air and Moisture Conditions in Building Envelope Components' carried out as a co-project between DTU Byg and SBi....

Lipolysis, lipid peroxidation, and color characteristics of Serrano Hams from Duroc and large white pigs during dry-curing.

Science.gov (United States)

del Olmo, Ana; Calzada, Javier; Nuñez, Manuel

2013-11-01

Lipolysis, lipid peroxidation, and colorimetric characteristics of Serrano hams from Duroc and Large White pigs along a 15-mo curing period were investigated. Physicochemical parameters of both types of hams evolved similarly during curing. Twelve of 13 free fatty acids (FFAs) increased during curing, eicosatrienoic acid being the only exception. Linoleic, stearic, and arachidonic acids and the minor heptadecanoic acid reached lower concentrations, and the rest of minor FFAs higher concentrations, in Duroc hams than in Large White hams. The index measuring the early stage of lipid peroxidation declined from month 5 onwards, indicating that the phenomenon had been completed by month 5, while the index of the secondary stage of lipid peroxidation increased with curing time. Higher values were found for the 1st index in Duroc hams. Curing affected color parameters. Lightness decreased and redness increased in both types of hams, while yellowness decreased only in Duroc hams. Lower redness values were found for Duroc hams. Major differences in color parameters were found between muscles. Principal components analysis of FFAs yielded 2 main principal components. The 1st factor, correlated with all FFAs excepting eicosatrienoic acid, allowed discrimination between curing times. The 2nd factor, correlated with eicosatrienoic acid, permitted discrimination between breeds. © 2013 Institute of Food Technologists®

Eignung von HAM-Nat und TMS-Modul "Medizinisch-naturwissenschaftliches Grundverständnis" für die Studienbewerberauswahl in der Medizin [Suitability of the HAM-Nat test and TMS module "basic medical-scientific understanding" for medical school selection

Directory of Open Access Journals (Sweden)

Hissbach, Johanna

2012-11-01

Full Text Available [english] Aims: Tests with natural-scientific content are predictive of the success in the first semesters of medical studies. Some universities in the German speaking countries use the ‘Test for medical studies’ (TMS for student selection. One of its test modules, namely “medical and scientific comprehension”, measures the ability for deductive reasoning. In contrast, the Hamburg Assessment Test for Medicine, Natural Sciences (HAM-Nat evaluates knowledge in natural sciences. In this study the predictive power of the HAM-Nat test will be compared to that of the NatDenk test, which is similar to the TMS module “medical and scientific comprehension” in content and structure. Methods: 162 medical school beginners volunteered to complete either the HAM-Nat (N=77 or the NatDenk test (N=85 in 2007. Until spring 2011, 84.2% of these successfully completed the first part of the medical state examination in Hamburg. Via different logistic regression models we tested the predictive power of high school grade point average (GPA or “Abiturnote” and the test results (HAM-Nat and NatDenk with regard to the study success criterion “first part of the medical state examination passed successfully up to the end of the 7 semester” (Success7Sem. The Odds Ratios (OR for study success are reported.Results: For both test groups a significant correlation existed between test results and study success (HAM-Nat: OR=2.07; NatDenk: OR=2.58. If both admission criteria are estimated in one model, the main effects (GPA: OR=2.45; test: OR=2.32 and their interaction effect (OR=1.80 are significant in the HAM-Nat test group, whereas in the NatDenk test group only the test result (OR=2.21 significantly contributes to the variance explained. Conclusions: On their own both HAM-Nat and NatDenk have predictive power for study success, but only the HAM-Nat explains additional variance if combined with GPA. The selection according to HAM-Nat and GPA has under the

Political culture and the labour movement: a comparison between Poplar and West Ham, 1889-1914

OpenAIRE

Banks-Conney, Diana Elisabeth

2005-01-01

This thesis compares two areas of East London, Poplar and West Ham,that ultimately became strongholds of the Labour Party. The thesis attemptsto answer the crucial question of why, prior to 1914, it seemed as if Labour had succeeded in South West Ham but had failed to achieve similar representation in Poplar. This thesis considers that although contemporaries had identified similar social and economic problems in both Poplar and West Ham in the early twentieth century, more detailed analysis ...

Weak isometries of Hamming spaces

Directory of Open Access Journals (Sweden)

Ryan Bruner

2016-09-01

Full Text Available Consider any permutation of the elements of a (finite metric space that preserves a specific distancep. When is such a permutation automatically an isometry of the metric space? In this note we studythis problem for the Hamming spaces H(n,q both from a linear algebraic and combinatorial pointof view. We obtain some sufficient conditions for the question to have an affirmative answer, as wellas pose some interesting open problems.

The motor evoked potential in AIDS and HAM/TSP: state of the evidence.

Science.gov (United States)

Leon-Sarmiento, Fidias E; Elfakhani, Mohamed; Boutros, Nash N

2009-12-01

We aimed to better understand the involvement of the corticospinal tract, assessed by non-invasive transcranial stimulation, in order to determine the actual involvement of the motor system in patients with HAM/TSP and AIDS. An exhaustive MEDLINE search for the period of 1985 to 2008 for all articles cross-referenced for 'HTLV-I, HTLV-II, HTLV-III and HIV, HIV1, HIV2, evoked potential, motor evoked potential, high voltage electrical stimulation, transcranial magnetic stimulation, magnetic stimulation, corticomotor physiology, motor pathways, acquired immunodeficiency syndrome, AIDS, SIDA, tropical spastic paraparesis, HTLV-I-associated myelopathy, HAM, TSP, and HAM/TSP' were selected and analysed. Eighteen papers published in English, Spanish, Portuguese, French and Japanese were identified. Only the central motor conduction time has been analyzed in seropositive patients to human retroviruses. The investigations done on HAM/TSP support the involvement of the pyramidal tract mainly at lower levels, following a centripetal pattern; in AIDS, such an involvement seems to be more prominent at brain levels following a centrifugal pattern. The central motor conduction time abnormalities and involvement differences of the corticospinal tract of patients with AIDS and HAM/TSP dissected here would allow to re-orient early neurorehabilitation measures in these retroviruses-associated neurodegenerative disorders. Besides this, more sophisticated and sensitive non-invasive corticospinal stimulation measures that detect early changes in thalamocortical-basal ganglia circuitry will be needed in both clinically established as well as asymptomatic patients at times when the fastest corticospinal fibers remain uninvolved.

RESEARCH Comparison of HTLV-associated myelopathy (HAM) in ...

African Journals Online (AJOL)

and HAM4 but did not directly compare patients with and without. HIV infection. .... proportion to sensory symptoms: all older patients had sensory symptoms ... age of initiation of sexual intercourse and multiple sexual partners.9. Patients ...

Survival of Escherichia coli O157:H7 in needle-tenderized dry cured Westphalian ham.

Science.gov (United States)

Graumann, Gary H; Holley, Richard A

2007-09-15

Westphalian ham is a dry cured, ready-to-eat product that is manufactured without a lethal heat treatment. Hams are preserved by a process that involves curing, fermenting, smoking and drying, which may take 3 months or more to complete. The process can be accelerated by tenderizing the meat with solid needles, to increase the rate of cure-salt diffusion throughout muscle tissues. In this study, intact hams were immersed in a solution containing a five strain cocktail of Escherichia coli O157:H7 at 8 log cfu/mL, to determine whether needle treatment before cure application would internalize organisms from the surface. In two trials, the survival of E. coli O157:H7 on external surfaces and within deep tissues after needle treatment was followed during the ripening of hams. The injured E. coli O157:H7 cells were recovered by plating samples on pre-poured Tryptic Soy Agar plates which were incubated for 3 to 4 h at 35 degrees C, overlaid with Sorbitol MacConkey Agar containing cefixime and tellurite and re-incubated at 35 degrees C for 48 to 72 h. Inoculated-injected hams initially carried E. coli O157:H7 at numbers of 7.3 and 4.6 log cfu/g E. coli O157:H7 on the surface and inside, respectively. After 112 d of ripening, which included 79 d of drying, no E. coli O157:H7 were detected at the surface of hams following enrichment, whereas in deep tissue the organism was recovered at numbers of 3.1 log cfu/g. The Westphalian ham ripening procedure evidently was not adequate to eliminate E. coli O157:H7 internalized by needle tenderization.

Effects of marketing group on the quality of fresh and cured hams sourced from a commercial processing facility

Science.gov (United States)

The objective was: 1) to characterize the effect of marketing 30 group on fresh and cured ham quality, and 2) to determine which fresh ham traits correlated to cured ham quality traits. Pigs raised in 8 barns representing two seasons (hot and cold) and two production focuses (lean and quality) were ...

Lower bounds on the periodic Hamming correlations of frequency hopping sequences with low hit zone

Institute of Scientific and Technical Information of China (English)

无

2006-01-01

In this paper, several periodic Hamming correlation lower bounds for frequency hopping sequences with low hit zone, with respect to the size p of the frequency slot set, the sequence length L, the family size M, low hit zone LH ( or no hit zone NH ), the maximum periodic Hamming autocorrelation sidelobe Ha and the maximum periodic Hamming crosscorrelation Hc, are established. It is shown that the new bounds include the known Lempel-Greenberger bounds, T.S. Seay bounds and Peng-Fan bounds for the conventional frequency hopping sequences as special cases.

Between preservation and transformation. First considerations about the recovery of the peep districts in Parma

Directory of Open Access Journals (Sweden)

Luca Gullì

2012-10-01

Full Text Available The regeneration policy of the PEEP districts, can contribute to the enrichment of the theoretical framework formulated for the protection of the heritage of the Modern Movement. In 2011, the Municipality of Parma, showing a new awareness in relation to assets until now rarely considered, devices a specific field of study within its structural urbanistic plan. In the absence of a regulatory framework of reference, it is crucial to build up the appropriate frameworks of knowledge directed to operational decisions. This can be done by specifically dedicated archives to which to entrust with the definition of a body of rules of urban planning and housing tailored to the particularities of these settlements and to the real questions of transformation that can arise in them.

ROCK TYPOLOGY IN CHOOSING SPRINGS. ANCIENT METHODS FOR DETERMINING WATER QUALITY IN THE PARMA REGION

Directory of Open Access Journals (Sweden)

Valentino Straser

2011-12-01

Full Text Available This study was a scientific validation of some ancient methods used for purifying water and selecting springs based on the nature of the soil and rocks. A historical and scientific analysis of the territory was made, with the aim of trying to identify ancient methods which might be retrieved and used again in a modern way for a comprehensive interpretation of the environment we live in. The investigation was led near Parma in the north of Italy, in mountainous and hilly areas which rise from rocky outcrops consisting of fragments of the ancient oceanic crust composed of argillaceous complexes, ultrabasic rocks from the ophiolite succession as well as flyschoid sedimentary rocks containing arenaceous, carboniferous and marly elements.

Effect of use of citrus bagasse as functional product-extender on physicochemical and textural properties of cooked ham

Directory of Open Access Journals (Sweden)

José Antonio Aguilar-Rico

2011-12-01

Full Text Available The substitution effect of carrageenan, soy protein and potato starch by orange bagasse on physico-chemical characteristics of cooked ham was evaluated. A 33 factorial design was used, with substitution levels of 0, 50 and 100%. The results indicate that the substitution of potato starch for orange bagasse results in increase in the ham yield, but to replace the carrageenan and/or soy protein by orange bagasse, cause decrease in yield below that non-substituted ham. Moreover, if even yields increase with substitution of potato starch by orange bagasse, however, the textural characteristics of the product obtained showed deficiency in comparison with thenon-substituted ham. Apparently orange bagasse substitution does not alter the matrix stability formation in ham, so there was no significant difference in expressible moisture. Substitution of carrageenan, soy protein and potato starch by orange bagasse in ham has highest influence on pH and color parameters, this due probably to compounds presents in the fruit (citric acid and carotenoids. Orange bagasse has high potential as a novel source of dietary fiber in food industry.

HAM-Based Adaptive Multiscale Meshless Method for Burgers Equation

Directory of Open Access Journals (Sweden)

Shu-Li Mei

2013-01-01

Full Text Available Based on the multilevel interpolation theory, we constructed a meshless adaptive multiscale interpolation operator (MAMIO with the radial basis function. Using this operator, any nonlinear partial differential equations such as Burgers equation can be discretized adaptively in physical spaces as a nonlinear matrix ordinary differential equation. In order to obtain the analytical solution of the system of ODEs, the homotopy analysis method (HAM proposed by Shijun Liao was developed to solve the system of ODEs by combining the precise integration method (PIM which can be employed to get the analytical solution of linear system of ODEs. The numerical experiences show that HAM is not sensitive to the time step, and so the arithmetic error is mainly derived from the discrete in physical space.

Ectopic expression of the HAM59 gene causes homeotic transformations of reproductive organs in sunflower (Helianthus annuus L.).

Science.gov (United States)

Shulga, O A; Neskorodov, Ya B; Shchennikova, A V; Gaponenko, A K; Skryabin, K G

2015-01-01

The function of the HAM59 MADS-box gene in sunflower (Helianthus annuus L.) was studied to clarify homeotic C activity in the Asteraceae plant family. For the first time, transgenic sunflower plants with a modified pattern of HAM59 expression were obtained. It was shown that the HAM59 MADS-box transcription factor did mediate C activity in sunflower. In particular, it participated in termination of the floral meristem, repression of the cadastral function of A-activity, and together with other C-type sunflower protein HAM45-in the specification of the identity of stamens and pistils.

The global aerosol-climate model ECHAM-HAM, version 2: sensitivity to improvements in process representations

Directory of Open Access Journals (Sweden)

K. Zhang

2012-10-01

Full Text Available This paper introduces and evaluates the second version of the global aerosol-climate model ECHAM-HAM. Major changes have been brought into the model, including new parameterizations for aerosol nucleation and water uptake, an explicit treatment of secondary organic aerosols, modified emission calculations for sea salt and mineral dust, the coupling of aerosol microphysics to a two-moment stratiform cloud microphysics scheme, and alternative wet scavenging parameterizations. These revisions extend the model's capability to represent details of the aerosol lifecycle and its interaction with climate. Nudged simulations of the year 2000 are carried out to compare the aerosol properties and global distribution in HAM1 and HAM2, and to evaluate them against various observations. Sensitivity experiments are performed to help identify the impact of each individual update in model formulation.

Results indicate that from HAM1 to HAM2 there is a marked weakening of aerosol water uptake in the lower troposphere, reducing the total aerosol water burden from 75 Tg to 51 Tg. The main reason is the newly introduced κ-Köhler-theory-based water uptake scheme uses a lower value for the maximum relative humidity cutoff. Particulate organic matter loading in HAM2 is considerably higher in the upper troposphere, because the explicit treatment of secondary organic aerosols allows highly volatile oxidation products of the precursors to be vertically transported to regions of very low temperature and to form aerosols there. Sulfate, black carbon, particulate organic matter and mineral dust in HAM2 have longer lifetimes than in HAM1 because of weaker in-cloud scavenging, which is in turn related to lower autoconversion efficiency in the newly introduced two-moment cloud microphysics scheme. Modification in the sea salt emission scheme causes a significant increase in the ratio (from 1.6 to 7.7 between accumulation mode and coarse mode emission fluxes of

Detrusor Arreflexia as an End Stage of Neurogenic Bladder in HAM/TSP?

Directory of Open Access Journals (Sweden)

Matheus Tannus

2011-01-01

Full Text Available The HTLV-1 virus is a known agent involved in the development of HAM/TSP. Past studies have typically observed patients with autonomic dysfunction consisting of detrusor overactivity and detrusor-sphincter dyssynergia, with the occasional observation of underactive detrusor or detrusor arreflexia. However, studies have not yet evaluated the progression of neurogenic bladder over time. In this paper, we describe a HAM/TSP patient with the initial development of overactive detrusor, and subsequent development of detrusor arreflexia. Given a paucity of studies characterizing the effects of HTLV-1 on the autonomic nervous system, particularly aspects controlling continence, this patient's clinical course may represent one type of end point for patients with HAM/TSP and neurogenic bladder. Further cohort or case-series studies, with particular emphasis on the progression of neurogenic bladder, are needed to evaluate the significance of this described case in relation to typical disease progression patterns.

CT and MRI findings in HAM. A report on five cases

Energy Technology Data Exchange (ETDEWEB)

Fukaura, Hikoaki; Tashiro, Kunio; Maruo, Yasunori; Moriwaka, Fumio; Itoh, Kazunori; Matsuura, Tooru; Togashi, Takehiro (Hokkaido Univ., Sapporo (Japan). School of Medicine); Hamada, Takeshi; Matsumoto, Akihisa

1989-02-01

The findings of the spinal MR imagings and the CT myelography of 5 cases with HTLV-I associated myelopathy (HAM) were presented. One case who showed transverse myelopathy with a multiple sclerosis-like abrupt onset showed spinal-cord swelling at the early stage on CT myelography; its disappearance was documented 4 months after corticosteroid therapy. The other 4 cases, all with slowly progressive myelopathy, clinically revealed spinal-cord atrophy, especially at the thoracic level, on MR imagings. The degree of spinal-cord atrophy seemed not have any correlation with the clinical and laboratory data or with the corticosteroid therapy. The clinical entity of HAM has not yet been determined, and its relationship with tropical spastic paraparesis (TSP) as well as that with some form of multiple sclerosis is controversial. The neuroradiological findings of MR imaging and CT myelography, including spinal-cord swelling at the early stage, in a case diagnosed as HAM with atypical clinical features or as spinal-cord atrophy in typical chronic cases might contribute to its resolution. (author).

Contribution of Histidine and Lysine to the Generation of Volatile Compounds in Jinhua Ham Exposed to Ripening Conditions Via Maillard Reaction.

Science.gov (United States)

Zhu, Chao-Zhi; Zhao, Jing-Li; Tian, Wei; Liu, Yan-Xia; Li, Miao-Yun; Zhao, Gai-Ming

2018-01-01

To evaluate the role of Maillard reactions in the generation of flavor compounds in Jinhua ham, the reactions of glucose and ethanal with histidine and lysine, respectively, were studied by simulating the ripening conditions of Jinhua ham. The volatile products produced were analyzed using solid phase microextraction-gas chromatography/mass spectrometry. The results showed that 8 volatile compounds were generated by the reaction of glucose and histidine and 10 volatile compounds were generated by the reaction of glucose and lysine. Reactions of ethanal with lysine and with histidine both generated 31 volatile compounds that contributed to the flavor of Jinhua ham. This indicates that histidine and lysine related to Maillard reactions possibly play important roles in the generation of the unique flavor compounds in Jinhua ham. This research demonstrates that free amino acids participate in the generation of volatile compounds from Jinhua ham via the Maillard reaction and provides a basic mechanism to explain flavor formation in Jinhua ham. Jinhua ham is a well-known traditional Chinese dry-cured meat product. However, the formation of the compounds comprising its special flavor is not well understood. Our results indicate that Maillard reactions occur in Jinhua ham under ripening conditions. This work illustrates the contribution of Maillard reactions to the flavor of Jinhua ham. © 2017 Institute of Food Technologists®.

Formation of heterocyclic amines in salami and ham pizza toppings during baking of frozen pizza.

Science.gov (United States)

Gibis, Monika; Weiss, Jochen

2013-06-01

Heterocyclic amines (HAs) are formed as Maillard reaction products in the crust of meat products during heating processes. Two typical pizza toppings--salami and cooked ham--were analyzed for the presence of HAs after baking frozen pizzas at top and bottom temperatures of 250 and 230 °C, respectively. After baking pizza slices for 12 min, MeIQx (2-amino-3,4,8-trimethylimidazo[4,5-f]quinoxaline; 0.2 ng/g), 4,8-DiMeIQx (2-amino-3,8-dimethylimidazo[4,5-f]quinoxaline; 0.5 ng/g), PhIP (2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine; 0.2 ng/g), norharman (4.5 ng/g), and harman (2.5 ng/g) were found in the ham toppings, whereas only the comutagenic norharman (107.4 ng/g) and harman (11.4 ng/g) were found in the salami toppings. The content of MeIQx and 4,8-DiMeIQx in ham increased from 0.3 to 1.8 ng/g and 0.8 to 1.6 ng/g, respectively, when the recommended baking time was increased from 15 min (manufacturer's specification) to 18 min at 230 °C. MeIQx was formed in salami when the heating time was extended to 18 min. Moreover, higher concentrations of PhIP in salami or ham slices were found when baking temperatures were 250 °C rather than 230 °C (baking time of 12 min). However, sensory tests showed that panelists preferred longer-baked pizzas due to an increased crispiness. Thus, results show that a substantial formation of HAs may occur in pizza toppings such as ham and salami, with ham being particularly susceptible when compared to salami. Formation of HAs increases with increasing baking time and temperature. The occurrence of the cupping of ham or salami slices during baking may also increase the formation of HAs. © 2013 Institute of Food Technologists®

Detection of enteroviruses from urban sewage in Parma.

Science.gov (United States)

Cesari, C; Colucci, M E; Veronesi, L; Giordano, R; Paganuzzi, F; Affanni, P; Bracchi, M T; Capobianco, E; Ferrari, G; Tanzi, Maria Luisa

2010-12-01

The human enteroviruses (EV) are the most common and widespread human viruses in the world. They have bowel as their natural habitat and they can spread in the environment through the faecal excretion. In the continental climate Regions these viruses may cause epidemic outbreaks in summer and fall, while in the tropical Regions the EV infections present a high incidence during all year. The symptoms can be minor or subclinic, but they can be also associated to rare and serious diseases. The aim of this study was to evaluate the environmental circulation of polioviruses and non-polio enteroviruses (NPEV) using standard methods of urban wastewater surveillance recommended by the WHO. A total of 188 wastewater samples were collected between February 2005 and December 2008 from two sewage treatment plants in Parma. The sampling was carried out twice a month. Environmental variables were collected for each day of sampling. Out of the 188 examined wastewater samples, 78.7% were positive to the enterovirus research. One out of the 148 positive samples was identified as poliovirus Sabin-like type 3. The remaining 147 positive samples were enteroviruses non polio: Coxsakieviruses and Echoviruses. All Coxsakieviruses isolated were of type B. The proposed method has shown high sensibility, also in presence of very low expected prevalence of vaccine poliovirus. It allows to verify the kind and relative frequency of enteric viruses circulating in the country, whose characteristics (virulence and pathogenicity) may vary with reference to a different epidemiologic and demographic structure of the resident population.

Das Hamburger Auswahlverfahren in der Zahnmedizin – Einführung des HAM-Nat als fachspezifischer Studierfähigkeitstest [The Hamburg Selection Procedure for Dental Students – Introduction of the HAM-Nat as subject-specific test for study aptitude

Directory of Open Access Journals (Sweden)

Kothe, Christian

2013-11-01

Full Text Available [english] Introduction: The present study examines the question whether the selection of dental students should be based solely on average school-leaving grades (GPA or whether it could be improved by using a subject-specific aptitude test.Methods: The HAM-Nat Natural Sciences Test was piloted with freshmen during their first study week in 2006 and 2007. In 2009 and 2010 it was used in the dental student selection process. The sample size in the regression models varies between 32 and 55 students. Results: Used as a supplement to the German GPA, the HAM-Nat test explained up to 12% of the variance in preclinical examination performance. We confirmed the prognostic validity of GPA reported in earlier studies in some, but not all of the individual preclinical examination results. Conclusion: The HAM-Nat test is a reliable selection tool for dental students. Use of the HAM-Nat yielded a significant improvement in prediction of preclinical academic success in dentistry.[german] Einleitung: In der vorliegenden Untersuchung wird der Frage nachgegangen, ob die Auswahl der Studierenden in der Zahnmedizin alleine durch die Abiturdurchschnittsnote erfolgen sollte oder ob sie durch den Einsatz eines fachspezifischen Studierfähigkeitstest verbessert werden kann. Methoden: Der Naturwissenschaftstest HAM-Nat wurde in den Jahren 2006 und 2007 in der Erstsemesterwoche an den Studienanfängerinnen und -anfängern* erprobt sowie 2009 und 2010 im Auswahlverfahren eingesetzt. Die Stichprobengrößen der Regressionsmodelle variieren in allen Jahrgängen zwischen 32 und 55 Teilnehmern. Ergebnisse: Der HAM-Nat erklärte zusätzlich zur Abiturdurchschnittsnote bis zu 12 % der Leistungsvarianz in den vorklinischen Prüfungsleistungen. Die in anderen Studien gefundene prognostische Güte der Abiturdurchschnittsnote konnte für einige, aber nicht für alle Einzelprüfungen bestätigt werden. Schlussfolgerung: Der HAM-Nat erwies sich als zuverlässiges Auswahlinstrument

Symmetry-adapted HAM/3 method and its application to some symmetric molecules

Directory of Open Access Journals (Sweden)

Narita Susumu

2004-01-01

Full Text Available The semiempirical HAM/3 method developed by Lindholm and coworkers about two decades ago has been known to have a deficiency that splits energies for the degenerate energy states. We have recently proposed a group-theoretical approach to remedy the internally broken symmetry of the HAM/3 Hamiltonians. In this paper, we present some results of its application to various small molecules with symmetry Td, C3v, and D3h. The proposed scheme gives correct degeneracy for these molecules.

Symmetry-adapted HAM/3 method and its application to some symmetric molecules

OpenAIRE

Narita, Susumu; Shibuya, Tai-ichi; Fujiwara, Fred Y.; Takahata, Yuji

2004-01-01

The semiempirical HAM/3 method developed by Lindholm and coworkers about two decades ago has been known to have a deficiency that splits energies for the degenerate energy states. We have recently proposed a group-theoretical approach to remedy the internally broken symmetry of the HAM/3 Hamiltonians. In this paper, we present some results of its application to various small molecules with symmetry Td, C3v, and D3h. The proposed scheme gives correct degeneracy for these molecules. O método...

Effect of hot carcass weight on loin, ham, and belly quality from pigs sourced from a commercial processing facility,.

Science.gov (United States)

Harsh, B N; Arkfeld, E K; Mohrhauser, D A; King, D A; Wheeler, T L; Dilger, A C; Shackelford, S D; Boler, D D

2017-11-01

The objective was to determine the predictive abilities of HCW for loin, ham, and belly quality of 7,684 pigs with carcass weights ranging from 53.2 to 129.6 kg. Carcass composition, subjective loin quality, and ham face color were targeted on all carcasses, whereas in-plant instrumental loin color and belly quality were assessed on 52.0 and 47.5% of carcasses, respectively. Loin chop slice shear force (SSF), cured ham quality, and adipose iodine value (IV) were evaluated on at least 10% of the population. The slope of regression lines and coefficients of determination between HCW and quality traits were computed using PROC REG of SAS and considered significant at ≤ 0.05. As HCW increased, boneless loins became darker and redder, evidenced by lower L* (β = -0.0243, color score (β = 0.0024, ham face color ( ham face L* values and 0.47% of the variability in a* values. Heavier carcasses produced thicker and firmer bellies, with HCW accounting for 37.81% of the variability in belly thickness (β = 0.0272, ham quality explained by HCW was poor (≤5.60%), suggesting that HCW is a poor predictor of the primal quality of pigs within this weight range. Nonetheless, HCW was a moderate predictor of belly quality traits. The findings of this study suggest that increasing HCW did not compromise loin, ham, or belly quality attributes.

Assessing the use of frozen pork meat in the manufacture of cooked ham

OpenAIRE

LOS, Francine Gomes Basso; PRESTES, Rosa Cristina; GRANATO, Daniel; SIMÕES, Deise Rosana Silva; ROMAN, Silvane Souza; DEMIATE, Ivo Mottin

2016-01-01

This study aimed to evaluate the effects of slow (–18 °C) and fast freezing (liquid nitrogen) of pork meat, and the use of exudate released upon thawing, on the physicochemical, color, rheological, microbiological, histological, and sensory characteristics of cooked ham. The meat samples were frozen at –18 °C and thawed after 22 weeks for the production of cooked ham. No significant difference was observed regarding physicochemical, color and microbiological parameters or in senso...

Cytoplasmic Localization of HTLV-1 HBZ Protein: A Biomarker of HTLV-1-Associated Myelopathy/Tropical Spastic Paraparesis (HAM/TSP).

Science.gov (United States)

Baratella, Marco; Forlani, Greta; Raval, Goutham U; Tedeschi, Alessandra; Gout, Olivier; Gessain, Antoine; Tosi, Giovanna; Accolla, Roberto S

2017-01-01

HTLV-1 is the causative agent of a severe form of adult T cell leukemia/Lymphoma (ATL), and of a chronic progressive neuromyelopathy designated HTLV-1 associated myelopathy/tropical spastic paraparesis (HAM/TSP). Two important HTLV-1-encoded proteins, Tax-1 and HBZ, play crucial roles in the generation and maintenance of the oncogenic process. Less information is instead available on the molecular and cellular mechanisms leading to HAM/TSP. More importantly, no single specific biomarker has been described that unambiguously define the status of HAM/TSP. Here we report for the first time the finding that HBZ, described until now as an exclusive nuclear protein both in chronically infected and in ATL cells, is instead exclusively localized in the cytoplasm of peripheral blood mononuclear cells (PBMC) from patients suffering of HAM/TSP. Interestingly, at the single cell level, HBZ and Tax-1 proteins are never found co-expressed in the same cell, suggesting the existence of mechanisms of expression uncoupling of these two important HTLV-1 viral products in HAM/TSP patients. Cells expressing cytoplasmic HBZ were almost exclusively found in the CD4+ T cell compartment that was not, at least in a representative HAM/TSP patient, expressing the CD25 marker. Less than 1 percent CD8+ T cells were fond positive for HBZ, while B cells and NK cells were found negative for HBZ in HAM/TSP patients. Our results identify the cytoplasmic localization of HBZ in HAM/TSP patient as a possible biomarker of this rather neglected tropical disease, and raise important hypotheses on the role of HBZ in the pathogenesis of the neuromyelopathy associated to HTLV-1 infection.

Cytoplasmic Localization of HTLV-1 HBZ Protein: A Biomarker of HTLV-1-Associated Myelopathy/Tropical Spastic Paraparesis (HAM/TSP.

Directory of Open Access Journals (Sweden)

Marco Baratella

2017-01-01

Full Text Available HTLV-1 is the causative agent of a severe form of adult T cell leukemia/Lymphoma (ATL, and of a chronic progressive neuromyelopathy designated HTLV-1 associated myelopathy/tropical spastic paraparesis (HAM/TSP. Two important HTLV-1-encoded proteins, Tax-1 and HBZ, play crucial roles in the generation and maintenance of the oncogenic process. Less information is instead available on the molecular and cellular mechanisms leading to HAM/TSP. More importantly, no single specific biomarker has been described that unambiguously define the status of HAM/TSP. Here we report for the first time the finding that HBZ, described until now as an exclusive nuclear protein both in chronically infected and in ATL cells, is instead exclusively localized in the cytoplasm of peripheral blood mononuclear cells (PBMC from patients suffering of HAM/TSP. Interestingly, at the single cell level, HBZ and Tax-1 proteins are never found co-expressed in the same cell, suggesting the existence of mechanisms of expression uncoupling of these two important HTLV-1 viral products in HAM/TSP patients. Cells expressing cytoplasmic HBZ were almost exclusively found in the CD4+ T cell compartment that was not, at least in a representative HAM/TSP patient, expressing the CD25 marker. Less than 1 percent CD8+ T cells were fond positive for HBZ, while B cells and NK cells were found negative for HBZ in HAM/TSP patients. Our results identify the cytoplasmic localization of HBZ in HAM/TSP patient as a possible biomarker of this rather neglected tropical disease, and raise important hypotheses on the role of HBZ in the pathogenesis of the neuromyelopathy associated to HTLV-1 infection.

Application of Gelidium corneum edible films containing carvacrol for ham packages.

Science.gov (United States)

Lim, G O; Hong, Y H; Song, K B

2010-01-01

We prepared an edible film of Gelidium corneum (GC) containing carvacrol as an antimicrobial and antioxidative agent. The GC film containing carvacrol significantly decreased the WVP, while TS and %E values were increased, compared to the film without carvacrol. Increasing amounts of an antimicrobial agent increased antimicrobial activity against Escherichia coli O157:H7 and Listeria monocytogenes. Application of the film to ham packaging successfully inhibited the microbial growth and lipid oxidation of ham during storage. Our results indicate that GC film can be a useful edible packaging material for food products, and the incorporation of carvacrol in the GC film may extend the shelf life.

The use of high pressure processing to enhance the quality and shelf life of reduced sodium naturally cured restructured cooked hams.

Science.gov (United States)

Pietrasik, Z; Gaudette, N J; Johnston, S P

2016-06-01

The combined effect of partial salt replacement with modified potassium chloride and high pressure processing (600 MPa for 3 min at 8°C) on the quality and shelf life of naturally-cured restructured hams was investigated over a 12 week storage period. Instrumental, microbiological and consumer acceptability testing was performed. A partial salt substitution with modified potassium chloride adversely affected textural and water binding characteristics of hams and led to a decrease in the consumer acceptance compared to regular salt hams. Celery powder used as a curing agent had beneficial effects on water holding and moisture retention and improved bind of restructured hams; however the consumer acceptability of flavor and aftertaste received significantly lower scores compared to nitrite. No significant differences in all consumer acceptability parameters resulted for hams subjected to HPP compared to non-HPP for all storage periods indicating that HPP can effectively extend shelf-life of restructured ham without compromising eating quality. Crown Copyright © 2016. Published by Elsevier Ltd. All rights reserved.

Reduzierbarkeit der Abbrecherquote im Humanmedizinstudium durch das Hamburger Auswahlverfahren für Medizinische Studiengänge - Naturwissenschaftsteil (HAM-Nat [Possible reduction of the medical school dropout number by the Hamburg Assessment test for Medicine - part Natural sciences (HAM-Nat

Directory of Open Access Journals (Sweden)

Harendza, Sigrid

2008-05-01

Full Text Available [english] Aims: Since 2005 German medical faculties are allowed to select 60% of their freshmen. Nevertheless, many faculties stick to a selection based merely on the grade point average assigned by the secondary school (Abiturnote which is the best known predictor of success in German medical schools. Methods: In order to improve selection with respect to medical school dropout numbers we developed the HAM-Nat (Hamburg Admission test for Medicine - part Natural sciences, a test consisting of 52 multiple-choice questions from the topics of chemistry, physics, biology and mathematics, and assessed its difficulty with pupils of 6 different schools. Then the HAM-Nat was administered to 333 first-year students just before the start of their courses in October 2006. After the first academic year the power of the HAM-Nat to predict individual study success was compared to that of the grade point average. Study success was measured by the number of passed exams. Outcomes: The HAM-Nat was found to correlate better with study success than the grade point average. A projection based on data from older student cohorts shows that student selection with the HAM-Nat can reduce the number of students dropping out compared with a selection based on the grade point average alone. Other parameters like chosen natural science subjects at school or an industrial training in medicine or other areas do not predict academic success. Conclusions: The HAM-Nat is a valuable tool to predict student success at medical school. Based on this study Hamburg’s medical faculty has decided to introduce the HAM-Nat to select its entrants in 2008. [german] Zielsetzung: Seit das Hochschulrahmengesetz 2005 den Hochschulen ermöglicht, 60% der Medizinstudienanfänger selbst auszuwählen, sind die Medizinischen Fakultäten auf der Suche nach dem optimalen Auswahlverfahren. Viele tun sich schwer, ein Auswahlkriterium zu definieren. Noch schwieriger ist es, einen Test für die Auswahl

Effects of Processing Temperature on Color Properties of Dry-Cured Hams Made without Nitrite

Directory of Open Access Journals (Sweden)

Giovanni Parolari

2016-04-01

Full Text Available Dry cured hams were investigated for their ability to develop red color even at low temperature (3–4 °C and in the absence of added nitrites; results were compared with those obtained from nitrite-free hams made at conventional warm maturing temperatures. Colorimetric parameters (L*, a*, b*, and hue and concentration of the main pigments Zn protoporphyrin IX (ZnPP and heme were measured at three stages of preparation (six, nine, and 12 months, showing that red color was successfully formed at low temperatures, though at a slower rate and less intensively than under warm conditions. Major differences in the pattern of color development were found with the two processing temperatures. While the typical features of an enzyme-dependent mechanism, with a progressive drop in enzyme activity paralleling the synthesis of Zn protoporphyrin IX, were observed at warm temperatures, the same did not occur in cold-made hams, where the enzyme activity was almost unchanged throughout the process. These results, along with data from a descriptive sensory analysis, are supportive of a non-enzymatic mechanism leading to ZnPP (hence the red color under cold conditions, with an estimated three-month delay compared with nitrite-free hams manufactured in a warm maturing regimen.

Effects of Processing Temperature on Color Properties of Dry-Cured Hams Made without Nitrite.

Science.gov (United States)

Parolari, Giovanni; Aguzzoni, Agnese; Toscani, Tania

2016-04-29

Dry cured hams were investigated for their ability to develop red color even at low temperature (3-4 °C) and in the absence of added nitrites; results were compared with those obtained from nitrite-free hams made at conventional warm maturing temperatures. Colorimetric parameters (L*, a*, b*, and hue) and concentration of the main pigments Zn protoporphyrin IX (ZnPP) and heme were measured at three stages of preparation (six, nine, and 12 months), showing that red color was successfully formed at low temperatures, though at a slower rate and less intensively than under warm conditions. Major differences in the pattern of color development were found with the two processing temperatures. While the typical features of an enzyme-dependent mechanism, with a progressive drop in enzyme activity paralleling the synthesis of Zn protoporphyrin IX, were observed at warm temperatures, the same did not occur in cold-made hams, where the enzyme activity was almost unchanged throughout the process. These results, along with data from a descriptive sensory analysis, are supportive of a non-enzymatic mechanism leading to ZnPP (hence the red color) under cold conditions, with an estimated three-month delay compared with nitrite-free hams manufactured in a warm maturing regimen.

Effects of Processing Temperature on Color Properties of Dry-Cured Hams Made without Nitrite

Science.gov (United States)

Parolari, Giovanni; Aguzzoni, Agnese; Toscani, Tania

2016-01-01

Dry cured hams were investigated for their ability to develop red color even at low temperature (3–4 °C) and in the absence of added nitrites; results were compared with those obtained from nitrite-free hams made at conventional warm maturing temperatures. Colorimetric parameters (L*, a*, b*, and hue) and concentration of the main pigments Zn protoporphyrin IX (ZnPP) and heme were measured at three stages of preparation (six, nine, and 12 months), showing that red color was successfully formed at low temperatures, though at a slower rate and less intensively than under warm conditions. Major differences in the pattern of color development were found with the two processing temperatures. While the typical features of an enzyme-dependent mechanism, with a progressive drop in enzyme activity paralleling the synthesis of Zn protoporphyrin IX, were observed at warm temperatures, the same did not occur in cold-made hams, where the enzyme activity was almost unchanged throughout the process. These results, along with data from a descriptive sensory analysis, are supportive of a non-enzymatic mechanism leading to ZnPP (hence the red color) under cold conditions, with an estimated three-month delay compared with nitrite-free hams manufactured in a warm maturing regimen. PMID:28231128

Sampling methods to detect and estimate populations of Tyrophagus putrescentiae (Schrank) (Sarcoptiformes: Acaridae) infesting dry-cured hams

Science.gov (United States)

Spatial and temporal dynamics of pest populations is an important aspect of effective pest management. However, absolute sampling of some pest populations such as the ham mite, Tyrophagus putrescentiae (Schrank) (Sarcoptiformes: Acaridae), a serious pest of dry-cured ham, can be difficult. Sampling ...

Use of vacuum-steam-vacuum and ionizing radiation to eliminate Listeria innocua from ham.

Science.gov (United States)

Sommers, Christopher; Kozempel, Michael; Fan, Xuetong; Radewonuk, E Richard

2002-12-01

Listeria spp. are a frequent postprocess contaminant of ready-to-eat (RTE) meat products, including ham. Vacuum-steam-vacuum (VSV) technology has been used successfully to eliminate Listeria innocua from hot dogs. Ionizing radiation can eliminate Listeria spp. from RTE meats. However, the excessive application of either technology can cause changes in product quality, including structural changes, changes in cure color (redness), and lipid oxidation. In this study, two cycles of VSV were combined with 2.0 kGy of ionizing radiation to obtain 4.40- and 4.85-log10 reductions of L. innocua on ham meat and skin, respectively. The use of both treatments resulted in an additive, as opposed to synergistic, reduction of L. innocua on ham. The combination treatment did not cause statistically significant changes in product structure, color (redness), or lipid oxidation.

Nutritional Value and Potential Chemical Food Safety Hazards of Selected Traditional and Conventional Pork Hams from Poland

Directory of Open Access Journals (Sweden)

Michał Halagarda

2017-01-01

Full Text Available Consumers no longer look for food characterized only by health safety and proper nutritional value. As a result, an increased interest in traditional and regional food can be observed. The aim of this paper is to analyze the results of a comparative analysis of three types of hams: traditional products registered on the List of Traditional Products of the Polish Ministry of Agriculture and Rural Development, then products whose names, retail prices, appearance, and manufacturer’s description suggest traditional methods of production, and finally conventional hams. The results show that traditional hams are characterized by the highest nutritional value among the analyzed groups of products. They have the lowest water and a high protein content. In addition, traditional hams are distinguished by a low concentration of sodium chloride and no addition of phosphates. The residues of nitrites and nitrates indicate their moderate use in manufacturing processes.

Two Babinski signs in seropositive (HAM and seronegative tropical spastic paraparesis Dos signos de Babinski en pacientes con paraparesia espástica tropical seropositiva (HAM y seronegativa

Directory of Open Access Journals (Sweden)

Fidias E. Leon-Sarmiento

2008-01-01

Full Text Available Tropical spastic paraparesis (TSP may or may not be associated to HTLV-I antibodies and is usually characterized by clinical and pathological spinal cord abnormalities at thoracic levels. We present here five Brazilian patients who had typical chronic idiopatic spastic paraparesis; two of them were HTLV-I seropositive (HAM and three HTLV-I seronegative (TSP - associated-myelopathy. Three out of these five patients also displayed clinical supraspinal involvement, indeed, platysma muscle hypotrophy or atrophy (the Babinski plus sign. These findings support the view that clinical involvement in HAM and TSP is wider than the spinal cord abnormalities usually considered. Possible non-infectious co-factors (e.g., mycotoxins may be involved in disease pathogenesis in a multistep process of viruses, toxins and environment which may account for serological differences found in this group of patients.La paraparesia espástica tropical (PET, puede o no estar asociada con anticuerpos contra el HTLV-I y se caracteriza, usualmente, por alteraciones clínicas y patológicas a nivel de region dorso-lumbar de la medula espinal. Presentamos cinco pacientes brasileros, quienes tuvieron hallazgos típicos de paraparesia espástica crónica idiopática; dos de ellos tuvieron (HAM y tres no tuvieron (TSP anticuerpos, en el suero, contra el HTLV-I. En tres pacientes se encontró hipotrofia o atrofia del músculo platisma (signo de Babinski plus, demostrando que el compromiso clínico en pacientes con HAM y TSP se extiende más allá de la médula espinal torácica. Cofactores (por ejemplo, micotoxinas podrían estar involucrados en la patogénesis de esta enfermedad, en una interacción compleja de virus, toxinas y medio ambiente, lo cual explicaría las diferencias serológicas encontradas en este grupo de pacientes.

Standardisation of Western blotting to detect HTLV-1 antibodies synthesised in the central nervous system of HAM/TSP patients

Directory of Open Access Journals (Sweden)

Luiz Claudio Pereira Ribeiro

2013-09-01

Full Text Available Intrathecal synthesis of human T-lymphotropic virus type 1 (HTLV-1 antibodies (Abs represents conclusive evidence of a specific immune response in the central nervous system of HTLV-1 associated myelopathy/tropical spastic paraparesis (HAM/TSP patients. Western blotting (WB for HTLV Abs in serum is a confirmatory test for HTLV-1 infection. The aim of this study was to standardise the Western blot to demonstrate the intrathecal pattern of Abs against HTLV-1 proteins in HAM/TSP patients. Paired cerebrospinal fluid (CSF and serum samples were selected from 20 patients with definite HAM/TSP, 19 HTLV-1 seronegative patients and two HTLV-1 patients without definite HAM/TSP. The presence of reactive bands of greater intensity in the CSF compared to serum (or bands in only the CSF indicated the intrathecal synthesis of anti-HTLV-1 Abs. All definite HAM/TSP patients presented with an intrathecal synthesis of anti-HTLV-1 Abs; these Abs were not detected in the control patients. The most frequent intrathecal targets of anti-HTLV-1 Abs were GD21, rgp46-I and p24 and, to a lesser extent, p19, p26, p28, p32, p36, p53 gp21 and gp46. The intrathecal immune response against env (GD21 and rgp46-I and gag (p24 proteins represents the most important humoral pattern in HAM/TSP. This response may be used as a diagnostic marker, considering the frequent association of intrathecal anti-HTLV-1 Ab synthesis with HAM/TSP and the pathogenesis of this neurological disease.

Introduction of the HAM-Nat examination--applicants and students admitted to the Medical Faculty in 2012-2014.

Science.gov (United States)

Werwick, Katrin; Winkler-Stuck, Kirstin; Hampe, Wolfgang; Albrecht, Peggy; Robra, Bernt-Peter

2015-01-01

In the 2012/13 winter semester, the Magdeburg Medical Faculty introduced a test of knowledge for the selection of applicants. The Hamburg Assessment Test for Medicine - Natural Sciences (HAM-Nat) comprises a multiple-choice test with questions on the aspects of biology, physics, chemistry and mathematics relevant to medicine, which was specifically developed for the selection of medicine applicants. The aim is to study how the HAM-Nat influences student selection, the reasons why students decide to take the test as part of their application procedure and what expectations they have of their course of study. The selection procedures applied at the university in 2011 (without HAM-Nat) and in 2012-2014 (with HAM-Nat) are compared. On the basis of the results of exploratory interviews, university entrants in winter semester 2013/2014 participated in a written survey on why they chose their subject and place of study and their expectations of their course of study. No problems were encountered in introducing the extended selection procedure that included the HAM-Nat Test. The HAM-Nat had a great influence on the selection decision. About 65% of the students admitted would not have obtained a place if the decision had been based exclusively on their Abitur grade [grade obtained in the German school-leaving examination]. On average, male applicants obtained better HAM-Nat results than female ones. The questionnaire was answered by 147 out of 191 university entrants (77%). In the case of applicants from Saxony-Anhalt, the principle reasons for choosing the regional capital are its proximity, the social environment offered, good conditions for studying and the feel-good factor at the university. For the majority of applicants, however, particularly applicants from other federal states, the relatively good chances of admission in Magdeburg were the main reason. The Magdeburg Medical Faculty regards the HAM-Nat as a suitable tool for selecting applicants with outstanding

High pressure effect on the color of minced cured restructured ham at different levels of drying, pH, and NaCl.

Science.gov (United States)

Bak, Kathrine Holmgaard; Lindahl, Gunilla; Karlsson, Anders H; Lloret, Elsa; Ferrini, Gabriele; Arnau, Jacint; Orlien, Vibeke

2012-03-01

Color changes of minced cured restructured ham was studied considering the effects of high pressure (HP) treatment (600MPa, 13°C, 5min), raw meat pH(24) (low, normal, high), salt content (15, 30g/kg), and drying (20%, 50% weight loss). Raw hams were selected based on pH(24) in Semimembranosus, mixed with additives, frozen, sliced, and dried using the Quick-Dry-Slice® process. Meat color (CIE 1976 L*a*b*) and reflectance spectra were measured before and after HP treatment. HP significantly increased L*, decreased a*, and decreased b* for restructured ham dried to 20% weight loss, regardless of salt content and pH(24). L* and a* were best preserved in high pH/high salt restructured ham. HP had no effect on the color of restructured ham dried to 50% weight loss. HP had no effect on the shape of reflectance curves, indicating that the pigment responsible for minced cured restructured ham color did not change due to HP. Copyright © 2011 Elsevier Ltd. All rights reserved.

Método acelerado de processamento de presunto cru Accelerated method of dry-cured ham processing

Directory of Open Access Journals (Sweden)

Walter Bergamin Filho

2010-06-01

Full Text Available Nos métodos tradicionais de elaboração de presunto cru usa-se o pernil suíno inteiro, diferentemente da metodologia proposta neste trabalho, que combinou desossa, adição de transglutaminase, massageamento e moldagem das peças previamente à secagem e maturação, objetivando reduzir o tempo de processamento do produto. Avaliaram-se os efeitos de dois teores de NaCl adicionados (T1 - 3,5% e T2 - 5%, sobre características físico-químicas e microbiológicas dos presuntos crus ao longo do processo, além da avaliação sensorial dos produtos finais. Os presuntos crus obtidos atenderam aos padrões físico-químicos e microbiológicos determinados na legislação brasileira e não foram encontradas diferenças significativas (p The traditional methodologies of dry-cured ham production use the entire ham, differently from the one proposed in this study that combined boning, addition of transglutaminase, and tumbling and moulding before the drying and ageing stages. The effects of two levels of added NaCl (T1 - 3.5% and T2 - 5% on the physicochemical and microbiological characteristics of dry-cured hams during the process and the sensory analyses of the final products were evaluated. The dry-cured hams met the physicochemical and microbiological standards of the Brazilian legislation, and no significant differences (p < 0.05 were found between the two treatments in the parameters evaluated during the process and in the final products, except for the weight loss, which was higher in T1 (39.74 ± 4.02% than in T2 (37.22 ± 2.96%. The shape and thickness of the dry-cured hams prepared in this research were adequate to slicing, and they had excellent appearance, typical aroma, and flavor similar to traditional dry-cured hams usually found in the Brazilian market receiving about 80% of acceptance by consumers.

High pressure treatments on the inactivation of Salmonella Enteritidis and the physicochemical, rheological and color characteristics of sliced vacuum-packaged dry-cured ham.

Science.gov (United States)

de Alba, María; Montiel, Raquel; Bravo, Daniel; Gaya, Pilar; Medina, Margarita

2012-06-01

The effect of high pressure (HP) on Salmonella Enteritidis in sliced dry-cured ham stored under temperature abuse (8°C) during 60d was investigated. After treatment, reductions of S. Enteritidis were 1.06, 2.54 and 4.32 log units in ham treated at 400, 500 and 600MPa for 5min at 12°C, compared to non-pressurized samples. After 60d, counts of S. Enteritidis in ham treated at 400 and 500MPa were 2.56 and 2.66 log units lower than in non-treated ham, whereas the pathogen was only detected after enrichment in ham treated at 600MPa. Lipid oxidation increased with storage and pressurization, whereas total free amino acid contents were similar in HP and control samples after 60d. Dry-cured ham treated at the highest pressures exhibited lower shear resistance, whereas the maximum force to compress the sample was slightly changed. Color (L*, a* and b*) varied with pressurization and storage. Changes induced by HP in dry-cured ham were attenuated during storage. Copyright © 2012 Elsevier Ltd. All rights reserved.

Fewer study participants needed to demonstrate superior antidepressant efficacy when using the Hamilton melancholia subscale (HAM-D₆) as outcome measure

DEFF Research Database (Denmark)

Østergaard, Søren Dinesen; Bech, Per; Miskowiak, Kamilla Woznica

2016-01-01

participants per group would be required to detect a statistically significant difference between EPO and placebo when using the HAM-D6 as outcome measure, whereas the required group size for HAM-D17 would be 146 participants. Limitations The EPO RCT was not originally designed to investigate the research...... placebo-controlled trial (RCT) testing the effect of erythropoietin (EPO) as augmentation therapy in patients with treatment-resistant depression.  Methods We assessed the scalability (Mokken analysis of unidimensionality), responsiveness (item responsiveness analysis) and ability to show drug......-placebo separation (estimation of sample size needed to detect statistically significant difference between EPO and placebo) of the HAM-D6 and the HAM-D17.  Results The HAM-D6 demonstrated higher scalability, higher responsiveness, and better drug-placebo separation compared to the HAM-D17. As a consequence, only 39...

On the Feng-Rao bound for generalized hamming weights

DEFF Research Database (Denmark)

Geil, Hans Olav; Thommesen, Christian

2006-01-01

The Feng-Rao bound gives good estimates of the minimum distance of a large class of codes. In this work we are concerned with the problem of how to extend the Feng-Rao bound so that it deals with all the generalized Hamming weights. The problem was solved by Heijnen and Pellikaan in [7] for a large...... family of codes that includes the duals of one-point geometric Goppa codes and the q-ary Reed-Muller codes, but not the Feng-Rao improved such ones. We show that Heijnen and Pellikaan's results holds for the more general class of codes for which the traditional Feng-Rao bound can be applied. We also...... establish the connection to the Shibuya-Sakaniwa bound for generalized Hamming weights ([15], [16], [17], [18], [19] and [20]). More precisely we show that the Shibuya-Sakaniwa bound is a consequence of the extended Feng-Rao bound. In particular the extended Feng-Rao bound gives always at least as good...

On the Feng-Rao bound for generalized Hamming weights

DEFF Research Database (Denmark)

Geil, Olav; Thommesen, Christian

2005-01-01

The Feng-Rao bound gives good estimates of the minimum distance of a large class of codes. In this work we are concerned with the problem of how to extend the Feng-Rao bound so that it deals with all the generalized Hamming weights. The problem was solved by Heijnen and Pellikaan in [7] for a large...... family of codes that includes the duals of one-point geometric Goppa codes and the q-ary Reed-Muller codes, but not the Feng-Rao improved such ones. We show that Heijnen and Pellikaan’s results holds for the more general class of codes for which the traditional Feng-Rao bound can be applied. We also...... establish the connection to the Shibuya-Sakaniwa bound for generalized Hamming weights ([15], [16], [17], [18], [19] and [20]). More precisely we show that the Shibuya-Sakaniwa bound is a consequence of the extended Feng-Rao bound. In particular the extended Feng-Rao bound gives always at least as good...

Imaging spinal cord atrophy in progressive myelopathies: HTLV-I-associated neurological disease (HAM/TSP) and multiple sclerosis (MS).

Science.gov (United States)

Azodi, Shila; Nair, Govind; Enose-Akahata, Yoshimi; Charlip, Emily; Vellucci, Ashley; Cortese, Irene; Dwyer, Jenifer; Billioux, B Jeanne; Thomas, Chevaz; Ohayon, Joan; Reich, Daniel S; Jacobson, Steven

2017-11-01

Previous work measures spinal cord thinning in chronic progressive myelopathies, including human T-lymphotropic virus 1 (HTLV-1)-associated myelopathy/tropical spastic paraparesis (HAM/TSP) and multiple sclerosis (MS). Quantitative measurements of spinal cord atrophy are important in fully characterizing these and other spinal cord diseases. We aimed to investigate patterns of spinal cord atrophy and correlations with clinical markers. Spinal cord cross-sectional area was measured in individuals (24 healthy controls [HCs], 17 asymptomatic carriers of HTLV-1 (AC), 47 HAM/TSP, 74 relapsing-remitting MS [RRMS], 17 secondary progressive MS [SPMS], and 40 primary progressive MS [PPMS]) from C1 to T10. Clinical disability scores, viral markers, and immunological parameters were obtained for patients and correlated with representative spinal cord cross-sectional area regions at the C2 to C3, C4 to C5, and T4 to T9 levels. In 2 HAM/TSP patients, spinal cord cross-sectional area was measured over 3 years. All spinal cord regions are thinner in HAM/TSP (56 mm 2 [standard deviation, 10], 59 [10], 23 [5]) than in HC (76 [7], 83 [8], 38 [4]) and AC (71 [7], 78 [9], 36 [7]). SPMS (62 [9], 66 [9], 32 [6]) and PPMS (65 [11], 68 [10], 35 [7]) have thinner cervical cords than HC and RRMS (73 [9], 77 [10], 37 [6]). Clinical disability scores (Expanded Disability Status Scale [p = 0.009] and Instituto de Pesquisas de Cananeia [p = 0.03]) and CD8 + T-cell frequency (p = 0.04) correlate with T4 to T9 spinal cord cross-sectional area in HAM/TSP. Higher cerebrospinal fluid HTLV-1 proviral load (p = 0.01) was associated with thinner spinal cord cross-sectional area. Both HAM/TSP patients followed longitudinally showed thoracic thinning followed by cervical thinning. Group average spinal cord cross-sectional area in HAM/TSP and progressive MS show spinal cord atrophy. We further hypothesize in HAM/TSP that is possible that neuroglial loss from a thoracic inflammatory

Simultaneous analysis of consumer variables, acceptability and sensory characteristics of dry-cured ham.

Science.gov (United States)

Sugimoto, Masahiro; Obiya, Shinichi; Kaneko, Miku; Enomoto, Ayame; Honma, Mayu; Wakayama, Masataka; Tomita, Masaru

2016-11-01

We conducted a consumer acceptability analysis of dry-cured ham based on sensory evaluation. Consumer acceptability data are rendered heterogeneous by the diverse backgrounds and assessment abilities of the participants, requiring versatile analytical methods for their interpretation. Totally, 9 sensory attributes of 12 kinds of dry-cured ham samples collected from Japan (n=9), Italy (n=1), Spain (n=1), and Germany (n=1) were tasted by 117 Japanese consumers who showed acceptable evaluation abilities during blind sampling. Common techniques, such as hierarchical clustering, principal component analysis, and external preference mapping, were simultaneously utilized to analyze each characteristics scored in modified hedonic scale. These analyses revealed the relationships between the features and preferences of the assessors. For example, consumers aged 20-30 with smoking and drinking habits preferred sweetness and saltiness, and gave high ratings to Spanish Jómon serrano and Italian prosciutto. Our approach could assist ham marketers to identify potential purchasers and the preferred characteristics of their products. Copyright © 2016 Elsevier Ltd. All rights reserved.

Hamming generalized corrector for reactivity calculation

International Nuclear Information System (INIS)

Suescun-Diaz, Daniel; Ibarguen-Gonzalez, Maria C.; Figueroa-Jimenez, Jorge H.

2014-01-01

This work presents the Hamming method generalized corrector for numerically resolving the differential equation of delayed neutron precursor concentration from the point kinetics equations for reactivity calculation, without using the nuclear power history or the Laplace transform. A study was carried out of several correctors with their respective modifiers with different time step calculations, to offer stability and greater precision. Better results are obtained for some correctors than with other existing methods. Reactivity can be calculated with precision of the order h 5 , where h is the time step. (orig.)

Texture and Quality Parameters of Slovenian Dry-Cured Ham Kraški pršut According to Mass and Salt Levels

Directory of Open Access Journals (Sweden)

Darko Andronikov

2013-01-01

Full Text Available The aim of the present study is to investigate the effects of fresh ham mass and the amount of salt added during processing on the technological, sensorial and physicochemical qualities of Slovenian dry-cured ham (Kraški pršut produced under Protected Geographical Indication. A total of 84 fresh ham samples (pH=5.6–5.9 measured 24 h post mortem originating from pigs (Landrace × Large white were divided into subgroups according to mass (light, 9.5–10.5 kg vs. heavy, 11.5–13.0 kg and salt addition during production (normal vs. low salt. These formed four subgroups for the analyses: light and normally salted, light and low salt, heavy and normally salted, and heavy and low salt. After the salting period, the NaCl concentration in the normally salted muscles was 3.8 to 4.0 %, and in the less salted muscles 2.8 to 3.0 %. During the processing of the dry-cured ham (at the beginning, after salting, and after resting, the semimembranosus (SM and biceps femoris (BF muscles were analysed for water activity (aw, pH, salt content, moisture, total minerals, non-protein nitrogen, and total nitrogen. One year after the processing, the instrumental (stress relaxation and texture profile and sensory qualities were also analysed. After the salting and resting periods, the pH of the samples was significantly decreased in comparison with the fresh ham, although after ageing period this increased again, to reach nearly the initial values (pH=5.59–5.74. At the same time, the aw of both muscles in all experimental groups dropped below 0.90. The total mass losses varied between the groups (34.75–36.63 %, with the samples of heavy and low salt ham showing the greatest mass loss. The light and low salt SM muscles showed slightly higher proteolysis indices (non-protein nitrogen/total nitrogen ratio after one year, which indicated a trend towards more rapid proteolysis as compared to the normally salted hams. Generally, the softer texture of the BF muscle

SUSTAINABILITY OF BIODIVERSITY BY VALORIZATION OF SARDA BREED GOAT DRY HAMS

Directory of Open Access Journals (Sweden)

R. Melillo

2011-01-01

Full Text Available Goat farming is a very important resource, expecially in marginal and unlikely exploitable Mediterranean areas. They are extensively reared, mainly for milk production and for suckling kids meat. The meat from adult goats instead is not profitable, because of its very low commercial value. The transformation of the Sarda goat (native breed meat in ripened products (ham would contribute to safeguard the Sardinian goat supply chain. In the present study, in order to characterize the Sarda breed goat dry ham, five batches (L1–L5, processed in a traditional plant, were analyzed. The chemical-physical characteristics were determined in the following stages: fresh ham (MP, after salting (S, after drying (E and at the end of ripening (P. The microbiological parameters were determined in MP and in P. The dynamics of pH during processing were similar to those of cured meat products (in P: 6.58±0.26. The aw value decreased during the processing up to 0.79±0.03. Regarding the microbiological parameters, in P the coagulase negative Staphylococci were the prevalent flora (4.38±1.08 Log10 cfu/g, followed by the Lactic acid bacteria (2.46±1.00. The Moulds and Yeasts were not constant and the presence of pathogens was not highlighted.

Effect of Oyster Shell Calcium Powder on the Quality of Restructured Pork Ham

OpenAIRE

Choi, Jung-Seok; Lee, Hyun-Jin; Jin, Sang-Keun; Lee, Hyun-Joo; Choi, Yang-Il

2014-01-01

This study was conducted to evaluate the effects of oyster shell calcium powder (OSCP) as a substitute for phosphates in curing agent, on the quality of restructured pork ham. Restructured pork ham was processed under six treatment conditions: T1 (no additives), T2 (0.3% sodium tripolyphosphate), T3 (1.5% NaCl+0.5% whey protein), T4 (1.5% NaCl+0.5% whey protein+0.15% OSCP), T5 (1.5% NaCl+0.5% whey protein+0.3% OSCP), and T6 (1.5% NaCl+0.5% whey protein+0.5% OSCP). Addition of OSCP significant...

Influence of physicochemical characteristics and high pressure processing on the volatile fraction of Iberian dry-cured ham.

Science.gov (United States)

Martínez-Onandi, Nerea; Rivas-Cañedo, Ana; Ávila, Marta; Garde, Sonia; Nuñez, Manuel; Picon, Antonia

2017-09-01

The volatile fraction of 30 Iberian dry-cured hams of different physicochemical characteristics and the effect of high pressure processing (HPP) at 600MPa on volatile compounds were investigated. According to the analysis of variance carried out on the levels of 122 volatile compounds, intramuscular fat content influenced the levels of 8 benzene compounds, 5 carboxylic acids, 2 ketones, 2 furanones, 1 alcohol, 1 aldehyde and 1 sulfur compound, salt concentration influenced the levels of 1 aldehyde and 1 ketone, salt-in-lean ratio had no effect on volatile compounds, and water activity influenced the levels of 3 sulfur compounds, 1 alcohol and 1 aldehyde. HPP-treated samples of Iberian ham had higher levels of 4 compounds and lower levels of 31 compounds than untreated samples. A higher influence of HPP treatment on volatile compounds than physicochemical characteristics was observed for Iberian ham. Therefore, HPP treatment conditions should be optimized in order to diminish its possible effect on Iberian ham odor and aroma characteristics. Copyright © 2017 Elsevier Ltd. All rights reserved.

Aspergillus westerdijkiae as a major ochratoxin A risk in dry-cured ham based-media.

Science.gov (United States)

Vipotnik, Ziva; Rodríguez, Alicia; Rodrigues, Paula

2017-01-16

Penicillium nordicum is well known for its ability to produce high amounts of ochratoxin A (OTA) in cured meat-derived products. On the other hand, Aspergillus westerdijkiae, one of the most relevant OTA-producing species of the genus Aspergillus, is usually considered a major risk in carbon-rich food matrices of plant origin. The objective of this work was to evaluate, for the first time, the ecophysiological conditions governing growth, OTA production and sporulation of A. westerdijkiae (the type-strain and one ham-native strain), in comparison with P. nordicum, in dry-cured ham based medium. For that purpose, the interaction between temperature (15, 20, 25 and 30°C) and water activity (a w ) (0.99, 0.97, 0.93, 0.90 and 0.85), achieved with a combination of ionic (NaCl) and non-ionic (glycerol) solutes, was studied by using dry-cured ham-based medium as a model system. Different OTA production profiles were found between the two genera, and also between the two strains of A. westerdijkiae, mostly in terms of amounts of OTA produced. The optimal OTA production conditions for A. westerdijkiae were at 0.94-0.97 a w and 20-25°C, and for P. nordicum at 0.95-0.97 a w between 18 and 22°C. Under these conditions, A. westerdijkiae produced 1934ng/g agar, while P. nordicum produced 712ng/g. None of the strains was able to produce detectable amounts of OTA at 0.85 a w , under all temperatures tested. Growth and sporulation were not good indicators of OTA production by A. westerdijkiae or P. nordicum. The results obtained show that A. westerdijkiae may represent a great potential risk of OTA contamination in dry-cured ham due to the high production under a wide range of conditions. Knowledge of the ecophysiology of important Aspergillus and Penicillium species and of their adaptability to the matrices can be determinant to adopt appropriate technological modifications during ham ripening process. Copyright © 2016 Elsevier B.V. All rights reserved.

Evolution of nitrate and nitrite during the processing of dry-cured ham with partial replacement of NaCl by other chloride salts.

Science.gov (United States)

Armenteros, Mónica; Aristoy, María-Concepción; Toldrá, Fidel

2012-07-01

Nitrate and nitrite are commonly added to dry-cured ham to provide protection against pathogen microorganisms, especially Clostridium botulinum. Both nitrate and nitrite were monitored with ion chromatography in dry-cured hams salted with different NaCl formulations (NaCl partially replaced by KCl and/or CaCl(2), and MgCl(2)). Nitrate, that is more stable than nitrite, diffuses into the ham and acts as a reservoir for nitrite generation. A correct nitrate and nitrite penetration was detected from the surface to the inner zones of the hams throughout its processing, independently of the salt formulation. Nitrate and nitrite achieved similar concentrations, around 37 and 2.2 ppm, respectively in the inner zones of the ham for the three assayed salt formulations at the end of the process, which are in compliance with European regulations. Copyright © 2012 Elsevier Ltd. All rights reserved.

Comparison of HTLV-I Proviral Load in Adult T Cell Leukemia/Lymphoma (ATL), HTLV-I-Associated Myelopathy (HAM-TSP) and Healthy Carriers.

Science.gov (United States)

Akbarin, Mohammad Mehdi; Rahimi, Hossein; Hassannia, Tahereh; Shoja Razavi, Ghazaleh; Sabet, Faezeh; Shirdel, Abbas

2013-03-01

Human T Lymphocyte Virus Type one (HTLV-I) is a retrovirus that infects about 10-20 million people worldwide. Khorasan province in Iran is an endemic area. The majority of HTLV-I-infected individuals sustain healthy carriers but small proportion of infected population developed two progressive diseases: HAM/TSP and ATL. The proviral load could be a virological marker for disease monitoring, therefore in the present study HTLV-I proviral load has been evaluated in ATL and compared to HAM/TSP and healthy carriers. In this case series study, 47 HTLV-I infected individuals including 13 ATL, 23 HAM/TSP and 11 asymptomatic subjects were studied. Peripheral blood mononuclear cells (PBMCs) were investigated for presence of HTLV-I DNA provirus by PCR using LTR and Tax fragments. Then in infected subjects, HTLV-I proviral load was measured using real time PCR TaqMan method. The average age of patients in ATL was 52±8, in HAM/TSP 45.52±15.17 and in carrier's 38.65±14.9 years which differences were not statistically significant. The analysis of data showed a significant difference in mean WBC among study groups (ATL vs HAM/TSP and carriers P=0.0001). Moreover, mean HTLV-I proviral load was 11967.2 ± 5078, 409 ± 71.3 and 373.6 ± 143.3 in ATL, HAM/TSP and Healthy Carriers, respectively. The highest HTLV-I proviral load was measured in ATL group that had a significant correlation with WBC count (R=0.495, P=0.001). The proviral load variations between study groups was strongly significant (ATL vs carrier P=0.0001; ATL vs HAM/TSP P= 0.0001 and HAM/TSP vs carriers P< 0.05). Conclusion : The present study demonstrated that HTLV-I proviral load was higher in ATL group in comparison with HAM/TSP and healthy carriers. Therefore, HTLV-I proviral load is a prognostic factor for development of HTLV-I associated diseases and can be used as a monitoring marker for the efficiency of therapeutic regime.

The influence of electron beam radiation in the nutritional value, chemical composition and bioactivities of edible flowers of Bauhinia variegata L. var. candida alba Buch.-Ham from Brazil.

Science.gov (United States)

Villavicencio, Anna L C H; Heleno, Sandrina A; Calhelha, Ricardo C; Santos-Buelga, Celestino; Barros, Lillian; Ferreira, Isabel C F R

2018-02-15

As edible flowers are highly perishable, irradiation technology can be applied to increase their shelf life, as also for phytosanitary purposes. Herein, flowers of Bauhinia variegata L. var. candida alba Buch.-Ham were submitted to electron beam irradiation at the doses of 0.5, 0.8 and 1kGy, to study the effects in the nutritional and chemical profiles, and also in antioxidant, cytotoxic and anti-inflammatory activities. The petals of white flowers revealed interesting bioactive properties being kaempferol derivatives the most abundant compounds, especially kaempferol-3-O-rutinoside. The applied irradiation doses did not highly affect the nutritional profile. No changes were produced in cytotoxicity, but the anti-inflammatory activity slightly decreased. However, the antioxidant activity was increased, especially in the dose of 0.5kGy, in agreement with the higher content in phenolic compounds found at this dose. Copyright © 2017 Elsevier Ltd. All rights reserved.

Novel Differential Measurement of Natural and Added Phosphorus in Preserved versus Non-Enhanced Ham

Science.gov (United States)

Cupisti, Adamasco; Benini, Omar; Ferretti, Valerio; Gianfaldoni, Daniela; Kalantar-Zadeh, Kamyar

2018-01-01

Accurate assessment of the quantity and chemical type of phosphorus (P) content in processed meat products may have major clinical implications for management of kidney disease patients. We examined 40 lots of cooked ham including 20 without and 20 with P-containing preservatives. Novel spectro-photometrical methods were employed to measure total P and 3 different P subtypes, i.e., water-soluble (inorganic) P including added preservatives and natural P derived from phospholipids and phosphoproteins separately. Total Nitrogen and fat contents were assayed, as well. There was 66% more inorganic P in preserved vs. non-enhanced ham, i.e., 169±36 vs. 102±16 mg/100g (p0.05), indicating a small portion of unspecified P and/or undermeasurement Novel differential dietary P measurement detects added P-containing preservatives. Processed cooked ham has 66% more measurable inorganic P and 64% higher P-to-protein ratio than non-enhanced product. The contribution of processed food to global dietary phosphorus burden can negatively influence CKD outcome and counteract the efficacy of P-binder medications. PMID:22406120

Metabolomic Profiling as a Possible Reverse Engineering Tool for Estimating Processing Conditions of Dry-Cured Hams.

Science.gov (United States)

Sugimoto, Masahiro; Obiya, Shinichi; Kaneko, Miku; Enomoto, Ayame; Honma, Mayu; Wakayama, Masataka; Soga, Tomoyoshi; Tomita, Masaru

2017-01-18

Dry-cured hams are popular among consumers. To increase the attractiveness of the product, objective analytical methods and algorithms to evaluate the relationship between observable properties and consumer acceptability are required. In this study, metabolomics, which is used for quantitative profiling of hundreds of small molecules, was applied to 12 kinds of dry-cured hams from Japan and Europe. In total, 203 charged metabolites, including amino acids, organic acids, nucleotides, and peptides, were successfully identified and quantified. Metabolite profiles were compared for the samples with different countries of origin and processing methods (e.g., smoking or use of a starter culture). Principal component analysis of the metabolite profiles with sensory properties revealed significant correlations for redness, homogeneity, and fat whiteness. This approach could be used to design new ham products by objective evaluation of various features.

Muscle individual phospholipid classes throughout the processing of dry-cured ham: influence of pre-cure freezing.

Science.gov (United States)

Pérez-Palacios, Trinidad; Ruiz, Jorge; Dewettinck, Koen; Le, Thien Trung; Antequera, Teresa

2010-03-01

This paper aims to study the profile of phospholipid (PL) classes of Iberian ham throughout its processing and the changes it underwent due to the influence of the pre-cure freezing treatment. The general profile of each PL class did not vary during the ripening stage. Phosphatidylcholine (PC) showed the highest proportion, followed by phosphatidyletanolamine (PE) and phosphatidylserine (PS) and phosphatidylinositol (PI) being the minor PL. The four PL classes were highly hydrolysed during the salting stage and their degradation continued during the rest of the processing. Pre-cure freezing of Iberian ham influenced the levels of the four PL classes at the initial stage, all of them being higher in refrigerated (R) than in pre-cure frozen (F) hams. Moreover, the pattern of hydrolysis was not the same in these two groups. Copyright 2009 Elsevier Ltd. All rights reserved.

A polymorphism in the stearoyl-CoA desaturase gene promoter influences monounsaturated fatty acid content of Duroc × Iberian hams

Energy Technology Data Exchange (ETDEWEB)

Henriquez-Rodriguez, E.; Tor, M.; Pena, R.N.; Estany, J.

2015-07-01

Data on 74 dry-cured hams from Duroc × Iberian pigs were used to examine whether the tag polymorphism AY487830:g.2228T>C in the promoter region of the stearoyl-CoA desaturase [SCD] gene affect fat desaturation and monounsaturated fatty acid (MUFA) as previously described in purebred Duroc hams. Samples were taken from sliced trays of dry-cured hams marketed as Jamón Ibérico de cebo, which were randomly purchased from the same supplier in different stores of the same supermarket chain. Genomic DNA was isolated from each sample to genotype for SCD and gender. Also, a sample of two slices was used to determine fat content and fatty acid (FA) composition by gas chromatography. The effect of the genotype (TT and CT) and gender (barrows and gilts) was estimated under a Bayesian setting. Results showed that the SCD polymorphism was associated to fat composition but not to fat content, with TT hams showing increased C18:1n-7, C18:1n-9, C20:1n-9 and MUFA (probability between 0.92-0.98) and decreased C18:2n-6, C20:4n-6 and polyunsaturated FA (PUFA) (probability between 0.91-0.99) as compared to the CT. As a result, the TT hams had more MUFA (0.95%) and a higher MUFA/PUFA ratio (0.43) than the CT. Barrows had more saturated FA (SFA) and less PUFA than gilts. No differences in MUFA content were found between genders. The SCD polymorphism had a greater impact on MUFA than using hams from barrows instead of gilts. It is concluded that the SCD polymorphism is a good tool to increase MUFA and MUFA/PUFA ratio in Duroc crossbred dry-cured hams. (Author)

Bovine Blood Constituents as Fat Replacers in Ham Pâté

Directory of Open Access Journals (Sweden)

Fabiana Ribeiro Viana

2004-01-01

Full Text Available Some tests were carried out in this work with the aim of evaluating a partial replacement of fat in the raw batter of ham pâté by using bovine blood constituents, such as globin (GL, plasma (PL or 1:1 globin and plasma (GP. Plasma was separated from red cells by blood centrifugation, and globin was extracted by the carboxymethylcellulose method. The salt-soluble protein content (SSP and the binding properties including water holding capacity (WHC and raw batter stability (RBS were estimated. The results indicated that among the 3 treatments studied, the use of globin showed to be a little more advantageous for the quality of the raw batter of ham pâté, since its incorporation as fat replacer led to an increase in RBS but no change of SSP was observed.

Hamming distance and mobility behavior in generalized rock-paper-scissors models

Science.gov (United States)

Bazeia, D.; Menezes, J.; de Oliveira, B. F.; Ramos, J. G. G. S.

2017-09-01

This work reports on two related investigations of stochastic simulations which are widely used to study biodiversity and other related issues. We first deal with the behavior of the Hamming distance under the increase of the number of species and the size of the lattice, and then investigate how the mobility of the species contributes to jeopardize biodiversity. The investigations are based on the standard rules of reproduction, mobility and predation or competition, which are described by specific rules, guided by generalization of the rock-paper-scissors game, valid in the case of three species. The results on the Hamming distance indicate that it engenders universal behavior, independently of the number of species and the size of the square lattice. The results on the mobility confirm the prediction that it may destroy diversity, if it is increased to higher and higher values.

Perspektif Hukum dan HAM terhadap Eksistensi Aliran Keagamaan di Indonesia

Directory of Open Access Journals (Sweden)

Rohidin -

2013-04-01

Full Text Available Penelitian bertujuan untuk menganalisis eksistensi aliran keagamaan di Indonesia yang difatwa sesat oleh MUI, ditinjau dari perspektif Hukum dan HAM. Penelitian ini menggunakan dua jenis data yakni primer dan sekunder. Data primer dikumpulkan melaui wawancara dengan sejumlah informan dari MUI, Ahmadiyah, dan Ahli-ahli agama Islam. Hasil penelitian ini menunjukkan bahwa aliran-aliran keagamaan yang difatwa sesat oleh MUI tersebut, dalam perspektif MUI tidak dianggap sebagai kelompok agama yang resmi diakui oleh negara maupun menurut ajaran agama Islam yang sudah establish. Hal ini didasarkan pada ketentuan al-Qur’an dan Hadist, serta ketentuan hukum positif Indonesia. Kontroversi terhadap fatwa MUI ini dipicu oleh beberapa faktor. Pertama, adanya perbedaan antara pandangan MUI dengan para aktivis HAM dalam memaknai kebebasan beragama. MUI mendasarkan pandangannya pada norma-norma agama dan hukum positif, sementara para aktivis HAM mendasarkan pada norma-norma HAM Universal. This research attempt to analyze the existence of the religious sectes in Indonesia from perspective of the international human rights law. This research use the primary and secondary data. The primary data was collected through interview with the some informant such as MUI, Ahmadiyah, and Human rights activist. The result of this research show, that the existence of the religious sectes in Indonesian law system are normatively not be considered as a religious group. They are perceived by MUI as the religious deviate. In the normative paradigm MUI use it argument through some Al-Qur’an verses and also hadist in determining weather one religion group learned saying deviate or not. And the MUI positive paradigm is using its argument through some criminal law articel in determining one religion group deviate or not. Some factors which is made the fatwa  controversion are there two causes. First, because of different perspective between MUI with democracy and human rights

Classification of pre-sliced pork and Turkey ham qualities based on image colour and textural features and their relationships with consumer responses.

Science.gov (United States)

Iqbal, Abdullah; Valous, Nektarios A; Mendoza, Fernando; Sun, Da-Wen; Allen, Paul

2010-03-01

Images of three qualities of pre-sliced pork and Turkey hams were evaluated for colour and textural features to characterize and classify them, and to model the ham appearance grading and preference responses of a group of consumers. A total of 26 colour features and 40 textural features were extracted for analysis. Using Mahalanobis distance and feature inter-correlation analyses, two best colour [mean of S (saturation in HSV colour space), std. deviation of b*, which indicates blue to yellow in L*a*b* colour space] and three textural features [entropy of b*, contrast of H (hue of HSV colour space), entropy of R (red of RGB colour space)] for pork, and three colour (mean of R, mean of H, std. deviation of a*, which indicates green to red in L*a*b* colour space) and two textural features [contrast of B, contrast of L* (luminance or lightness in L*a*b* colour space)] for Turkey hams were selected as features with the highest discriminant power. High classification performances were reached for both types of hams (>99.5% for pork and >90.5% for Turkey) using the best selected features or combinations of them. In spite of the poor/fair agreement among ham consumers as determined by Kappa analysis (Kappa-valuetexture appearance and acceptability), a dichotomous logistic regression model using the best image features was able to explain the variability of consumers' responses for all sensorial attributes with accuracies higher than 74.1% for pork hams and 83.3% for Turkey hams. Copyright 2009 Elsevier Ltd. All rights reserved.

The effect of sex, carcass mass, back fat thickness and lean meat content on pork ham and loin characteristics

Directory of Open Access Journals (Sweden)

D. Knecht

2016-01-01

P  ≤ 0.01. Half-carcass mass showed a strong negative correlation with bone content in ham and loin (r = −0.35 and r = −0.21, respectively. Back fat thickness and meat content strongly and inversely correlated with the content of ham and loin in half-carcasses (r = −0.41 and r = 0.59 for back fat thickness; r = 0.66 and r = −0.57 for lean meat content. Close and inverse correlations of back fat thickness and lean meat content were observed with regard to their content in ham and loin (P  ≤ 0.01.

Potential Biomarker of Myofibrillar Protein Oxidation in Raw and Cooked Ham: 3-Nitrotyrosine Formed by Nitrosation.

Science.gov (United States)

Feng, Xianchao; Li, Chenyi; Ullah, Niamat; Hackman, Robert M; Chen, Lin; Zhou, Guanghong

2015-12-30

The stability of cured meat products is increased by the protection of its proteins from oxidation by sodium nitrite (NaNO2) during processing. This study investigated the effects of NaNO2 (0, 50, 100, 200, and 400 mg/kg) on the physiochemical and structural characteristics of myofibrillar protein (MP) in raw and cooked ham. The NaNO2 showed a dose-dependent antioxidant effect, by inhibiting carbonyl formation, dityrosine formation, and denaturation of MP, and a nitrosative effect, through the formation of 3-Nitrotyrosine (3-NT). The 3-NT content within MP of raw ham had distinct negative correlations with sulfhydryl content and surface hydrophobicity. The 3-NT content within MP of cooked ham had significantly negative correlations with carbonyl, sulfhydryl content and turbidity and had significantly positive correlations with disulfide content. These results indicated that 3-NT may be a potential marker for protein oxidation in raw and cooked cured meat products.

Effects of antioxidant and package materials on the quality of irradiated rugao ham

International Nuclear Information System (INIS)

Cao Hong; Chen Xiulan; Bao Jianzhong; Han Yan; Jiang Yunsheng; Wang Zhijun; Dong Jie; Yang Hairong; Xi Jun

2008-01-01

Irradiation could extend the shelf life of ham, but irradiation also facilitates the oxidation of fat. Different packaging materials and combination of antioxidants were used to deal with Rugao ham in order to lower the level of antioxidation caused by irradiation treatment. The peroxide value of fat was detected as the reference index. The results were indicated that the fat peroxide value of all samples increased within the storage of 100d, and then decreased. Aluminum film compound packaging showed a better effect than polyethylene plastic bag. The antioxideant combination of 0.5% tea-polyphenol, 0.5% Vc, 0.5% citric acid, 5% sodium alginate, applied on 4 kGy irradiated samples was measured the lowest peroxide value of fat among all the treatments. (authors)

HAM-Tools – a whole building simulation tool in Annex 41

DEFF Research Database (Denmark)

Kalagasidis, Angela Sasic; Rode, Carsten; Woloszyn, Monika

2008-01-01

HAM-Tools is a building simulation software. The main task of this tool is to simulate transfer processes related to building physics, i.e. heat, air and moisture transport in buildings and building components in operating conditions. The scope of the ECBCS Annex 41 “Whole Building Heat, Air...

Development of Graves' ophthalmopathy and uveitis after radioiodine therapy for Graves' disease in a patient with HTLA-I associated myelopathy (HAM)

International Nuclear Information System (INIS)

Ozawa, Yasunori; Migita, Masayoshi; Watanabe, Tomoji; Okuda, Itsuko; Takeshita, Akira; Takagi, Akio; Shishiba, Yoshimasa

1994-01-01

HTLV-I carriers or patients with HTLV-I associated myelopathy (HAM) are prone to immune-mediated inflammatory disorders. We present a 44-year-old female with HAM who developed Graves' disease. She developed severe Graves' ophthalmopathy shortly after 131 I therapy, concurrently with a remarkable increase in TSH-receptor antibody titer. Ophthalmopathy was aggravated in spite of prednisolone therapy and euthyroidism being maintained by thyroxine replacement. Uveitis also developed after 131 I therapy and iridocyclitis finally required trabeculotomy. This case suggests that HAM patients may have a higher risk of immune-mediated Graves' ophthalmopathy after 131 I therapy.(author)

Accumulation and evolution of tocopherols in dry-cured hams from Iberian pigs as affected by their feeding and rearing system

DEFF Research Database (Denmark)

Rey, A I; Lopez-Bote, C J; Daza, A

2010-01-01

The influence of feeding and rearing systems on the accumulation and evolution of α- and γ-tocopherols in relation to storage time in dry-cured ham slices and pieces was investigated. The accumulation of γ-tocopherol in Musculus Biceps femoris or fat of cured hams was lower in groups fed acorns i...

Characterization of commercial cooked hams according to physicochemical, sensory, and textural parameters using chemometrics

Directory of Open Access Journals (Sweden)

Francine Gomes Basso Los

2014-09-01

Full Text Available Cooked ham is considered a high-value product due to the quality of its raw material. Although its consumption is still low in Brazil, it is increasing due to the rising purchasing power of sectors of the population. This study aimed to assess the microbiological, physicochemical, rheological, and sensory quality of cooked hams (n=11 marketed in Brazil. All samples showed microbiological results within the standards established by Brazilian legislation. Eight of the eleven samples studied met all the legal requirements; two samples violated the standards due to the addition of starch; one sample had lower protein content than the minimum required, and another one had sodium content higher than that stated on the label. The use of Hierarchical Cluster Analysis allowed the agglomeration of the samples into three groups with distinct quality traits and with significant differences in moisture content, chromaticity, syneresis, and heating and freezing loss. Principal Component Analysis showed that the samples which correlated to higher sensory acceptance regarding flavor and overall acceptability were those with higher moisture, protein, fat, and luminosity values. This study confirmed the efficacy of multivariate statistical techniques in assessing the quality of commercial cooked hams and in indicating the physicochemical parameters associated with the perception of product quality.

Determination of the viability of Toxoplasma gondii in cured ham using bioassay: influence of technological processing and food safety implications.

Science.gov (United States)

Bayarri, Susana; Gracia, María J; Lázaro, Regina; Pe Rez-Arquillué, Consuelo; Barberán, Montserrat; Herrera, Antonio

2010-12-01

Toxoplasmosis is a zoonotic disease caused by the protozoan Toxoplasma gondii and distributed worldwide. Ingestion of viable cysts from infected raw or undercooked meat is an important route of horizontal transmission of the parasite to humans. Little information is available concerning the effect of commercial curing on cysts of T. gondii. This study is the first in which the influence of processing of cured ham on the viability of T. gondii has been evaluated, using bioassay to assess the risk of infection from eating this meat product. Naturally infected pigs were selected for the study, and a mouse concentration bioassay technique was used to demonstrate viable bradyzoites of T. gondii in porcine tissues and hams. No viable parasites were found in the final product (14 months of curing) based on results of the indirect immunofluorescence assay and histological and PCR analyses. Our results indicate that the consumption of hams cured as described here poses an insignificant risk of acquiring toxoplasmosis. However, additional studies are required to evaluate the safety of ham products cured under different conditions of curing time, salt, and nitrite concentration.

Radio Club more than just a bunch of Hams

OpenAIRE

Kuska, Dale

1997-01-01

Students here at NPS spend most of their free time with their noses stuck in school books. Many, however, somehow find spare time to participate in extracurricular hobbies and activities. Amateur radio is one of these hobbies. Radio or "ham" operators enjoy a wealth of possibilities, including recreation, as well as being an integral unit in public events and emergency services. The NPS Amateur Radio Club takes full advantage of these possibilities.

Aerosol processing in stratiform clouds in ECHAM6-HAM

Science.gov (United States)

Neubauer, David; Lohmann, Ulrike; Hoose, Corinna

2013-04-01

Aerosol processing in stratiform clouds by uptake into cloud particles, collision-coalescence, chemical processing inside the cloud particles and release back into the atmosphere has important effects on aerosol concentration, size distribution, chemical composition and mixing state. Aerosol particles can act as cloud condensation nuclei. Cloud droplets can take up further aerosol particles by collisions. Atmospheric gases may also be transferred into the cloud droplets and undergo chemical reactions, e.g. the production of atmospheric sulphate. Aerosol particles are also processed in ice crystals. They may be taken up by homogeneous freezing of cloud droplets below -38° C or by heterogeneous freezing above -38° C. This includes immersion freezing of already immersed aerosol particles in the droplets and contact freezing of particles colliding with a droplet. Many clouds do not form precipitation and also much of the precipitation evaporates before it reaches the ground. The water soluble part of the aerosol particles concentrates in the hydrometeors and together with the insoluble part forms a single, mixed, larger particle, which is released. We have implemented aerosol processing into the current version of the general circulation model ECHAM6 (Stevens et al., 2013) coupled to the aerosol module HAM (Stier et al., 2005). ECHAM6-HAM solves prognostic equations for the cloud droplet number and ice crystal number concentrations. In the standard version of HAM, seven modes are used to describe the total aerosol. The modes are divided into soluble/mixed and insoluble modes and the number concentrations and masses of different chemical components (sulphate, black carbon, organic carbon, sea salt and mineral dust) are prognostic variables. We extended this by an explicit representation of aerosol particles in cloud droplets and ice crystals in stratiform clouds similar to Hoose et al. (2008a,b). Aerosol particles in cloud droplets are represented by 5 tracers for the

Effect of Particular Breed on the Chemical Composition, Texture, Color, and Sensorial Characteristics of Dry-cured Ham

OpenAIRE

Seong, Pil Nam; Park, Kuyng Mi; Kang, Sun Moon; Kang, Geun Ho; Cho, Soo Hyun; Park, Beom Young; Van Ba, Hoa

2014-01-01

The present study demonstrates the impact of specific breed on the characteristics of dry-cured ham. Eighty thighs from Korean native pig (KNP), crossbreed (Landrace×Yorkshire)♀×Duroc♂ (LYD), Berkshire (Ber), and Duroc (Du) pig breeds (n = 10 for each breed) were used for processing of dry-cured ham. The thighs were salted with 6% NaCl (w/w) and 100 ppm NaNO2, and total processing time was 413 days. The effects of breed on the physicochemical composition, texture, color and sensory characteri...

Hamming method for solving the delayed neutron precursor concentration for reactivity calculation

International Nuclear Information System (INIS)

Díaz, Daniel Suescún; Ospina, Juan Felipe Flórez; Sarasty, Jesús Andrés Rodríguez

2012-01-01

Highlights: ► We present a new formulation to calculate the reactivity using the Hamming method. ► This method shows better accuracy than existing methods for reactivity calculation. ► The reactivity is calculated without limitation of the nuclear power form. ► The method can be implemented in reactivity meters with time step of up to 0.1 s. - Abstract: We propose a new method for numerically solving the inverse point kinetic equation for a nuclear reactor using the Hamming method, without requiring the nuclear power history and without using the Laplace transform. This new method converges with accuracy of order h 5 , where h is the step in the computation time. The procedure is validated for different forms of the nuclear power and with different time steps. The results indicate that this method has a better accuracy and lower computational effort compared with other conventional methods that use the nuclear power history.

PHOTOGRAMMETRIC TECHNIQUES FOR PROMOTION OF ARCHAEOLOGICAL HERITAGE: THE ARCHAEOLOGICAL MUSEUM OF PARMA (ITALY

Directory of Open Access Journals (Sweden)

E. Dall’Asta

2016-06-01

Full Text Available In a context rich in history and cultural heritage, such as the Italian one, promotion and enhancement of historical evidences are crucial. The paper describes the case study of the Archaeological Museum of Parma, which, for the main part, conserves evidences found in the roman archaeological site of Veleia (Piacenza, Italy. To enhance the comprehension of the past, the project aims to promote the exhibits through new digital contents, in particular 3D models and AR applications, to improve their usability by the public. Projects like this pose some difficulties especially in data acquisition and restitution due to complexity of the objects and their dimension and position that are not always adequate for an easy survey. Furthermore, in this case, it was necessary to find a solution that takes into account, on one hand, the necessity of a high degree of detail to ensure high metric quality and, on the other hand, the need of producing small files, in order to easy load and consult them on the web or smartphone applications. For all these reasons, close-range photogrammetry was considered the most adequate technique to produce the major part of the models. In this paper, particular attention will be dedicated to the description of the survey campaign and data processing, underlining difficulties and adopted solutions, in order to provide a methodological summary of the actions performed.

Processamento do presunto "cook-in" de cordeiros Processing of cook-in ham of lambs

Directory of Open Access Journals (Sweden)

Eliane Mattos Monteiro

1999-12-01

Full Text Available Este trabalho teve por objetivo desenvolver tecnologia para produto curado (presunto "cook-in", com pernis de cordeiros cruza Texel x Corriedale em associação com tratamentos tecnológicos (massagem em "tumbler" e processo "cook-in". O estudo foi desenvolvido pela EMBRAPA/CPPSUL e Universidade Federal de Santa Maria, RS, Brasil. Após as análises da composição química, a carne foi injetada manualmente com 20 % de salmoura composta por água + gelo 79%, cloreto de sódio 7,52%, condimento para presunto 4,70%, fosfatos 1,97%, sais de cura 1,88%, sacarose 3,38% e glutamato monossódico 0,19 %. Os presuntos foram avaliados quanto à composição química (umidade, proteína, gordura, cinzas, pigmentos totais e pH, parâmetros sensoriais (cor, aroma, sabor, textura e aceitabilidade e rendimento. Uma das principais características dos presuntos obtidos com pernil de cordeiros cruza Texel x Corriedale foi o baixo conteúdo de gordura associado ao bom rendimento e à excelente aceitabilidade.The aim of this study was to develop technology for the curing lambs (cook-in hams which were manufactured from the legs of crossbred Texel x Corriedale lambs in association with technologic treatment (massaging in tumbler and cook-in process. The experiment was conducted at the EMBRAPA-CPPSUL/ UFSM, RS, Brazil. After the evaluation of the chemical composition, the meat was injected with it manually - 20 % of brine containing water 79%, salt 7.52%, curing salts 1.88%, sucrose 3.38%, ham condiments 4.70%, phosphate 1.97% and sodium glutamate 0.19%. The ham quality was evaluated by analysis of its chemical composition (moisture, protein, ash, fat, pH, sensory properties (color, aroma, texture, acceptability and yield. The main characteristics of lamb hams were low fat contents associated with excellent acceptability and good yield.

Classification of dry-cured hams according to the maturation time using near infrared spectra and artificial neural networks.

Science.gov (United States)

Prevolnik, M; Andronikov, D; Žlender, B; Font-i-Furnols, M; Novič, M; Škorjanc, D; Čandek-Potokar, M

2014-01-01

An attempt to classify dry-cured hams according to the maturation time on the basis of near infrared (NIR) spectra was studied. The study comprised 128 samples of biceps femoris (BF) muscle from dry-cured hams matured for 10 (n=32), 12 (n=32), 14 (n=32) or 16 months (n=32). Samples were minced and scanned in the wavelength range from 400 to 2500 nm using spectrometer NIR System model 6500 (Silver Spring, MD, USA). Spectral data were used for i) splitting of samples into the training and test set using 2D Kohonen artificial neural networks (ANN) and for ii) construction of classification models using counter-propagation ANN (CP-ANN). Different models were tested, and the one selected was based on the lowest percentage of misclassified test samples (external validation). Overall correctness of the classification was 79.7%, which demonstrates practical relevance of using NIR spectroscopy and ANN for dry-cured ham processing control. Copyright © 2013 Elsevier Ltd. All rights reserved.

Quantum Algorithm for K-Nearest Neighbors Classification Based on the Metric of Hamming Distance

Science.gov (United States)

Ruan, Yue; Xue, Xiling; Liu, Heng; Tan, Jianing; Li, Xi

2017-11-01

K-nearest neighbors (KNN) algorithm is a common algorithm used for classification, and also a sub-routine in various complicated machine learning tasks. In this paper, we presented a quantum algorithm (QKNN) for implementing this algorithm based on the metric of Hamming distance. We put forward a quantum circuit for computing Hamming distance between testing sample and each feature vector in the training set. Taking advantage of this method, we realized a good analog for classical KNN algorithm by setting a distance threshold value t to select k - n e a r e s t neighbors. As a result, QKNN achieves O( n 3) performance which is only relevant to the dimension of feature vectors and high classification accuracy, outperforms Llyod's algorithm (Lloyd et al. 2013) and Wiebe's algorithm (Wiebe et al. 2014).

Small is beautiful: diversity of freshwater ostracods (Crustacea, Ostracoda in marginal habitats of the province of Parma (Northern Italy

Directory of Open Access Journals (Sweden)

Stefano TAVERNELLI

2006-08-01

Full Text Available A study on the distribution of ostracods in small freshwater habitats of the province of Parma was conducted from May 2004 to December 2005. Vernal pools, ponds, shallow lakes, fountains, springs, ditches, canals, and streams were among the most common types of aquatic systems included in this survey. Altogether, 90 sites located between 24 and 1557 m a.s.l. were visited, and 125 samples were collected. 41 samples did not contain ostracods, and 7 samples were not considered because only immature specimens or empty valves were found. Consequently, 77 samples from 58 sites were analysed. Whenever possible, ostracod identification was done at the species level based on the morphology of both valves and limbs. Thirty-eight taxa from 20 genera belonging to the families Candonidae, Ilyocyprididae, Cyprididae, and Notodromadidae were recorded. This roughly accounts for one-third of the estimated number of non-marine ostracod species in Italy. Scanning electron microscopy images of valves are provided. The maximum number of species per site was six. The most frequent species were Heterocypris incongruens, Eucypris virens, Pseudocandona pratensis, Cypria ophthalmica, and Tonnacypris lutaria. Of particular relevance is the occurrence of species with a limited known distribution in Italy, viz. Ilyocypris monstrifica, Potamocypris villosa, Candona cf. lindneri, Fabaeformiscandona breuili and Physocypria kraepelini. A putative new species of the genus Candona, here left in open nomenclature, is also reported. Our results highlight the importance of so-called "marginal" aquatic habitats as potential biodiversity hotspots, in spite of the general lack of interest shown by freshwater ecologists and taxonomists in undertaking scientific investigations in these environments.

IL RUOLO DELLA FORMAZIONE NELLA PROMOZIONE DELLA LINGUA E DELLA CULTURA ITALIANA. INTERVISTA AL PROFESSOR ROBERTO GRECI, PRESIDE DELLA FACOLTÀ DI LETTERE E FILOSOFIA DELL’UNIVERSITÀ DI PARMA

Directory of Open Access Journals (Sweden)

Valentina Zenoni

2011-07-01

Full Text Available La formazione rappresenta uno strumento basilare nella promozione della lingua e della cultura italiana. L’argomento è articolato e complesso perché abbraccia diverse questioni. Da un lato va sostenuto l’utilizzo di mezzi adeguati, come quello telematico, che favoriscono e facilitano la diffusione all’estero. Dall’altro la proposta didattica di università e scuole deve essere riorganizzata alla luce delle nuove esigenze formative. Il ruolo degli atenei italiani potrebbe diventare più incisivo se si adeguassero maggiormente agli standard esteri, in modo da favorire la circolazione di studenti anche verso e non soltanto dall’Italia. Per quanto riguarda, invece, il tipo di formazione da sostenere, va riqualificata quella umanistica e tradizionale, non perché rappresenti la cultura nella sua totalità ma perché costituisce un patrimonio che caratterizza il nostro paese e non deve andare perso. Abbiamo parlato di queste tematiche con il Professor Roberto Greci, Preside della Facoltà di Lettere e Filosofia dell’Università di Parma e Presidente del Consiglio scientifico e didattico del Consorzio Interuniversitario ICoN, Italian Culture On the Net.     The role of training in the promotion of Italian language and culture. An interview with Professor Roberto Greci, Dean of the Literature and Philosophy Faculty at the University of Parma   Training represents a basic tool in promoting Italian language and culture.  The topic is complex because it encompasses diverse issues.  On the one hand appropriate means are needed, like telematic resources, which encourage and facilitate spreading abroad.  On the other, university and school courses need to be reorganized in light of the new training needs.  The role of Italian universities could to be stronger if they met foreign standards, to promote the circulation of students towards and not just away from Italy.  As far as regards the type of training to be undertaken, the humanistic

Analytical Solution of Nonlinear Problems in Classical Dynamics by Means of Lagrange-Ham

DEFF Research Database (Denmark)

Kimiaeifar, Amin; Mahdavi, S. H; Rabbani, A.

2011-01-01

In this work, a powerful analytical method, called Homotopy Analysis Methods (HAM) is coupled with Lagrange method to obtain the exact solution for nonlinear problems in classic dynamics. In this work, the governing equations are obtained by using Lagrange method, and then the nonlinear governing...

Antioxidant supplementation in pig nutrition: effects on shelf life of longissimus dorsi muscle and consumers’ preferences for smoked cured ham.

Directory of Open Access Journals (Sweden)

Federica Maghin

2015-07-01

Full Text Available The effects of dietary supplementation with antioxidant mixture in medium-heavy swine on oxidative status, nutritional and sensory characteristics of longissimus dorsi (LD muscle and smoked cured ham were evaluated. Seventy-four pigs (PIC x Max Grow, were assigned to two experimental groups: control (CT and treated supplemented with antioxidant mixture (AOX for 45 days before slaughter. The total antiradicalic activity of blood (KRL test and carcass dressing percentage was positively affected (P<0.05 by AOX supplementation. Chemical composition of LD was not affected by dietary treatment. Oxidative stability and colour indices were significantly affected (P<0.05 by dietary treatment and storage time (0, 6, 12, 15 days under modified atmosphere packs - MAP. Sensory analysis revealed that at 12 and 15 days of storage a loss of colour beside presence of off odors was higher (P<0.05 in CT than AOX group. The seasoning losses of smoked cured ham tended to be lower (P=0.06 in AOX group than CT. Physical and chemical composition was not affected by dietary treatment. Sensory analysis revealed a difference between CT and AOX (P<0.05 in salty and sweet taste. Furthermore, the consumer test revealed that smoked cured ham from AOX were preferred (P<0.05 than CT. Dietary supplementation with antioxidant mixture improves total antioxidant status, carcass dressing percentage and smoked cured ham seasoning losses. The oxidative, colour stability and sensory parameters of LD muscle was improved in AOX groups during refrigerated storage in MAP. Antioxidant mixture positively affect the consumer preference of smoked cured ham, without affecting other quality parameters.

Development of Graves' ophthalmopathy and uveitis after radioiodine therapy for Graves' disease in a patient with HTLA-I associated myelopathy (HAM)

Energy Technology Data Exchange (ETDEWEB)

Ozawa, Yasunori; Migita, Masayoshi; Watanabe, Tomoji; Okuda, Itsuko; Takeshita, Akira; Takagi, Akio; Shishiba, Yoshimasa (Toranomon Hospital, Tokyo (Japan))

1994-09-01

HTLV-I carriers or patients with HTLV-I associated myelopathy (HAM) are prone to immune-mediated inflammatory disorders. We present a 44-year-old female with HAM who developed Graves' disease. She developed severe Graves' ophthalmopathy shortly after [sup 131]I therapy, concurrently with a remarkable increase in TSH-receptor antibody titer. Ophthalmopathy was aggravated in spite of prednisolone therapy and euthyroidism being maintained by thyroxine replacement. Uveitis also developed after [sup 131]I therapy and iridocyclitis finally required trabeculotomy. This case suggests that HAM patients may have a higher risk of immune-mediated Graves' ophthalmopathy after [sup 131]I therapy.(author).

Implementasi Filter Finite Impulse Response (FIR Window Hamming dan Blackman menggunakan DSK TMS320C6713

Directory of Open Access Journals (Sweden)

LITA LIDYAWATI

2016-02-01

Full Text Available ABSTRAK Filter didefinisikan sebagai proses atau rangkaian yang melewatkan pita frekuensi tertentu yang diinginkan dan meredam pita frekuensi lainnya. Salah satu metode perancangan filter digital Finite Impulse Response (FIR adalah metode windowing. Dalam penelitian ini digunakan jenis window Hamming dan Blackman. Simulasi dilakukan dengan menggunakan software Matlab dengan memasukan frekuensi passband, frekuensi stopband, ripple passband, dan stopband attenuation. Dengan frekuensi sampling sebesar 15000 Hz, frekuensi passband sebesar 3000 Hz, frekuensi stopband sebesar 5000 Hz. Setelah simulasi dilakukan implementasi filter dengan parameter yang sama menggunakan DSK TMS 320C6713 dengan bantuan software CCS. Simulasi dan implementasi dilakukan pada semua band frekuensi. Hasil pengujian terhadap implementasi filter adalah respon magnitude, frekuensi cut-off, bandwidth, dan faktor kualitas dengan hasil simulasi tidak menunjukkan perbedaan yang signifikan. Kata kunci: filter digital, windowing, Hamming, Blackman, frekuensi cut-off . ABSTRACT Filter is defined as a process or series that skip certain desired frequency band and other frequency bands drown. One method of designing a digital filter Finite Impulse Response (FIR is a windowing method. This study used the type of window Hamming and Blackman. Simulations performed using Matlab software by inserting a frequency passband, stopband frequency, passband ripple, and stopband attenuation. With a sampling frequency of 15,000 Hz, a frequency of 3000 Hz passband, stopband frequency of 5000 Hz. After the simulation is completed, implementation of the filter with the same parameters using TMS 320C6713 DSK with the help of software CCS. Simulation and implmentasi performed on all frequency bands. The test results of the implementation of the filter is the Magnitude response, the cut-off frequency, bandwidth, and quality factor with simulation results showed no significant difference. Keywords: digital

Linguistic construct of songs of the Ham of Nigeria: A genre analysis ...

African Journals Online (AJOL)

The article examines the texts of songs of the Ham of Nigeria, a minority group, whose social links originate from kinship with a commonly held ancestry, to establish how such a relationship could be explicated in the content of the songs people from the society engage with. The study seeks to demonstrate the relationship ...

Nucleotide sequence analysis of HTLV-I isolated from cerebrospinal fluid of a patient with TSP/HAM: comparison to other HTLV-I isolates.

Science.gov (United States)

Mukhopadhyaya, R; Sadaie, M R

1993-02-01

Human T-cell leukemia virus type I (HTLV-I) has been associated with adult T-cell leukemia/lymphoma and the chronic neurologic disorder tropical spastic paraparesis/HTLV-I-associated myelopathy (TSP/HAM). To study the genetic structure of the virus associated with TSP/HAM, we have obtained and sequenced a partial genomic clone from an HTLV-I-positive cell line established from cerebrospinal fluid (CSF) of a Jamaican patient with TSP/HAM. This clone consisted of a 4.3-kb viral sequence containing the 5' long terminal repeat (LTR), gag, and N-terminal portion of the pol gene, with an overall 1.3% sequence variation resulting from mostly nucleotide substitutions, as compared to the prototype HTLV-I ATK-1. The gag and pol regions showed only 1.4% and 1.2% nucleotide variations, respectively. However, the U3 region of the LTR showed the highest sequence variation (3.6%), where several changes appear to be common among certain TSP/HAM isolates. Several of these changes reside within the 21-bp boundaries and the Tax-responsive element. It would be important to determine if the observed changes are sufficient to cause neurologic disorders similar to the murine leukemia virus system or simply reflect the divergent pool of HTLV-I from different geographic locations. At this time, we cannot rule out the possibility that the observed changes have either direct or indirect significance for the HTLV-I pathogenesis in TSP/HAM.

Improved Iris Recognition through Fusion of Hamming Distance and Fragile Bit Distance.

Science.gov (United States)

Hollingsworth, Karen P; Bowyer, Kevin W; Flynn, Patrick J

2011-12-01

The most common iris biometric algorithm represents the texture of an iris using a binary iris code. Not all bits in an iris code are equally consistent. A bit is deemed fragile if its value changes across iris codes created from different images of the same iris. Previous research has shown that iris recognition performance can be improved by masking these fragile bits. Rather than ignoring fragile bits completely, we consider what beneficial information can be obtained from the fragile bits. We find that the locations of fragile bits tend to be consistent across different iris codes of the same eye. We present a metric, called the fragile bit distance, which quantitatively measures the coincidence of the fragile bit patterns in two iris codes. We find that score fusion of fragile bit distance and Hamming distance works better for recognition than Hamming distance alone. To our knowledge, this is the first and only work to use the coincidence of fragile bit locations to improve the accuracy of matches.

Outbreak of febrile gastroenteritis caused by Listeria monocytogenes 1/2a in sliced cold beef ham, Italy, May 2016

Science.gov (United States)

Maurella, Cristiana; Gallina, Silvia; Ru, Giuseppe; Adriano, Daniela; Bellio, Alberto; Bianchi, Daniela Manila; Chiavacci, Laura; Crescio, Maria Ines; Croce, Margherita; D'Errico, Valeria; Dupont, Maria Franca; Marra, Alessandro; Natangelo, Ubaldo; Pomilio, Francesco; Romano, Angelo; Stanzione, Stefano; Zaccaria, Teresa; Zuccon, Fabio; Caramelli, Maria; Decastelli, Lucia

2018-01-01

In May 2016, two separate clusters of febrile gastroenteritis caused by Listeria monocytogenes were detected by the local health authority in Piedmont, in northern Italy. We carried out epidemiological, microbiological and traceback investigations to identify the source. The people affected were students and staff members from two different schools in two different villages located in the Province of Turin; five of them were hospitalised. The epidemiological investigation identified a cooked beef ham served at the school canteens as the source of the food-borne outbreak. L. monocytogenes was isolated from the food, the stools of the hospitalised pupils and the environment of the factory producing the cooked beef ham. All isolates except one were serotype 1/2a, shared an indistinguishable PFGE pattern and were 100% identical by whole genome sequencing (WGS). By combining a classical epidemiological approach with both molecular subtyping and WGS techniques, we were able to identify and confirm a Listeria gastroenteritis outbreak associated with consumption of sliced cold beef ham. PMID:29536831

Effect of Hops Beta Acids on the Survival of Unstressed- or Acid-Stress-Adapted-Listeria Monocytogenes and on the Quality and Sensory Attributes of Commercially Cured Ham Slices.

Science.gov (United States)

Wang, Li; McKeith, Amanda Gipe; Shen, Cangliang; Carter, Kelsey; Huff, Alyssa; McKeith, Russell; Zhang, Xinxia; Chen, Zhengxing

2016-02-01

This study evaluated the antilisterial activity of hops beta acids (HBA) and their impact on the quality and sensory attributes of ham. Commercially cured ham slices were inoculated with unstressed- and acid-stress-adapted (ASA)-L. monocytogenes (2.2 to 2.5 log CFU/cm(2) ), followed by no dipping (control), dipping in deionized (DI) water, or dipping in a 0.11% HBA solution. This was followed by vacuum or aerobic packaging and storage (7.2 °C, 35 or 20 d). Samples were taken periodically during storage to check for pH changes and analyze the microbial populations. Color measurements were obtained by dipping noninoculated ham slices in a 0.11% HBA solution, followed by vacuum packaging and storage (4.0 °C, 42 d). Sensory evaluations were performed on ham slices treated with 0.05% to 0.23% HBA solutions, followed by vacuum packaging and storage (4.0 °C, 30 d). HBA caused immediate reductions of 1.2 to 1.5 log CFU/cm(2) (P ham slices. During storage, the unstressed-L. monocytogenes populations on HBA-treated samples were 0.5 to 2.0 log CFU/cm(2) lower (P color or sensory attributes of the ham slices stored in vacuum packages. These results are useful for helping ready-to-eat meat processors develop operational procedures for applying HBA on ham slices. © 2016 Institute of Food Technologists®

Alginate-Based Edible Films Delivering Probiotic Bacteria to Sliced Ham Pretreated with High Pressure Processing

Directory of Open Access Journals (Sweden)

Foteini Pavli

2017-08-01

Full Text Available The aim of the present work was to evaluate the efficacy of Na-alginate edible films as vehicles for delivering probiotic bacteria to sliced ham with or without pretreatment using high pressure processing (HPP. Three strains of probiotic bacteria were incorporated in Na-alginate forming solution. Ham slices (with or without pretreatment using HPP at 500 MPa for 2 min were packed under vacuum in contact with the films and then stored at 4, 8 and 12 °C for 66, 47 and 40 days, respectively. Microbiological analysis was performed in parallel with pH and color measurements. Sensory characteristics were assessed, while the presence and the relative abundance of each probiotic strain during storage was evaluated using pulsed field gel electrophoresis. In ham slices without HPP treatment, probiotic bacteria were enumerated above 106 CFU/g during storage at all temperatures. Same results were obtained in cases of HPP treated samples, but pH measurements showed differences with the latter ones exhibiting higher values. Sensory evaluation revealed that probiotic samples had a more acidic taste and odor than the control ones, however these characteristics were markedly compromised in samples treated with HPP. Overall, the results of the study are promising since probiotic bacteria were successfully delivered in the products by edible films regardless of the HPP treatment.

Alginate-Based Edible Films Delivering Probiotic Bacteria to Sliced Ham Pretreated with High Pressure Processing.

Science.gov (United States)

Pavli, Foteini; Kovaiou, Ioanna; Apostolakopoulou, Georgia; Kapetanakou, Anastasia; Skandamis, Panagiotis; Nychas, George-John E; Tassou, Chrysoula; Chorianopoulos, Nikos

2017-08-29

The aim of the present work was to evaluate the efficacy of Na-alginate edible films as vehicles for delivering probiotic bacteria to sliced ham with or without pretreatment using high pressure processing (HPP). Three strains of probiotic bacteria were incorporated in Na-alginate forming solution. Ham slices (with or without pretreatment using HPP at 500 MPa for 2 min) were packed under vacuum in contact with the films and then stored at 4, 8 and 12 °C for 66, 47 and 40 days, respectively. Microbiological analysis was performed in parallel with pH and color measurements. Sensory characteristics were assessed, while the presence and the relative abundance of each probiotic strain during storage was evaluated using pulsed field gel electrophoresis. In ham slices without HPP treatment, probiotic bacteria were enumerated above 10⁶ CFU/g during storage at all temperatures. Same results were obtained in cases of HPP treated samples, but pH measurements showed differences with the latter ones exhibiting higher values. Sensory evaluation revealed that probiotic samples had a more acidic taste and odor than the control ones, however these characteristics were markedly compromised in samples treated with HPP. Overall, the results of the study are promising since probiotic bacteria were successfully delivered in the products by edible films regardless of the HPP treatment.

Solutions of the SIR models of epidemics using HAM

International Nuclear Information System (INIS)

Awawdeh, Fadi; Adawi, A.; Mustafa, Z.

2009-01-01

In this paper, we investigate the accuracy of the Homotopy Analysis Method (HAM) for solving the problem of the spread of a non-fatal disease in a population. The advantage of this method is that it provides a direct scheme for solving the problem, i.e., without the need for linearization, perturbation, massive computation and any transformation. Mathematical modeling of the problem leads to a system of nonlinear ODEs. MATLAB 7 is used to carry out the computations. Graphical results are presented and discussed quantitatively to illustrate the solution.

a Restoration Oriented Hbim System for Cultural Heritage Documentation: the Case Study of Parma Cathedral

Science.gov (United States)

Bruno, N.; Roncella, R.

2018-05-01

The need to safeguard and preserve Cultural Heritage (CH) is increasing and especially in Italy, where the amount of historical buildings is considerable, having efficient and standardized processes of CH management and conservation becomes strategic. At the time being, there are no tools capable of fulfilling all the specific functions required by Cultural Heritage documentation and, due to the complexity of historical assets, there are no solution as flexible and customizable as CH specific needs require. Nevertheless, BIM methodology can represent the most effective solution, on condition that proper methodologies, tools and functions are made available. The paper describes an ongoing research on the implementation of a Historical BIM system for the Parma cathedral, aimed at the maintenance, conservation and restoration. Its main goal was to give a concrete answer to the lack of specific tools required by Cultural Heritage documentation: organized and coordinated storage and management of historical data, easy analysis and query, time management, 3D modelling of irregular shapes, flexibility, user-friendliness, etc. The paper will describe the project and the implemented methodology, focusing mainly on survey and modelling phases. In describing the methodology, critical issues about the creation of a HBIM will be highlighted, trying to outline a workflow applicable also in other similar contexts.

HAM Construction modeling using COMSOL with MatLab Modeling Guide version 1.0.

NARCIS (Netherlands)

Schijndel, van A.W.M.

2006-01-01

This paper presents a first modeling guide for the modeling and simulation of up to full 3D dynamic Heat, Air & Moisture (HAM) transport of building constructions using COMSOL with Matlab. The modeling scripts are provided at the appendix. Furthermore, all modeling files and results are published at

HAM Construction modeling using COMSOL with MatLab Modeling Guide, version 1.0

NARCIS (Netherlands)

Schijndel, van A.W.M.

2006-01-01

This paper presents a first modeling guide for the modeling and simulation of up to full 3D dynamic Heat, Air & Moisture (HAM) transport of building constructions using COMSOL with Matlab. The modeling scripts are provided at the appendix. Furthermore, all modeling files and results are published at

Interplay between biology and sedimentology in a mudflat (Biezelingse Ham, Westerschelde, The Netherlands)

NARCIS (Netherlands)

de Brouwer, J.F.C.; Bjelic, S.; De Deckere, E.M.G.T.; Stal, L.J.

2000-01-01

The aim of this research was to investigate the importance of biological processes on the sediment characteristics and the morphology of a mudflat in the Westerschelde (The Netherlands). For this purpose, a transect in the Biezelingse Ham mudflat was sampled on a monthly basis. In spring, the muddy

Faithful reconstruction of digital holograms captured by FINCH using a Hamming window function in the Fresnel propagation.

Science.gov (United States)

Siegel, Nisan; Rosen, Joseph; Brooker, Gary

2013-10-01

Recent advances in Fresnel incoherent correlation holography (FINCH) increase the signal-to-noise ratio in hologram recording by interference of images from two diffractive lenses with focal lengths close to the image plane. Holograms requiring short reconstruction distances are created that reconstruct poorly with existing Fresnel propagation methods. Here we show a dramatic improvement in reconstructed fluorescent images when a 2D Hamming window function substituted for the disk window typically used to bound the impulse response in the Fresnel propagation. Greatly improved image contrast and quality are shown for simulated and experimentally determined FINCH holograms using a 2D Hamming window without significant loss in lateral or axial resolution.

Effect of Dietary Processed Sulfur Supplementation on Texture Quality, Color and Mineral Status of Dry-cured Ham.

Science.gov (United States)

Kim, Ji-Han; Ju, Min-Gu; Yeon, Su-Jung; Hong, Go-Eun; Park, WooJoon; Lee, Chi-Ho

2015-01-01

This study was performed to investigate the chemical composition, mineral status, oxidative stability, and texture attributes of dry-cured ham from pigs fed processed sulfur (S, 1 g/kg feed), and from those fed a basal diet (CON), during the period from weaning to slaughter (174 d). Total collagen content and soluble collagen of the S group was significantly higher than that of the control group (pham (pham from the control group, that from the S group exhibited lower springiness and gumminess; these results suggest that feeding processed sulfur to pigs can improve the quality of the texture and enhance the oxidative stability of dry-cured ham.

Role of IL-21 in HTLV-1 infections with emphasis on HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP).

Science.gov (United States)

Rajaei, Taraneh; Farajifard, Hamid; Rafatpanah, Houshang; Bustani, Reza; Valizadeh, Narges; Rajaei, Bahareh; Rezaee, Seyed Abdolrahim

2017-06-01

Interleukin-21 (IL-21) enhances the survival and cytotoxic properties of cytotoxic T cells (CTLs) and exhibits essential roles in controlling chronic viral infections. HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP) is a chronic progressive inflammatory disease of the nervous system. The main determinant of disease progression is efficiency of the CTL response to Human T lymphotropic virus types I (HTLV-1). In this study, the expression of host IL-21 and HTLV-I Tax and proviral load (PVL) was evaluated to understand the role and mechanism of IL-21 in HTLV-1 infections and the subsequent development of HAM/TSP. A cross-sectional study was carried out on 20 HAM/TSP patients, 20 asymptomatic HTLV-1 carriers (ACs) and 20 healthy controls (HCs) to evaluate the expression of IL-21 and Tax and PVL in non-activated and phorbol myristate acetate (PMA)-ionomycin-activated peripheral blood mononuclear cells (PBMCs). The mean mRNA expression of IL-21 in the non-activated and activated PBMCs was higher (by 5-13 times) in the HAM/TSP patients than in ACs and HCs (p Tax and PVL was observed in the HAM/TSP subjects than ACs (p Tax gene expression was positively correlated with PVL (R = 0.595, p = 0.000) and IL-21 gene expression (R = 0.395, p = 0.021) in the HTLV-1-infected subjects. In conclusion, the increase in IL-21 mRNA expression may reflect the attempt of infected T cells to induce an appropriate antiviral response, and the decrease in IL-21 protein expression may reflect the inhibition of IL-21 mRNA translation by viral factors in favour of virus evasion and dissemination.

Muscle characteristics only partially explain color variations in fresh hams.

Science.gov (United States)

Stufft, K; Elgin, J; Patterson, B; Matarneh, S K; Preisser, R; Shi, H; England, E M; Scheffler, T L; Mills, E W; Gerrard, D E

2017-06-01

Fresh hams display significant lean color variation that persists through further processing and contributes to a less desirable cured product. In an attempt to understand the underlying cause of this color disparity, we evaluated the differences in muscle characteristics and energy metabolites across semimembranosus (SM) muscles differing in color variation. The L* (lightness) and a* (redness) values were highest and lowest (Pham color variation but suggest other factors may mitigate or exacerbate these variances. Copyright © 2016 Elsevier Ltd. All rights reserved.

Accelerated production of dry cured hams.

Science.gov (United States)

Marriott, N G; Graham, P P; Shaffer, C K; Phelps, S K

1987-01-01

Ten uncured legs from the right side of the sampled pork carcasses (Study A) were vacuum tumbled with the cure adjuncts for 30 min (T) and 10 counterparts from the left side were tumbled 30 min, rested 30 min and tumbled an additional 30 min (TRT). Evaluations were conducted at 40 and 70 days after cure application for color, taste attributes, percentage moisture, percentage salt and NO(3)(-) and NO(2)(-) content. Study B was the same except that 18 legs were boned, tumbled and cured for 40, 56 and 70 days. The TRT samples (Study A) at 40 days sustained less color fading (P 0.05) existed among the uncooked hams. Increased cure time enhanced moisture loss and salt content (Study A) and color retention during cookery (Study B). The TRT samples had increased moisture loss and salt content (Study A). Copyright © 1987. Published by Elsevier Ltd.

Restructured low-fat cooked ham containing liquid whey fortified with lactulose.

Science.gov (United States)

Oliveira, Cristiane A; Massingue, Armando A; Moura, Ana Paula R; Fontes, Paulo Rogério; Ramos, Alcinéia Ls; Ramos, Eduardo M

2018-01-01

Current health concerns have driven consumers to request products with nutritional and physiological advantages, which can be achieved by using prebiotic ingredients. Lactulose is a prebiotic with excellent functional properties and can be easily incorporated into meat products through the addition of liquid whey. This study investigated the technological and sensorial quality of restructured cooked ham elaborated without liquid whey added (control) and with liquid whey containing different contents (0, 30, 60 and 100 g kg -1 ) of lactulose. Liquid whey did not change any technological or sensorial characteristics of the product, but the general acceptability decreased due to addition of lactulose. Samples with higher lactulose concentrations had lower moisture content, pH and refreezing loss and increased carbohydrate content. Control and whey added samples had higher lightness and lower intense color than samples with lactulose. Liquid whey additions with higher lactulose content increased hardness and chewiness of the samples. Restructured cooked hams formulated with liquid whey and 30 g kg -1 of lactulose had minimal effects on the technological properties and sensory characteristics and, due to the possible benefits conferred by the prebiotic, is a potential alternative to provide meat products with prebiotic activity. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

The children of Ham

Directory of Open Access Journals (Sweden)

John W. Pulis

1997-01-01

Full Text Available [First paragraph] Bob Marley: Songs of Freedom. RITA MARLEY, ADRIAN BOOT & CHRIS SALEWICZ (eds.. London: Bloomsbury, 1995. 288 pp. (Paper £ 14.99 Marley and Me: The Real Story. DON TAYLOR (as told to Mike Henry. Kingston: Kingston Publishers, 1994. xxxv + 226 pp. (Paper US$ 16.95 Dread Talk: The Language of Rastafari. VELMA POLLARD. Kingston: Canoe Press, 1994. x + 84 pp. (Paper J$ 150.00 Rastafari: Roots and ldeology. BARRY CHEVANNES. Syracuse NY: Syracuse University Press, 1994; Kingston: The Press - University of the West Indies, 1995. xiv + 298 pp. (Cloth US$ 34.95, Paper US$ 17.95; J$ 500.00 Seeking a myth to justify the enslavement of Africans, explorers, scholars, and others turned to the Bible, that most sacred and preeminent of Western texts, conjured-up an old biblical curse, and set it to work one more time. As Europe entered the Modern Era, Africans were reinvented as the children of Ham and were targeted for a life of servitude in the New World. Five hundred years later, black folk in Jamaica seized upon an event in Africa, re-interpreted a passage in the Revelation of John, and set in motion a project that transformed enslavement and exile into a religious movement of global proportions.1

Hamming's "open doors" and group creativity as keys to scientific excellence: the example of Cambridge.

Science.gov (United States)

Erren, Thomas C

2008-01-01

Dr. Charlton used diverse approaches to identify research institutions which provided home to outstanding scientists and work. One intriguing example of long-lasting scientific excellence is Cambridge with 19 Nobel laureates who worked at the University or at the MRC Molecular Biology Unit when they received the prize between 1947 and 2006. With specific reference to Cambridge, I would like to complement the primarily quantitative assessment and offer considerations as to why and how research achievements may have clustered in space and time. Indeed, observations voiced by the mathematician Richard Hamming as to how great research can be pursued offer explanations for the series of great science in the UK. In my view, the most important determinant of the clustering may be illustrated by Hamming's fitting picture of "open doors": working in environments with the doors open allows constant interactions with peers with various disciplinary backgrounds, and thus fast avoidance of detours or dead ends in science and, ultimately, a focus on and the solution of problems of paramount, rather than of tangential, importance. Narrative insights into a strong argumentative tradition at Cambridge provided by Drs. Watson and Magueijo between 1968 and 2003 are in line with Hamming's suggestion and the value of group creativity. In the internet age with abundant interactions beyond home institutions we should not be surprised if clusters of great science were no longer confined to the usual suspect institutions which were awarded disproportionally with Nobel prizes in the past.

Consumer facial expression in relation to smoked ham with the use of face reading technology. The methodological aspects and informative value of research results.

Science.gov (United States)

Kostyra, Eliza; Rambuszek, Michał; Waszkiewicz-Robak, Bożena; Laskowski, Wacław; Blicharski, Tadeusz; Poławska, Ewa

2016-09-01

The study determined the emotional reactions of consumers in relation to hams using face visualization method, which was recorded by FaceReader (FR). The aims of the research were to determine the effect of the ham samples on the type of emotion, to examine more deeply the individual emotional reactions of consumers and to analyse the emotional variability with regard to the temporal measurement of impressions. The research involved testing the effectiveness of measuring emotions in response to the ongoing flavour impression after consumption of smoked hams. It was found that for all of the assessed samples, neutral and negative emotions prevailed as the overall emotions recorded during the assessment of the taste/flavour impression. The range of variability of the overall emotions depended more on the consumer reactions and less on the properties of the assessed product. Consumers expressed various emotions in time and the ham samples evoked different emotional reactions as an effect of duration of the impression. Copyright © 2016 Elsevier Ltd. All rights reserved.

Analysis of microbiological contamination in mixed pressed ham and cooked sausage in Korea.

Science.gov (United States)

Park, Myoung-Su; Wang, Jun; Park, Joong-Hyun; Forghani, Fereidoun; Moon, Jin-San; Oh, Deog-Hwan

2014-03-01

The objective of this study was to investigate the microbial contamination levels (aerobic bacteria plate count [APC], coliforms, Escherichia coli, Staphylococcus aureus, and Listeria monocytogenes) in mixed pressed ham and cooked sausage. A total of 180 samples were collected from factories with and without hazard analysis critical control point (HACCP) systems at four steps: after chopping (AC), after mixing (AM), cooling after the first heating process, and cooling after the second heating process. For ham, APCs and coliform and E. coli counts increased when ingredients were added to the meat at the AC step. Final product APC was 1.63 to 1.85 log CFU/g, and coliforms and E. coli were not detected. S. aureus and L. monocytogenes were found in nine (15.0%) and six (10.0%) samples, respectively, but only at the AC and AM steps and not in the final product. Sausage results were similar to those for ham. The final product APC was 1.52 to 3.85 log CFU/g, and coliforms and E. coli were not detected. S. aureus and L. monocytogenes were found in 29 (24.2%) and 25 (20.8%) samples at the AC and AM steps, respectively, but not in the final product. These results indicate that the temperature and time of the first and second heating are of extreme importance to ensure the microbiological safety of the final product regardless of whether a HACCP system is in place. Microorganism contamination must be monitored regularly and regulations regarding sanitization during processing should be improved. Education regarding employee personal hygiene, environmental hygiene, prevention of cross-contamination, ingredient control, and step-by-step process control is needed to reduce the risk of food poisoning.

Effect of the partial replacement of sodium chloride by other salts on the formation of volatile compounds during ripening of dry-cured ham.

Science.gov (United States)

Armenteros, Mónica; Toldrá, Fidel; Aristoy, M-Concepción; Ventanas, Jesús; Estévez, Mario

2012-08-08

The effect of the partial NaCl replacement by other salts (potassium, calcium, and magnesium chloride) on the formation of volatile compounds through the processing of dry-cured ham was studied using solid-phase microextraction (SPME). Three salt formulations were considered, namely, I (100% NaCl), II (50% NaCl and 50% KCl), and III (55% NaCl, 25% KCl, 15% CaCl(2), and 5% MgCl(2)). There was an intense formation of volatile compounds throughout the processing of dry-cured hams, particularly during the "hot-cellar" stage. The differences between treatments were found to be more remarkable at the end of the curing process. Hams from formulations I and II had significantly higher amounts of lipid-derived volatiles such as hexanal than hams from formulation III, whereas the latter had significantly higher amounts of Strecker aldehydes and alcohols. Plausible mechanisms by which salt replacement may affect the generation of volatile compounds include the influence of such replacement on lipid oxidation and proteolysis phenomena. The potential influence of the volatiles profile on the aroma of the products is also addressed in the present paper.

Analysis of the Relationship between Hamming Distance and the Electromagnetic Information Leakage

OpenAIRE

Sun Haimeng; Liu Jinming; Zhang Jiemin; Mao Jian

2013-01-01

Electromagnetic information leak as a potential data security risk is more and more serious. Discussing the relationship between compromising emanations and Hamming distance is directed to preventing or reducing the electromagnetic information leakage. The paper presents the model of electromagnetic information leak, then the hierarchical protection strategy based on the model is proposed, that is anti-radiation, anti-intercept and anti-reconstruction. Analyzing the causes of electromagnetic ...

Urban Imperviousness Effects on Summer Surface Temperatures Nearby Residential Buildings in Different Urban Zones of Parma

Directory of Open Access Journals (Sweden)

Marco Morabito

2017-12-01

Full Text Available Rapid and unplanned urban growth is responsible for the continuous conversion of green or generally natural spaces into artificial surfaces. The high degree of imperviousness modifies the urban microclimate and no studies have quantified its influence on the surface temperature (ST nearby residential building. This topic represents the aim of this study carried out during summer in different urban zones (densely urbanized or park/rural areas of Parma (Northern Italy. Daytime and nighttime ASTER images, the local urban cartography and the Italian imperviousness databases were used. A reproducible/replicable framework was implemented named “Building Thermal Functional Area” (BTFA useful to lead building-proxy thermal analyses by using remote sensing data. For each residential building (n = 8898, the BTFA was assessed and the correspondent ASTER-LST value (ST_BTFA and the imperviousness density were calculated. Both daytime and nighttime ST_BTFA significantly (p < 0.001 increased when high levels of imperviousness density surrounded the residential buildings. These relationships were mostly consistent during daytime and in densely urbanized areas. ST_BTFA differences between urban and park/rural areas were higher during nighttime (above 1 °C than daytime (about 0.5 °C. These results could help to identify “urban thermal Hot-Spots” that would benefit most from mitigation actions.

Phage Inactivation of Listeria monocytogenes on San Daniele Dry-Cured Ham and Elimination of Biofilms from Equipment and Working Environments.

Science.gov (United States)

Iacumin, Lucilla; Manzano, Marisa; Comi, Giuseppe

2016-01-05

The anti-listerial activity of generally recognized as safe (GRAS) bacteriophage Listex P100 (phage P100) was demonstrated in broths and on the surface of slices of dry-cured ham against 5 strains or serotypes (i.e., Scott A, 1/2a, 1/2b, and 4b) of Listeria monocytogenes. In a broth model system, phage P100 at a concentration equal to or greater than 7 log PFU/mL completely inhibited 2 log CFU/cm² or 3 log CFU/cm² of L. monocytogenes growth at 30 °C. The temperature (4, 10, 20 °C) seemed to influence P100 activity; the best results were obtained at 4 °C. On dry-cured ham slices, a P100 concentration ranging from 5 to 8 log PFU/cm² was required to obtain a significant reduction in L. monocytogenes. At 4, 10, and 20 °C, an inoculum of 8 log PFU/cm² was required to completely eliminate 2 log L. monocytogenes/cm² and to reach the absence in 25 g product according to USA food law. Conversely, it was impossible to completely eradicate L. monocytogenes with an inoculum of approximately of 3.0 and 4.0 log CFU/cm² and with a P100 inoculum ranging from 1 to 7 log PFU/cm². P100 remained stable on dry-cured ham slices over a 14-day storage period, with only a marginal loss of 0.2 log PFU/cm² from an initial phage treatment of approximately 8 log PFU/cm². Moreover, phage P100 eliminated free L. monocytogenes cells and biofilms on the machinery surfaces used for dry-cured ham production. These findings demonstrate that the GRAS bacteriophage Listex P100 at level of 8 log PFU/cm² is listericidal and useful for reducing the L. monocytogenes concentration or eradicating the bacteria from dry-cured ham.

Phage Inactivation of Listeria monocytogenes on San Daniele Dry-Cured Ham and Elimination of Biofilms from Equipment and Working Environments

Directory of Open Access Journals (Sweden)

Lucilla Iacumin

2016-01-01

Full Text Available The anti-listerial activity of generally recognized as safe (GRAS bacteriophage Listex P100 (phage P100 was demonstrated in broths and on the surface of slices of dry-cured ham against 5 strains or serotypes (i.e., Scott A, 1/2a, 1/2b, and 4b of Listeria monocytogenes. In a broth model system, phage P100 at a concentration equal to or greater than 7 log PFU/mL completely inhibited 2 log CFU/cm2 or 3 log CFU/cm2 of L. monocytogenes growth at 30 °C. The temperature (4, 10, 20 °C seemed to influence P100 activity; the best results were obtained at 4 °C. On dry-cured ham slices, a P100 concentration ranging from 5 to 8 log PFU/cm2 was required to obtain a significant reduction in L. monocytogenes. At 4, 10, and 20 °C, an inoculum of 8 log PFU/cm2 was required to completely eliminate 2 log L. monocytogenes/cm2 and to reach the absence in 25 g product according to USA food law. Conversely, it was impossible to completely eradicate L. monocytogenes with an inoculum of approximately of 3.0 and 4.0 log CFU/cm2 and with a P100 inoculum ranging from 1 to 7 log PFU/cm2. P100 remained stable on dry-cured ham slices over a 14-day storage period, with only a marginal loss of 0.2 log PFU/cm2 from an initial phage treatment of approximately 8 log PFU/cm2. Moreover, phage P100 eliminated free L. monocytogenes cells and biofilms on the machinery surfaces used for dry-cured ham production. These findings demonstrate that the GRAS bacteriophage Listex P100 at level of 8 log PFU/cm2 is listericidal and useful for reducing the L. monocytogenes concentration or eradicating the bacteria from dry-cured ham.

Effect of L-glucose and D-tagatose on bacterial growth in media and a cooked cured ham product.

Science.gov (United States)

Bautista, D A; Pegg, R B; Shand, P J

2000-01-01

Cured meats such as ham can undergo premature spoilage on account of the proliferation of lactic acid bacteria. This spoilage is generally evident from a milkiness in the purge of vacuum-packaged sliced ham. Although cured, most hams are at more risk of spoilage than other types of processed meat products because they contain considerably higher concentrations of carbohydrates, approximately 2 to 7%, usually in the form of dextrose and corn syrup solids. Unfortunately, the meat industry is restricted with respect to the choice of preservatives and bactericidal agents. An alternative approach from these chemical compounds would be to use novel carbohydrate sources that are unrecognizable to spoilage bacteria. L-Glucose and D-tagatose are two such potential sugars, and in a series of tests in vitro, the ability of bacteria to utilize each as an energy source was compared to that of D-glucose. Results showed that both L-glucose and D-tagatose are not easily catabolized by a variety of lactic bacteria and not at all by pathogenic bacteria such as Escherichia coli O157:H7, Salmonella Typhimurium, Staphylococcus aureus, Bacillus cereus, and Yersinia enterocolitica. In a separate study, D-glucose, L-glucose, and D-tagatose were added to a chopped and formed ham formulation and the rate of bacterial growth was monitored. Analysis of data by a general linear model revealed that the growth rates of total aerobic and lactic acid bacteria were significantly (P D-tagatose than those containing L- or D-glucose. Levels of Enterobacteriaceae were initially low and these bacteria did not significantly (P D-tagatose at 10 degrees C was extended by 7 to 10 days. These results indicate that D-tagatose could deter the growth of microorganisms and inhibit the rate of spoilage in a meat product containing carbohydrates.

PENJADWALAN FLOWSHOP MENGGUNAKAN ALGORITMA NAWAZ ENSCORE HAM

Directory of Open Access Journals (Sweden)

Ilyas Masudin

2014-06-01

Full Text Available This article attempts to schedule flow shop production using Nawaz Enscore Ham (NEH to schedule jobs machining. The objective of this paper is to minimize total makespan which could reduce total production costs. This paper is based on the case study where NEH is applied in scheduling jobs in machines and then compared with the existing machine’s scheduling. The algorithm of NEH is also used to reduce idle time of machines so that the utility or performances of the machine are maintained.  The results of NEH simulation indicate that by applying NEH algorithm to scheduling machines for 10 jobs and 5 machines can reduce 2.5 per cent or 118 minutes of completing time of jobs. It also decreases total idle time of machines about 582 minutes compared with the existing scheduling.

PENJADWALAN FLOWSHOP MENGGUNAKAN ALGORITMA NAWAZ ENSCORE HAM

Directory of Open Access Journals (Sweden)

Ilyas Masudin

2014-06-01

Full Text Available This article attempts to schedule flow shop production using Nawaz Enscore Ham (NEH to schedule jobs machining. The objective of this paper is to minimize total makespan which could reduce total production costs. This paper is based on the case study where NEH is applied in scheduling jobs in machines and then compared with the existing machine’s scheduling. The algorithm of NEH is also used to reduce idle time of machines so that the utility or performances of the machine are maintained. The results of NEH simulation indicate that by applying NEH algorithm to scheduling machines for 10 jobs and 5 machines can reduce 2.5 per cent or 118 minutes of completing time of jobs. It also decreases total idle time of machines about 582 minutes compared with the existing scheduling.

Modeling and optimization of sensory changes and shelf-life in vacuum-packaged cooked ham treated by E-beam irradiation

Energy Technology Data Exchange (ETDEWEB)

Benedito, J., E-mail: jjbenedi@tal.upv.e [Grupo de Analisis y Simulacion de Procesos Agroalimentarios, Departamento Tecnologia de Alimentos, Universidad Politecnica de Valencia, Cami de Vera S/n, E46022 Valencia (Spain); Cambero, M.I. [Departamento de Nutricion, Bromatologia y Tecnologia de los Alimentos, Facultad de Veterinaria, Universidad Complutense de Madrid, E28040 Madrid (Spain); Ortuno, C. [Grupo de Analisis y Simulacion de Procesos Agroalimentarios, Departamento Tecnologia de Alimentos, Universidad Politecnica de Valencia, Cami de Vera S/n, E46022 Valencia (Spain); Cabeza, M.C.; Ordonez, J.A.; Hoz, L. de la [Departamento de Nutricion, Bromatologia y Tecnologia de los Alimentos, Facultad de Veterinaria, Universidad Complutense de Madrid, E28040 Madrid (Spain)

2011-03-15

The E-beam irradiation of vacuum-packaged RTE cooked ham was carried out to establish the dose required to achieve the food safety objective (FSO) and to minimize changes in selected sensory attributes. Cooked ham was irradiated with doses ranging 1-4 kGy. After the treatment, the microbial inactivation of Listeria monocytogenes, the shelf-life of the product and some sensory attributes (appearance, odor, and flavor) were determined. The inactivation of L. monocytogenes was satisfactorily described by a first-order kinetics equation (R2=0.99). The influence of the irradiation dose on appearance, odor, and flavor was modeled through Gompertz (R2=0.99, for appearance) and Activation/Inactivation (R2=0.99, for odor and flavor) equations. A model was also developed to determine the shelf-life of irradiated cooked ham depending on the irradiation dose (R2>0.91). The dose that maximized the scores of the sensory attributes was 0.96 kGy resulting in an acceptable sensory quality for 80 days. It is possible to apply up to 2 kGy to ensure microbial safety, while provoking no significant changes in the above mentioned sensory attributes.

Modeling and optimization of sensory changes and shelf-life in vacuum-packaged cooked ham treated by E-beam irradiation

International Nuclear Information System (INIS)

Benedito, J.; Cambero, M.I.; Ortuno, C.; Cabeza, M.C.; Ordonez, J.A.; Hoz, L. de la

2011-01-01

The E-beam irradiation of vacuum-packaged RTE cooked ham was carried out to establish the dose required to achieve the food safety objective (FSO) and to minimize changes in selected sensory attributes. Cooked ham was irradiated with doses ranging 1-4 kGy. After the treatment, the microbial inactivation of Listeria monocytogenes, the shelf-life of the product and some sensory attributes (appearance, odor, and flavor) were determined. The inactivation of L. monocytogenes was satisfactorily described by a first-order kinetics equation (R2=0.99). The influence of the irradiation dose on appearance, odor, and flavor was modeled through Gompertz (R2=0.99, for appearance) and Activation/Inactivation (R2=0.99, for odor and flavor) equations. A model was also developed to determine the shelf-life of irradiated cooked ham depending on the irradiation dose (R2>0.91). The dose that maximized the scores of the sensory attributes was 0.96 kGy resulting in an acceptable sensory quality for 80 days. It is possible to apply up to 2 kGy to ensure microbial safety, while provoking no significant changes in the above mentioned sensory attributes.

The effect of high pressure and residual oxygen on the color stability of minced cured restructured ham at different levels of drying, pH, and NaCl.

Science.gov (United States)

Bak, Kathrine Holmgaard; Lindahl, Gunilla; Karlsson, Anders H; Lloret, Elsa; Gou, Pere; Arnau, Jacint; Orlien, Vibeke

2013-10-01

Color stability of minced cured restructured ham was studied by considering the effects of high pressure (HP) (600 MPa, 13°C, 5 min), raw meat pH24 (low, normal, high), salt content (15, 30 g/kg), drying (20%, 50% weight loss), and residual oxygen level (0.02%-0.30%). Raw hams were selected by pH24 in Semimembranosus, mixed with additives, frozen, sliced, and dried by the Quick-Dry-Slice® (QDS) process followed by HP treatment or not (control). Packaging and storage simulated industrial packaging: modified atmosphere containing 80% N2, 20% CO2, and residual O2 in one of three intervals: hams, while the stabilizing effect on 50% QDS hams was smaller, concluding that water has the dominating role. Raw meat pH24, salt content, and residual oxygen level had varying effects on the stability of the red color. Copyright © 2013 Elsevier Ltd. All rights reserved.

Quality characteristics of chunked and formed hams from pale, average and dark muscles were improved using an ammonium hydroxide curing solution.

Science.gov (United States)

Everts, A J; Wulf, D M; Everts, A K R; Nath, T M; Jennings, T D; Weaver, A D

2010-10-01

Cooking yield, cooked pH, purge loss, moisture, lipid oxidation, external and internal color, break strength and elongation distance were assessed for pale (PALE), average (AVG) and dark (DARK) inside hams injected with either a control cure solution (CON) or BPI-processing technology cure solution (BPT). Following enhancement, muscles were chunked, vacuum tumbled, smoked and cooked to 66 degrees C. Cooked ham pH was 6.49 for DARK, 6.40 for AVG, and 6.30 for PALE, respectively (PMeat Science Association. Published by Elsevier Ltd. All rights reserved.

Incubation of curing brines for the production of ready-to-eat, uncured, no-nitrite-or-nitrate-added, ground, cooked and sliced ham.

Science.gov (United States)

Krause, B L; Sebranek, J G; Rust, R E; Mendonca, A

2011-12-01

Salt concentration, vegetable juice powder (VJP) concentration and temperature were investigated to determine necessary conditions for incubation of curing brines including VJP and a starter culture containing Staphylococcus carnosus prior to production of naturally cured, no-nitrate/nitrite-added meat products. Subsequently, incubated brines were utilized to produce no-nitrate/nitrite-added sliced ham in which quality characteristics and residual nitrite concentrations were measured to determine feasibility of brine incubation for nitrate conversion prior to injection. Two ham treatments (one with VJP and starter culture; one with pre-converted VJP) and a nitrite-added control were used. No differences (P>0.05) were found for color in the VJP treatments. Control sliced ham was redder after 42 days of storage, retaining significantly (Phams during the first week of storage. While the nitrite-added control retained greater red color and initially had more residual nitrite than the VJP treatments, the two VJP treatments did not differ from each other. Copyright © 2011 Elsevier Ltd. All rights reserved.

Effects of a soybean-free diet supplied to Italian heavy pigs on fattening performance, and meat and dry-cured ham quality

Directory of Open Access Journals (Sweden)

Luca Sardi

2012-10-01

Full Text Available The aim of this study was to investigate the effects of a diet containing non-conventional (i.e. alternative to soybean meal vegetable protein sources on fattening performance, and meat and dry-cured ham quality of heavy pigs. Fifty-six (Landrace x Large White castrated males with an initial average body weight of 50 kg were allocated to two experimental groups: a control group in which pigs received a traditional soybean meal-based diet, and a treatment group in which soybean meal was replaced by vegetable protein sources (i.e. sunflower meal, potato protein, corn gluten feed, faba beans and dehydrated alfalfa meal, mainly locally grown and not genetically modified. Pigs were slaughtered at approximately 160 kg body weight. Dietary treatment had no significant effect on fattening performance, or meat, fat or dry-cured ham properties. Results suggest that it is possible to feed heavy pigs a soybean-free diet without impairing fattening performance or the quality of meat and Italian PDO (Protected Designation of Origin hams.

Relevance of nitrate and nitrite in dry-cured ham and their effects on aroma development

Directory of Open Access Journals (Sweden)

Flores, Mónica

2009-07-01

Full Text Available Potassium and sodium salts of nitrite (E 249 and E 250 and nitrate (E 251 and E 252 are authorised for use under certain levels in several foodstuffs such as non-heat-treated, cured and dried meat products, other cured meat products, canned meat products and bacon. The key point in the use of nitrate and nitrite as preservatives is to find a balance between ensuring the microbiological safety of the ham and keeping as low as possible the level of nitrosamines in the final product. Nitrites and nitrates are authorised as additives for dry-cured ham in the Directive 2006/52/EC of 5 July 2006 that modifies previous Council Directive 95/2/EC on food additives other than colours and sweeteners. The effect of nitrate and its reduction to nitrite in controlling the lipid oxidation process during the ham ripening is very important for the development of the characteristic cured flavour. The main benefits and drawbacks of the use of nitrites and nitrates in dry-cured ham and how these levels may affect its flavour are discussed in this manuscript.Las sales sódica y potásica del nitrito (E249 y E250 y del nitrato (E251 y E252 están autorizados para su uso en los productos cárnicos, secos, curados y no tratados por el calor, otros productos cárnicos curados, productos cárnicos enlatados y bacon. El punto esencial en el uso de nitrato y nitrito como conservantes consiste en encontrar un balance entre el aseguramiento de la seguridad microbiológica del jamón y mantener el nivel de nitrosaminas tan bajo como sea posible. Los nitratos y nitritos están autorizados como aditivos en el jamón curado según la Directiva Europea 2006/52/EC de 5 de Julio de 2006 que modificaba la previa Directiva Europea 95/2/EC de aditivos alimentarios distintos a los colorantes y edulcorantes. El efecto del nitrato y su reducción a nitrito para controlar la oxidación de los lípidos durante la maduración del jamón es muy importante para el desarrollo del caracter

Draft Genome Sequence of Staphylococcus carnosus subsp. utilis LTH 7013, Isolated from South Tyrolean Ham

OpenAIRE

M?ller, Anne; Huptas, Christopher; Wenning, Mareike; Schmidt, Herbert; Weiss, Agnes

2015-01-01

Staphylococcus carnosus is used as a starter culture in meat fermentation, where it contributes to color formation and produces aromatic compounds. Here, we report the first draft genome sequence of an S.?carnosus subsp. utilis strain, LTH 7013, isolated from South Tyrolean ham, with potential application as a starter culture.

The time has come to stop rotations for the identification of structures in the Hamilton Depression Scale (HAM-D₁₇)

DEFF Research Database (Denmark)

Bech, Per; Csillag, Claudio; Hellström, Lone

2013-01-01

Objective: To use principal component analysis (PCA) to test the hypothesis that the items of the Hamilton Depression Scale (HAM-D17) have been selected to reflect depression disability, whereas some of the items are specific for sub-typing depression into typical vs. atypical depression. Method......: Our previous study using exploratory factor analysis on HAM-D17 has been re-analyzed with PCA and the results have been compared to a dataset from another randomized prospective study. Results: PCA showed that the first principal component was a general factor covering depression disability...

The Hamming distance in the minority game

Science.gov (United States)

D'hulst, R.; Rodgers, G. J.

1999-08-01

We investigate different versions of the minority game, a toy model for agents buying and selling a commodity. The Hamming distance between the strategies used by agents to make decisions is introduced as an analytical tool to determine several properties of these models. The success rate of the agents in an adaptive version of the game is compared with the rate from a stochastic version. It is shown numerically and analytically that the adaptive process is inefficient, increasing the success rate of the unused strategies while decreasing the success rate of the strategies used by the agents. The agents do not do as well as if they were forced to use only one strategy permanently. A version of the game in which the agents strategies evolve is also analysed using the notion of distance. The agents evolve into a state in which they are all using one strategy, which is again the state that yields the maximum success rate.

Psychometric properties of responses by clinicians and older adults to a 6-item Hebrew version of the Hamilton Depression Rating Scale (HAM-D6)

DEFF Research Database (Denmark)

Bachner, Yaacov G; O'Rourke, Norm; Goldfracht, Margalit

2013-01-01

The Hamilton Depression Rating Scale (HAM-D) is commonly used as a screening instrument, as a continuous measure of change in depressive symptoms over time, and as a means to compare the relative efficacy of treatments. Among several abridged versions, the 6-item HAM-D6 is used most widely in lar...... degree because of its good psychometric properties. The current study compares both self-report and clinician-rated versions of the Hebrew version of this scale....

Use of Fourier transform infrared spectroscopy for monitoring the shelf life of ham slices packed with probiotic supplemented edible films after treatment with high pressure processing.

Science.gov (United States)

Pavli, F; Argyri, A A; Nychas, G-J E; Tassou, C; Chorianopoulos, N

2018-04-01

The aim of the present study was to investigate the potential use of Fourier transform infrared (FTIR) spectroscopy to quantify biochemical changes occurring in ham slices packed with probiotic supplemented edible films and treated with High Pressure Processing (HPP), in monitoring spoilage. Details regarding the data collection and experimental procedure were presented by Pavli et al. (2017). A series of Partial Least Squares (PLS) models were developed to correlate spectral data from FTIR analysis with ham spoilage during storage under vacuum at different temperatures (4, 8 and 12°C). FTIR spectra were collected from the surface of the ham samples in parallel with microbiological analysis of total viable counts (TVC) and lactic acid bacteria (LAB). Qualitative interpretation of spectral data was based on a sensory evaluation, using a hedonic scale, classifying the samples in three quality classes, fresh, semi-fresh and spoiled. The scope of the modeling approach was to discriminate the ham slices in their respective quality class and additionally to predict the microbial population directly from spectral data. The results obtained demonstrated that the processing of the samples affected the performance of classification in the sensory classes, with better results observed in the case of for ham slices packed with probiotic supplemented (PS) edible films and of control samples without HPP. The performance of PLS regression models on providing quantitative estimations of microbial counts were based on specific figures of merit (bias factor, accuracy factor, root mean square error, percentage of prediction error). Bias and accuracy factors were close to unity for both microbial groups tested for samples without HPP, whereas for HPP treated samples the values of these indices ranged from 0.963 to 1.332, depending on the case and indice. The results of this study demonstrated for the first time that although FTIR can be used reliably for the rapid assessment of

Draft Genome Sequence of Staphylococcus carnosus subsp. utilis LTH 7013, Isolated from South Tyrolean Ham.

Science.gov (United States)

Müller, Anne; Huptas, Christopher; Wenning, Mareike; Schmidt, Herbert; Weiss, Agnes

2015-05-14

Staphylococcus carnosus is used as a starter culture in meat fermentation, where it contributes to color formation and produces aromatic compounds. Here, we report the first draft genome sequence of an S. carnosus subsp. utilis strain, LTH 7013, isolated from South Tyrolean ham, with potential application as a starter culture. Copyright © 2015 Müller et al.

Unveiling aerosol-cloud interactions - Part 2: Minimising the effects of aerosol swelling and wet scavenging in ECHAM6-HAM2 for comparison to satellite data

Science.gov (United States)

Neubauer, David; Christensen, Matthew W.; Poulsen, Caroline A.; Lohmann, Ulrike

2017-11-01

Aerosol-cloud interactions (ACIs) are uncertain and the estimates of the ACI effective radiative forcing (ERFaci) magnitude show a large variability. Within the Aerosol_cci project the susceptibility of cloud properties to changes in aerosol properties is derived from the high-resolution AATSR (Advanced Along-Track Scanning Radiometer) data set using the Cloud-Aerosol Pairing Algorithm (CAPA) (as described in our companion paper) and compared to susceptibilities from the global aerosol climate model ECHAM6-HAM2 and MODIS-CERES (Moderate Resolution Imaging Spectroradiometer - Clouds and the Earth's Radiant Energy System) data. For ECHAM6-HAM2 the dry aerosol is analysed to mimic the effect of CAPA. Furthermore the analysis is done for different environmental regimes. The aerosol-liquid water path relationship in ECHAM6-HAM2 is systematically stronger than in AATSR-CAPA data and cannot be explained by an overestimation of autoconversion when using diagnostic precipitation but rather by aerosol swelling in regions where humidity is high and clouds are present. When aerosol water is removed from the analysis in ECHAM6-HAM2 the strength of the susceptibilities of liquid water path, cloud droplet number concentration and cloud albedo as well as ERFaci agree much better with those of AATSR-CAPA or MODIS-CERES. When comparing satellite-derived to model-derived susceptibilities, this study finds it more appropriate to use dry aerosol in the computation of model susceptibilities. We further find that the statistical relationships inferred from different satellite sensors (AATSR-CAPA vs. MODIS-CERES) as well as from ECHAM6-HAM2 are not always of the same sign for the tested environmental conditions. In particular the susceptibility of the liquid water path is negative in non-raining scenes for MODIS-CERES but positive for AATSR-CAPA and ECHAM6-HAM2. Feedback processes like cloud-top entrainment that are missing or not well represented in the model are therefore not well

Study of the Assessment Method for N Excretion in Sustainable Heavy Pigs Production

Science.gov (United States)

Guo, Kaijun; Liu, Fenghua; Xu, Xiaolong; Xu, Jianqin; Zoccarato, Ivo

Italian heavy pigs, with an average slaughtering body weight of 150-170 kg, are world-wide famous for its Parma ham production. Because the requirement of market diversity, producers are interested in ham production following the procedure of Italian pork industry. However, with ever growing public concern about nitrogen (N) pollution in the environment, it is necessary to determine a suitable method to measure N excretion from heavy pig production. The N retention was calculated by factorial method and compared with estimations of other methods available in literature. The results showed that the N percentage of heavy pigs is 2.43% ± 0.07% on body weight basis and the percentage of N excretion was approximately 69.62% ± 0.20 of N intake. Regarding the N excretion of estimation methods, the proposal of Xiccato et al. was closer to reality of the heavy pig production than other methods and could be used as a standard way to calculate the N excretion. Besides the overall standard, it is opportune to make a N balance sheet for every individual farm under specific conditions. Only in this way, the farmers can realize their deficiencies and will voluntarily follow the Good Management Practice (GMP) indications so as to guarantee a sustainable development of pig production.

Antimicrobial activity of lauric arginate-coated polylactic acid films against Listeria monocytogenes and Salmonella typhimurium on cooked sliced ham.

Science.gov (United States)

Theinsathid, Pornpun; Visessanguan, Wonnop; Kruenate, Jittiporn; Kingcha, Yutthana; Keeratipibul, Suwimon

2012-02-01

A novel type of environmentally friendly packaging with antibacterial activity was developed from lauric arginate (LAE)-coating of polylactic acid (PLA) films after surface activation using a corona discharge. Scanning electron microscopy (SEM)-based analysis of the LAE/PLA films confirmed the successful coating of LAE on the PLA surface. The mechanical properties of the LAE/PLA films with different levels of LAE-coating (0% to 2.6%[w/w]) were essentially the same as those of the neat PLA film. The antibacterial activity of the LAE/PLA films against Listeria monocytogenes and Salmonella enterica Serovar Typhimurium (S. Typhimurium) was confirmed by a qualitative modified agar diffusion assay and quantitative JIS Z 2801:2000 method. Using the LAE/PLA film as a food-contact antimicrobial packaging for cooked cured ham, as a model system, suggested a potential application to inhibit L. monocytogenes and S. Typhimurium on ham with a 0.07% (w/w) LAE coating on the PLA when high transparency is required, as evidenced from the 2 to 3 log CFU/tested film lower pathogen growth after 7 d storage but even greater antibacterial activity is obtained with a LAE coating level of 2.6% (w/w) but at the cost of a reduced transparency of the finished product. This article shows how we can simply develop functional green packaging of PLA for food with effective and efficient antimicrobial activity by use of LAE coating on the surface via corona discharge. The effectiveness of an innovative antimicrobial LAE-coated PLA film against foodborne pathogens was demonstrated. Importantly, the application of the LAE to form the LAE-coated PLA film can be customized within current film manufacturing lines. © 2012 Institute of Food Technologists®

Influence of tumbling, tumbling time, trim and sodium tripolyphosphate on quality and yield of cured hams

NARCIS (Netherlands)

Krause, R.J.; Ockerman, H.W.; Krol, B.; Moerman, P.C.; et al.

1978-01-01

Forty‐four boneless, cured hams were assigned to treatment groups to study the effect of tumbling, tumbling time (18 hr intermittent, 9.5 hr intermittent, 3 hr continuous), tumbling temperature (5°C and 15°C), sodium tripolyphosphate (TPP) pickle level (0 and 3.3%), and trim (lean, regular, and fat)

Color, sensory and textural attributes of beef frankfurter, beef ham and meat-free sausage containing tomato pomace.

Science.gov (United States)

Savadkoohi, Sobhan; Hoogenkamp, Henk; Shamsi, Kambiz; Farahnaky, Asgar

2014-08-01

The present investigation focuses on the textural properties, sensory attributes and color changes of beef frankfurter, beef ham and meat-free sausage produced by different levels of bleached tomato pomace. The texture and color profile were performed using an instrumental texture analyzer and colorimeter. The findings indicated that tomato pomace-added sausages had higher water holding capacity (WHC) compared to that of commercial samples. The frankfurters containing 5 and 7% (w/w) tomato pomace had the highest redness (a*), chroma (C*) and color differences (ΔE) values, while the meat-free sausages containing 7% (w/w) tomato pomace had significant (p0.05) color differences between beef ham samples (with and without tomato pomace). A significant progression in the textural hardness and chewiness of systems containing tomato pomace was observed as well as higher sensory scores by panelists. According to sensorial evaluations, bleached tomato pomace improved the consumer acceptability and preference. Copyright © 2014 Elsevier Ltd. All rights reserved.

Quality traits of fallow deer (Dama dama dry-cured hams

Directory of Open Access Journals (Sweden)

E. Piasentier

2011-03-01

Full Text Available Meat processing by drying, after salting or fermentation and before a long ripening period, is an ancient and widespread process, used to preserve meat from spoilage. Among the wide variety of dry meat products made in Europe, the most famous ones are made from pork (Italian and Spanish dry-cured hams, fermented sausages, but other interesting products are obtained from meat of different species: i.e., the “bresaola”, from bovine, horse, goat, etc. (Paleari et al., 2002. Deer meat and meat products are interesting in this picture, since they include the high degree of consumers’ appreciation for dried products and considering the growing interest for food obtained by natural husbandry and technology...

Pre-menopausal triple-negative breast cancer at HAM hospital medan

Science.gov (United States)

Betty; Laksmi, L. I.; Siregar, K. B.

2018-03-01

Triple-negative breast cancers (TNBC) are a type of breast cancer that does not have any or lack expression of the three receptors of estrogen (ER), progesterone (PR), and human epidermal growth factor receptor 2 (HER-2). This cross-sectional study was performed on patients TNBC in HAM hospital Medan from 2013 to 2016 by immunohistochemistry stained. A total 60 invasive breast cancer samples with TNBC. The more frequent in TNBC group were 51-60 years (19 cases, 31.66%) and pre-menopause (34 cases, 57%). Tumor size T3 and T4 with staging IIIA and IIIB, histology sub-type IC-NOS and ILC with grade 2 and grade 3 of histologic was more common in TNBC.

Survival of Listeria monocytogenes and Salmonella typhimurium and quality attributes of cooked pork chops and cured ham after irradiation

International Nuclear Information System (INIS)

Fu, A.H.; Sebranek, J.G.; Murano, E.A.

1995-01-01

Cooked pork chops (pumped with salt/polyphosphate brine or untreated) and cured hams were inoculated with Listeria monocytogenes and Salmonella typhimurium. The samples were irradiated at low (0.75 to 0.90 kGy) or medium doses (1.8 to 2.0 kGy), and each dose was delivered at either a low (2.5 M/min conveyor speed) or high (5.4 M/min) dose rate. Low-dose irradiation reduced L. monocytogenes by more than 2 log and S. typhimurium by 1 to 3 log. Pathogen populations and total plate counts (TPC) were reduced to undetectable levels by medium doses. No meat quality attributes were affected, and no dose rate effect was observed. Nitrite reduced (P 0.05) both pathogens and TPC during 7 degrees C storage in ham, especially when combined with low-dose irradiation

Gradual Reduction in Sodium Content in Cooked Ham, with Corresponding Change in Sensorial Properties Measured by Sensory Evaluation and a Multimodal Machine Vision System.

Directory of Open Access Journals (Sweden)

Kirsti Greiff

Full Text Available The European diet today generally contains too much sodium (Na(+. A partial substitution of NaCl by KCl has shown to be a promising method for reducing sodium content. The aim of this work was to investigate the sensorial changes of cooked ham with reduced sodium content. Traditional sensorial evaluation and objective multimodal machine vision were used. The salt content in the hams was decreased from 3.4% to 1.4%, and 25% of the Na(+ was replaced by K(+. The salt reduction had highest influence on the sensory attributes salty taste, after taste, tenderness, hardness and color hue. The multimodal machine vision system showed changes in lightness, as a function of reduced salt content. Compared to the reference ham (3.4% salt, a replacement of Na(+-ions by K(+-ions of 25% gave no significant changes in WHC, moisture, pH, expressed moisture, the sensory profile attributes or the surface lightness and shininess. A further reduction of salt down to 1.7-1.4% salt, led to a decrease in WHC and an increase in expressible moisture.

Gradual Reduction in Sodium Content in Cooked Ham, with Corresponding Change in Sensorial Properties Measured by Sensory Evaluation and a Multimodal Machine Vision System.

Science.gov (United States)

Greiff, Kirsti; Mathiassen, John Reidar; Misimi, Ekrem; Hersleth, Margrethe; Aursand, Ida G

2015-01-01

The European diet today generally contains too much sodium (Na(+)). A partial substitution of NaCl by KCl has shown to be a promising method for reducing sodium content. The aim of this work was to investigate the sensorial changes of cooked ham with reduced sodium content. Traditional sensorial evaluation and objective multimodal machine vision were used. The salt content in the hams was decreased from 3.4% to 1.4%, and 25% of the Na(+) was replaced by K(+). The salt reduction had highest influence on the sensory attributes salty taste, after taste, tenderness, hardness and color hue. The multimodal machine vision system showed changes in lightness, as a function of reduced salt content. Compared to the reference ham (3.4% salt), a replacement of Na(+)-ions by K(+)-ions of 25% gave no significant changes in WHC, moisture, pH, expressed moisture, the sensory profile attributes or the surface lightness and shininess. A further reduction of salt down to 1.7-1.4% salt, led to a decrease in WHC and an increase in expressible moisture.

Aerosol size-dependent below-cloud scavenging by rain and snow in the ECHAM5-HAM

Directory of Open Access Journals (Sweden)

R. Posselt

2009-07-01

Full Text Available Wet deposition processes are highly efficient in the removal of aerosols from the atmosphere, and thus strongly influence global aerosol concentrations, and clouds, and their respective radiative forcings. In this study, physically detailed size-dependent below-cloud scavenging parameterizations for rain and snow are implemented in the ECHAM5-HAM global aerosol-climate model. Previously, below-cloud scavenging by rain in the ECHAM5-HAM was simply a function of the aerosol mode, and then scaled by the rainfall rate. The below-cloud scavenging by snow was a function of the snowfall rate alone. The global mean aerosol optical depth, and sea salt burden are sensitive to the below-cloud scavenging coefficients, with reductions near to 15% when the more vigorous size-dependent below-cloud scavenging by rain and snow is implemented. The inclusion of a prognostic rain scheme significantly reduces the fractional importance of below-cloud scavenging since there is higher evaporation in the lower troposphere, increasing the global mean sea salt burden by almost 15%. Thermophoretic effects are shown to produce increases in the global and annual mean number removal of Aitken size particles of near to 10%, but very small increases (near 1% in the global mean below-cloud mass scavenging of carbonaceous and sulfate aerosols. Changes in the assumptions about the below-cloud scavenging by rain of particles with radius smaller than 10 nm do not cause any significant changes to the global and annual mean aerosol mass or number burdens, despite a change in the below-cloud number removal rate for nucleation mode particles by near to five-fold. Annual and zonal mean nucleation mode number concentrations are enhanced by up to 30% in the lower troposphere with the more vigourous size-dependent below-cloud scavenging. Closer agreement with different observations is found when the more physically detailed below-cloud scavenging parameterization is employed in the ECHAM5

Development of a ready to eat fish based product using seafood industry byproducts: FisHam

Directory of Open Access Journals (Sweden)

Luís Raimundo

2014-05-01

Full Text Available Over the last years, there has been an increased demand from consumers for safe, nutritionally balanced and convenient food products. These trends are contributing towards an increasing demand for fishery products which affects fishery resources worldwide, compromising stocks of many fish species. The technological enhancement of the byproducts of fish industries or fish species of low commercial value, transforming these materials in products with high nutritional potential will simultaneously contribute towards fulfill present consumer trends and to a more sustainable marine resources management. The present work develops the product concept and prototype formulation of a ready to eat omega 3 enriched product using raw material trimmings of fish of low commercial value. The product developed, FisHam is a ham-like refrigerated product, which can be slice and added to sandwiches or diced and added to salads. Product concept was validated with a questionnaire, in which it was obtained a positive global acceptance by 86% of the inquired people. Sensory analysis of the product revealed its good acceptability, with an average global appreciation of “enjoyed moderately” and with 58% of the pannel stating the intention of buying the product. Fish oil addition had no impact on sensory acceptance. Regarding the physicochemical analysis, the selected formulation showed a content of protein of 7,08%, low lipid content of 3,74%, medium content of humidity of 61% and low caloric value of 164 calories per 100 grams. The color, textural attributes, humidity content and microbiological parameters were monitored during 10 days of refrigerated storage at 5ºC. On the microbiological level, the product showed the absence of enterobacteries and psychrotrophics in compliance with legal microbiological criteria set for ready to eat products. It can be concluded that this new product can be considered an alternative product to meat ham and other meat products in

Growth characteristics of Listeria monocytogenes as affected by a native microflora in cooked ham under refrigerated and temperature abuse conditions.

Science.gov (United States)

Hwang, Cheng-An; Sheen, Shiowshuh

2011-05-01

This study examined the growth characteristics of Listeria monocytogenes as affected by a native microflora in cooked ham at refrigerated and abuse temperatures. A five-strain mixture of L. monocytogenes and a native microflora, consisting of Brochothrix spp., isolated from cooked meat were inoculated alone (monocultured) or co-inoculated (co-cultured) onto cooked ham slices. The growth characteristics, lag phase duration (LPD, h), growth rate (GR, log(10) cfu/h), and maximum population density (MPD, log(10) cfu/g), of L. monocytogenes and the native microflora in vacuum-packed ham slices stored at 4, 6, 8, 10, and 12 °C for up to 5 weeks were determined. At 4-12 °C, the LPDs of co-cultured L. monocytogenes were not significantly different from those of monocultured L. monocytogenes in ham, indicating the LPDs of L. monocytogenes at 4-12 °C were not influenced by the presence of the native microflora. At 4-8 °C, the GRs of co-cultured L. monocytogenes (0.0114-0.0130 log(10) cfu/h) were statistically but marginally lower than those of monocultured L. monocytogenes (0.0132-0.0145 log(10) cfu/h), indicating the GRs of L. monocytogenes at 4-8 °C were reduced by the presence of the native microflora. The GRs of L. monocytogenes were reduced by 8-7% with the presence of the native microflora at 4-8 °C, whereas there was less influence of the native microflora on the GRs of L. monocytogenes at 10 and 12 °C. The MPDs of L. monocytogenes at 4-8 °C were also reduced by the presence of the native microflora. Data from this study provide additional information regarding the growth suppression of L. monocytogenes by the native microflora for assessing the survival and growth of L. monocytogenes in ready-to-eat meat products. Published by Elsevier Ltd.

A novel organizational model to face the challenge of multimorbid elderly patients in an internal medicine setting: a case study from Parma Hospital, Italy.

Science.gov (United States)

Meschi, Tiziana; Ticinesi, Andrea; Prati, Beatrice; Montali, Arianna; Ventura, Antonio; Nouvenne, Antonio; Borghi, Loris

2016-08-01

Continuous increase of elderly patients with multimorbidity and Emergency Department (ED) overcrowding are great challenges for modern medicine. Traditional hospital organizations are often too rigid to solve them without consistently rising healthcare costs. In this paper we present a new organizational model achieved at Internal Medicine and Critical Subacute Care Unit of Parma University Hospital, Italy, a 106-bed internal medicine area organized by intensity of care and specifically dedicated to such patients. The unit is partitioned into smaller wards, each with a specific intensity level of care, including a rapid-turnover ward (mean length of stay model, compared with other peer units of the hospital and of other teaching hospitals of the region, showed a better performance, efficacy and effectiveness indexes calculated on Regional Hospital Discharge Records database system, allowing a capacity to face a massive (+22 %) rise in medical admissions from the ED. Further studies are needed to validate this model from a patient outcome point of view.

Effects of high pressure application (400 and 900 MPa) and refrigerated storage time on the oxidative stability of sliced skin vacuum packed dry-cured ham.

Science.gov (United States)

Clariana, Maria; Guerrero, Luis; Sárraga, Carmen; Garcia-Regueiro, José A

2012-02-01

The effect of high pressure processing at 400 MPa and 900 MPa on the oxidative stability of sliced and vacuum packaged commercial dry-cured ham was determined by analyzing the antioxidant enzyme activities, TBARS levels (thiobarbituric acid reactive substances), vitamin E content and physicochemical characteristics during refrigerated storage for 50 days in different light conditions. In dry-cured ham pressurized at 400 MPa color changes and sensory analyses were also assessed. The high pressure process at 900 MPa produced a decrease in superoxide dismutase (SOD) and glutathione peroxidase (GSHPx) activities and increased vitamin E content. In contrast, pressurization at 400 MPa, increased SOD activity, and showed no effect on vitamin E content and GSHPx activity. In general the physicochemical parameters determined (fat, moisture and collagen) were unaffected by pressurization. Treatment at 400 MPa increased the instrumental color measurement of lightness (L* values, CIELAB). This level of pressure also modified the hardness, chewiness, saltiness and color intensity. These changes of the sensory attributes in dry-cured ham were significant, but small. Copyright © 2011 Elsevier Ltd. All rights reserved.

Nisin, rosemary, and ethylenediaminetetraacetic acid affect the growth of Listeria monocytogenes on ready-to-eat turkey ham stored at four degrees Celsius for sixty-three days.

Science.gov (United States)

Ruiz, A; Williams, S K; Djeri, N; Hinton, A; Rodrick, G E

2009-08-01

The objectives of this study were to determine the anti-Listeria and general antimicrobial properties of nisin, rosemary, and EDTA alone and in combination on Listeria monocytogenes inoculated on ready-to-eat vacuum-packaged diced turkey ham and to ascertain the effects of the treatments on pH and objective color. The turkey hams were cut into 0.5-cm pieces, inoculated with a L. monocytogenes cocktail containing 5 strains of the bacterium, and treated with either no treatment and no inoculum (negative control), inoculum only (positive control), 0.5% nisin, 20 mM EDTA, 1% rosemary, 0.5% nisin + 20 mM EDTA, 0.5% nisin + 1% rosemary, 0.5% nisin + 20 mM EDTA + 1% rosemary, or 20 mM EDTA + 1% rosemary. All samples were vacuum-packaged, stored for 63 d at 4 degrees C +/- 1 degrees C, and analyzed at 1-wk intervals for total aerobes, L. monocytogenes, lactic acid organisms, pH, and objective color. Nisin, nisin with rosemary, nisin with EDTA, and nisin with rosemary and EDTA treatments reduced (P hams treated with nisin. The EDTA and rosemary treatments alone and in combination were ineffective in inhibiting growth of L. monocytogenes. Although none of the treatments completely eliminated L. monocytogenes, the results indicated that ready-to-eat turkey ham can have significantly decreased L. monocytogenes when treated with nisin alone or in combination with rosemary or EDTA, or both.

Influence of the convective surface transfer coefficients on the Heat, Air, and Moisture (HAM) building performance

DEFF Research Database (Denmark)

Steskens, Paul Wilhelmus Maria Hermanus; Janssen, Hans; Rode, Carsten

2009-01-01

Current models to predict heat, air and moisture (HAM) conditions in buildings assume constant boundary conditions for the temperature and relative humidity of the neighbouring air and for the surface heat and moisture transfer coefficients. These assumptions may introduce errors in the predicted...... influence on the predicted hygrothermal conditions at the surface of a building component and on the heat and vapour exchange with the indoor environment....

Mycobiota and toxigenic Penicillium species on two Spanish dry-cured ham manufacturing plants.

Science.gov (United States)

Alapont, C; López-Mendoza, M C; Gil, J V; Martínez-Culebras, P V

2014-01-01

The present study reports the natural mycobiota occurring in dry-cured hams, and in particular on the incidence of mycotoxin-producing fungi. A total of 338 fungal colonies were isolated from three stages of production, these being the post-salting, ripening and aging stages in two manufacturing plants. The results show that fungi were more frequently isolated from the aging stage and that the predominant filamentous fungal genus isolated was Penicillium. Seventy-four of the 338 fungal strains were selected for identification at the species level by using morphological criteria and internal transcribed spacers sequencing. Of the 74 fungal strains, 59 were Penicillium strains. Sixteen Penicillium species were identified, with P. commune (24 strains) and P. chrysogenum (13 strains) being the most abundant. The potential ability to produce cyclopiazonic acid (CPA) and ochratoxin A (OTA) was studied by isolating the culture followed by HPLC analysis of these mycotoxins in the culture extracts. The results indicated that 25 (33.7%) of the 74 fungal strains produced CPA. Worth noting is the high percentage of CPA-producing strains of P. commune (66.6%) of which some strains were highly toxigenic. P. polonicum strains were also highly toxigenic. With respect to OTA-producing fungi, a low percentage of fungal strains (9.5%) were able to produce OTA at moderate levels. OTA-producing fungi belonged to different Penicillium species including P. chrysogenum, P. commune, P. polonicum and P. verrucosum. These results indicate that there is a possible risk factor posed by CPA and OTA contamination of dry-cured hams.

SYSTEM CONTROL OF SMOKING PROCESS AND MEASURING BENZO[A]PYRENE IN TRADITIONAL PRODUCTION OF BOSNIAN DRY CURED HAM (BOSANSKI PRŠUT BY IMPLEMENTING HACCP SYSTEM

Directory of Open Access Journals (Sweden)

Almir Toroman

2013-08-01

Full Text Available As it is well known, traditional production of smoked meat products requires technological processes, which carry some food safety hazards (e.g. content of Benzo[a]pyrene. (B[a]P. “OMEGA COMERC Ltd.”, a member of the meat industry in Visoko region, has implemented food safety management system according to the recommendations from Codex Alimentarius CAC-RCP (9, recommended International Code of Practice - General Principles of Food Hygiene. By implementing HACCP system, the Company established adequate control measures in producing Bosnian dry cured ham (bosanski pršut on traditional way including the smoking process in the chambers. By doing this, they have created conditions to measure B[a]P content in the Bosnian dry cured ham and implement HACCP system without impairing traditional production and food safety of the final product.The aim of this study is to present the effect of the specific production process onto the meat smoking in order to preserve hygienic, nutritional and sensory values, and also to control B[a]P content in the final product.Key words: Bosnian dry cured ham, traditional production, smoking process, Benzo[a]pyrene, HACCP

Aerosol activation and cloud processing in the global aerosol-climate model ECHAM5-HAM

Directory of Open Access Journals (Sweden)

G. J. Roelofs

2006-01-01

Full Text Available A parameterization for cloud processing is presented that calculates activation of aerosol particles to cloud drops, cloud drop size, and pH-dependent aqueous phase sulfur chemistry. The parameterization is implemented in the global aerosol-climate model ECHAM5-HAM. The cloud processing parameterization uses updraft speed, temperature, and aerosol size and chemical parameters simulated by ECHAM5-HAM to estimate the maximum supersaturation at the cloud base, and subsequently the cloud drop number concentration (CDNC due to activation. In-cloud sulfate production occurs through oxidation of dissolved SO2 by ozone and hydrogen peroxide. The model simulates realistic distributions for annually averaged CDNC although it is underestimated especially in remote marine regions. On average, CDNC is dominated by cloud droplets growing on particles from the accumulation mode, with smaller contributions from the Aitken and coarse modes. The simulations indicate that in-cloud sulfate production is a potentially important source of accumulation mode sized cloud condensation nuclei, due to chemical growth of activated Aitken particles and to enhanced coalescence of processed particles. The strength of this source depends on the distribution of produced sulfate over the activated modes. This distribution is affected by uncertainties in many parameters that play a direct role in particle activation, such as the updraft velocity, the aerosol chemical composition and the organic solubility, and the simulated CDNC is found to be relatively sensitive to these uncertainties.

Cloud microphysics and aerosol indirect effects in the global climate model ECHAM5-HAM

Directory of Open Access Journals (Sweden)

U. Lohmann

2007-07-01

Full Text Available The double-moment cloud microphysics scheme from ECHAM4 that predicts both the mass mixing ratios and number concentrations of cloud droplets and ice crystals has been coupled to the size-resolved aerosol scheme ECHAM5-HAM. ECHAM5-HAM predicts the aerosol mass, number concentrations and mixing state. The simulated liquid, ice and total water content and the cloud droplet and ice crystal number concentrations as a function of temperature in stratiform mixed-phase clouds between 0 and −35° C agree much better with aircraft observations in the ECHAM5 simulations. ECHAM5 performs better because more realistic aerosol concentrations are available for cloud droplet nucleation and because the Bergeron-Findeisen process is parameterized as being more efficient.

The total anthropogenic aerosol effect includes the direct, semi-direct and indirect effects and is defined as the difference in the top-of-the-atmosphere net radiation between present-day and pre-industrial times. It amounts to −1.9 W m⁻² in ECHAM5, when a relative humidity dependent cloud cover scheme and aerosol emissions representative for the years 1750 and 2000 from the AeroCom emission inventory are used. The contribution of the cloud albedo effect amounts to −0.7 W m⁻². The total anthropogenic aerosol effect is larger when either a statistical cloud cover scheme or a different aerosol emission inventory are employed because the cloud lifetime effect increases.

Effect of meat ingredients (sodium nitrite and erythorbate) and processing (vacuum storage and packaging atmosphere) on germination and outgrowth of Clostridium perfringens spores in ham during abusive cooling.

Science.gov (United States)

Redondo-Solano, Mauricio; Valenzuela-Martinez, Carol; Cassada, David A; Snow, Daniel D; Juneja, Vijay K; Burson, Dennis E; Thippareddi, Harshavardhan

2013-09-01

The effect of nitrite and erythorbate on Clostridium perfringens spore germination and outgrowth in ham during abusive cooling (15 h) was evaluated. Ham was formulated with ground pork, NaNO2 (0, 50, 100, 150 or 200 ppm) and sodium erythorbate (0 or 547 ppm). Ten grams of meat (stored at 5 °C for 3 or 24 h after preparation) were transferred to a vacuum bag and inoculated with a three-strain C. perfringens spore cocktail to obtain an inoculum of ca. 2.5 log spores/g. The bags were vacuum-sealed, and the meat was heat treated (75 °C, 20 min) and cooled within 15 h from 54.4 to 7.2 °C. Residual nitrite was determined before and after heat treatment using ion chromatography with colorimetric detection. Cooling of ham (control) stored for 3 and 24 h, resulted in C. perfringens population increases of 1.46 and 4.20 log CFU/g, respectively. For samples that contained low NaNO2 concentrations and were stored for 3 h, C. perfringens populations of 5.22 and 2.83 log CFU/g were observed with or without sodium erythorbate, respectively. Residual nitrite was stable (p > 0.05) for both storage times. Meat processing ingredients (sodium nitrite and sodium erythorbate) and their concentrations, and storage time subsequent to preparation of meat (oxygen content) affect C. perfringens spore germination and outgrowth during abusive cooling of ham. Copyright © 2013 Elsevier Ltd. All rights reserved.

Evaluation of simulated aerosol properties with the aerosol-climate model ECHAM5-HAM using observations from the IMPACT field campaign

NARCIS (Netherlands)

Roelofs, G.-J.; Brink, H. ten; Kiendler-Scharr, A.; Leeuw, G. de; Mensah, A.; Minikin, A.; Otjes, R.

2010-01-01

In May 2008, the measurement campaign IMPACT for observation of atmospheric aerosol and cloud properties was conducted in Cabauw, The Netherlands. With a nudged version of the coupled aerosol-climate model ECHAM5-HAM we simulate the size distribution and chemical composition of the aerosol and the

Effects of high hydrostatic pressure and varying concentrations of sodium nitrite from traditional and vegetable-based sources on the growth of Listeria monocytogenes on ready-to-eat (RTE) sliced ham.

Science.gov (United States)

Myers, Kevin; Cannon, Jerry; Montoya, Damian; Dickson, James; Lonergan, Steven; Sebranek, Joseph

2013-05-01

The objective of this study was to determine the effect the source of added nitrite and high hydrostatic pressure (HHP) had on the growth of Listeria monocytogenes on ready-to-eat (RTE) sliced ham. Use of 600MPa HHP for 3min resulted in an immediate 3.9-4.3log CFU/g reduction in L. monocytogenes numbers, while use of 400MPa HHP (3min) provided less than 1log CFU/g reduction. With the 600MPa HHP treatment, sliced ham with a conventional concentration of sodium nitrite (200ppm) was not different in L. monocytogenes growth from use with 50 or 100ppm of sodium nitrite in pre-converted celery powder. Instrumental color values as well as residual nitrite and residual nitrate concentrations for cured (sodium nitrite and nitrite from celery powder) and uncured ham formulations are discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

Efeito do caseinato de sódio nas propriedades sensoriais do presunto "cook-in" Effect of sodium caseinate in the sensory properties of "cook-in" ham

Directory of Open Access Journals (Sweden)

Jicela Elsa Morales Udaeta

1995-01-01

Full Text Available Realizou-se o estudo do efeito das diferentes concentrações de caseinato de sódio nos atributos sensoriais do presento "cook-in". Em cada uma das quatro repetições, vinte presuntos foram designados ao acaso num dos cinco tratamentos, nos quais a formulação da salmoura de cura foi injetada a 20% em relação ao peso da carne em todos os tratamentos. A composição básica da salmoura correspondeu a 0,5% fosfato; 2,0% sal; 0,4% sais de cura; 0,66% condimento para presunto e 0,25% ascorbato, as condições de processamento foram as mesmas para todos os tratamentos, mas foram utilizados diferentes concentrações de caseinato de sódio em cada tratamento (0,0%; 0,5%; 1,0% e 1,5%. Foram retiradas amostras para medir o pH. Calculou-se as perdas no tambleamento e no cozimento e o rendimento. As propriedades sensoriais do presunto "cook-in" também foram avaliadas quanto a cor, aroma, coesividade, fatiamento, sabor e textura. O pH não apresentou efeito significativo, devido à salmoura ter sido ajustada para pH 9,0 para todos os tratamentos. Os presuntos com 1,0% caseinato de sódio apresentaram uma ótima aceitabilidade, mas apresentaram também a maior perda no cozimento. Os presuntos com 0,5% de caseinato de sódio apresentaram a menor perda no cozimento e uma razoável aceitabilidade das propriedades sensoriais.The effect of different concentrations of sodium caseinate in the sensory properties of "cook-in" ham was studied. In each of four replications, twenty ''cook-in" hams were randomly designed to one of five treatment groups in which the curing brine formulation was pumped 20% of their respectivo weights for all treatments. The basic brine composition was 0.5% phosphate; 2.0% salt; 0.4% curing salts; 0.66% ham condiment and 0.25% ascorbate, the processing conditions were the same for all treatments, but there was used different concentrations of sodium caseinate. (0.0%; 0.5%; 1.0% and 1.5%. Samples were removed for pH analysis. Tumbling

Laser-Scanner Survey of Structural Disorders: AN Instrument to Inspect the History of Parma Cathedral's Central Nave

Science.gov (United States)

Bruno, N.; Coïsson, E.; Cotti, M.

2017-05-01

This paper presents the use of laser scanner derived data for the study of the structural disorders in the central nave of the Parma Cathedral. An accurate three-dimensional model of the entire nave was realized to investigate deformations, in order to reconstruct the original conformation and the subsequent evolutions, also in comparison with previous surveys. Specifically, for the analysis presented in the paper, seven scans were performed, one for each bay: the results allowed to compare the deformations on the seven vaults, on the transverse and diagonal arches, giving first hints on the possible differences in the behaviour between the different elements. The measures on the levels of floor and pillars bases were analysed in a historical monitoring approach, in order to retrace the evolution of the differential settlements in time, since the construction of the building. Moreover, a structural analysis has been carried out on one transverse arch with distinct element analysis, with two different approaches. In one case, the structure was inserted exactly as surveyed, and then subjected to the actions. In the second case, the original geometry, before the deformation, was retraced through a parametric approach and the structural analysis basically started at the beginning of the building's life, thus trying to model not only the present structural situation, but also the path which led to the current deformation. The results were particularly meaningful as they showed that in the first case, disregarding the footsteps of history, the stress pattern inside the masonry was very different from the one obtained in the second case, which is more likely to represent the present conditions.

Verification of animal species in ham and salami by dna microarray and real time pcr methods

Directory of Open Access Journals (Sweden)

Zuzana Drdolová

2017-01-01

Full Text Available Consumer protection and detecting of adulteration is very important and has a wide societal impact in the economic sphere. Detection of animal species in meat products and the use of combining different methods is one of the means to achieve relevant product status. The aim of this study was to reveal whether or not the products label clearly meets the content declared by producer. In our study, 29 samples of meat products such as salami and ham obtained from stores and supermarkets in Slovakia were analyzed to detect the existing animal species according to the product label the use of Chipron LCD Array Analysis System, Meat 5.0. Products in which the presence of non-declared animal species has been detected were subjected to testing by the innuDETECT PCR Real-Time Kit, repeatedly. The results showed that 20 (68.96% samples were improperly labeled. From in total 14 tested ham samples 11 (78.57% products exhibited non-conformity with declared composition. Tested salami samples (15 revealed 9 (60% incorrectly labelled products. The results obtained by DNA Microarray and Real Time PCR methods were identical, and both methods should be extensively promoted for the detection of animal species in the meat and meat products. Normal 0 21 false false false EN-GB X-NONE X-NONE

Black carbon concentration and deposition estimations in Finland by the regional aerosol–climate model REMO-HAM

Directory of Open Access Journals (Sweden)

A. I. Hienola

2013-04-01

Full Text Available The prediction skill of the regional aerosol–climate model REMO-HAM was assessed against the black carbon (BC concentration measurements from five locations in Finland, with focus on Hyytiälä station for the year 2005. We examined to what extent the model is able to reproduce the measurements using several statistical tools: median comparison, overlap coefficient (OVL; the common area under two probability distributions curves and Z score (a measure of standard deviation, shape and spread of the distributions. The results of the statistics showed that the model is biased low. The local and regional emissions of BC have a significant contribution, and the model tendency to flatten the observed BC is most likely dominated by the lack of domestic burning of biofuel in the emission inventories. A further examination of the precipitation data from both measurements and model showed that there is no correlation between REMO's excessive precipitation and BC underestimation. This suggests that the excessive wet removal is not the main cause of the low black carbon concentration output. In addition, a comparison of wind directions in relation with high black carbon concentrations shows that REMO-HAM is able to predict the BC source directions relatively well. Cumulative black carbon deposition fluxes over Finland were estimated, including the deposition on snow.

POLITIK HUKUM PIDANA DALAM UPAYA PENGHAPUSAN KEKERASAN RUMAH TANGGA SEBAGAI WUJUD PENGAKUAN DAN PERLINDUNGAN HAM

Directory of Open Access Journals (Sweden)

Nadir Nadir

2013-09-01

Full Text Available Violence in household such as physical, psychological, sexualand economical violence is a form of criminal action happens inhousehold in which the doer and victim are from the samehousehold. The way of penal policy through the government insolution of violence in household is formed in norm codificationof positive law (positive wettelijk, by carrying out UU number 23of 2004 about abolition of violence in a household. Thisregulation is a form of government attention to human rights(HAM, and gender, non discrimination and the protection ofviolence victims in a household.

Essential oil composition of Cinnamomum bejolghota (Buch-Ham.) sweet : a secondary muga (Antheraea assama W/w) food plant from Assam, India

NARCIS (Netherlands)

Choudhury, S.N.; Ahmed, R.Z.; Barthel, A.; Leclercq, P.A.

1998-01-01

Cinnamomum bejolghota (Buch-Ham.) Sweet (formerly known as C. obtusi folium Roxb. ex Nees) is a secondary host plant for the muga silk worm (Antheraea assama Wlw). The leaves of this plant were collected from the Jorhat and Sibsagar districts in Assam, India, and hydrodistilled to extract the

Rain water runoff from porous building facades : implementation and application of a first-order runoff model coupled to a HAM model

NARCIS (Netherlands)

Brande, T. van den; Blocken, B.J.E.; Roels, S.

2013-01-01

Wind-driven rain (WDR) is one of the most important moisture sources for a building facade. Therefore, a reliable prediction of WDR loads is a prerequisite to assess the durability of building facade components. However, current state of the art Heat-Air-Moisture (HAM) models that are used to assess

Error detecting capabilities of the shortened Hamming codes adopted for error detection in IEEE Standard 802.3

Science.gov (United States)

Fujiwara, Toru; Kasami, Tadao; Lin, Shu

1989-09-01

The error-detecting capabilities of the shortened Hamming codes adopted for error detection in IEEE Standard 802.3 are investigated. These codes are also used for error detection in the data link layer of the Ethernet, a local area network. The weight distributions for various code lengths are calculated to obtain the probability of undetectable error and that of detectable error for a binary symmetric channel with bit-error rate between 0.00001 and 1/2.

Two phase modeling of nanofluid flow in existence of melting heat transfer by means of HAM

Science.gov (United States)

Sheikholeslami, M.; Jafaryar, M.; Bateni, K.; Ganji, D. D.

2018-02-01

In this article, Buongiorno Model is applied for investigation of nanofluid flow over a stretching plate in existence of magnetic field. Radiation and Melting heat transfer are taken into account. Homotopy analysis method (HAM) is selected to solve ODEs which are obtained from similarity transformation. Roles of Brownian motion, thermophoretic parameter, Hartmann number, porosity parameter, Melting parameter and Eckert number are presented graphically. Results indicate that nanofluid velocity and concentration enhance with rise of melting parameter. Nusselt number reduces with increase of porosity and melting parameters.

Characterization of French and Spanish dry-cured hams: influence of the volatiles from the muscles and the subcutaneous fat quantified by SPME-GC.

Science.gov (United States)

Sánchez-Peña, Carolina M; Luna, Guadalupe; García-González, Diego L; Aparicio, Ramón

2005-04-01

The influence of the volatile compounds on the characterization of Spanish and French dry-cured hams was studied. Thirty volatiles were quantified in each one of four locations (biceps femoris, semimembranosus and semitendinosus muscles and subcutaneous fat) of 29 dry-cured hams by solid-phase microextraction gas-chromatography (SPME-GC). The Brown-Forsythe univariate test allowed determination of the volatiles that individually could characterize (p0.95), then selected the most remarkable volatile compounds. Four compounds from the subcutaneous fat (methyl benzene and octanol) and the semitendinosus muscle (2-butanone and 2-octanone) allowed 100% correct classifications by geographic origin. On the other hand, only two compounds from the subcutaneous fat (octanol) and the biceps femoris muscle (3-methyl 1-butanol) correctly classified all the samples by the breed type. The ability of these variables to classify the samples was checked by the unsupervised procedure of principal components.

Analysis of the pressure response of high angle multiple (HAM) fractures intersecting a welbore; Kokeisha multi fracture (HAM) kosei ni okeru atsuryoku oto kaiseki ni tsuite

Energy Technology Data Exchange (ETDEWEB)

Ujo, S; Osato, K [Geothermal Energy Research and Development Co. Ltd., Tokyo (Japan); Arihara, N [Waseda University, Tokyo (Japan); Schroeder, R

1996-05-01

This paper reports pressure response analysis on wells piercing a high angle multi (HAM) fracture model. In this model which is defined on a three-dimensional space, a plurality of slanted fractures intersect with wells at high angles (however, intersection of fractures with each other is not considered). With respect to the pressure response analysis method using this model, the paper presents a basic differential equation on pressure drawdown and boundary conditions in the wells taking flows in the fractures pseudo-linear, as well as external boundary conditions in calculation regions (a reservoir spreads to an infinite distance, and its top and bottom are closed by non-water permeating beds). The paper also indicates that results of calculating a single vertical fracture model and a slanted fracture model by using a numerical computation program (MULFRAC) based on the above equations agree well respectively with the existing calculation results (calculations performed by Erlougher and Cinco et al). 5 refs., 6 figs.

Discrimination of Li-ion batteries based on Hamming network using discharging-charging voltage pattern recognition for improved state-of-charge estimation

Energy Technology Data Exchange (ETDEWEB)

Kim, Jonghoon; Lee, Seongjun; Cho, B.H. [Power Electronics System Laboratory, School of Electrical Engineering and Computer Science, Seoul National University, Seoul 151-744 (Korea, Republic of)

2011-02-15

Differences in electrochemical characteristics among Li-ion batteries and factors such as temperature and ageing result in erroneous state-of-charge (SoC) estimation when using the existing extended Kalman filter (EKF) algorithm. This study presents an application of the Hamming neural network to the identification of suitable battery model parameters for improved SoC estimation. The discharging-charging voltage (DCV) patterns of ten fresh Li-ion batteries are measured, together with the battery parameters, as representative patterns. Through statistical analysis, the Hamming network is applied for identification of the representative DCV pattern that matches most closely of the pattern of the arbitrary battery to be measured. Model parameters of the representative battery are then applied to estimate the SoC of the arbitrary battery using the EKF. This avoids the need for repeated parameter measurement. Using model parameters selected by the proposed method, all SoC estimates (off-line and on-line) based on the EKF are within {+-}5% of the values estimated by ampere-hour counting. (author)

Analisis Kelayakan Buku Ajar Al Islam dan Kemuhammadiyahan Berwawasan HAM Untuk SMA/MA/SMK Terbitan Maarif Intitute dan Majelis Dikdasmen Pimpinan Pusat Muhammadiyah (Tinjauan dari Segi Materi dan Metodologi Pembelajaran

Directory of Open Access Journals (Sweden)

Rio Estetika

2016-10-01

Full Text Available Buku Ajar Al-Islam dan Kemuhammadiyahan berwawasan HAM untuk SMA/MA/SMK merupakan salah satu bentuk upaya pendidikan agama di Muhammadiyah untuk mengembangkan buku teks pengajaran Al Islam dan Kemuhammadiyahan agar dapat lebih dinamis, up to date, kontekstual, dan mengakomodasi aspek-aspek sosio-kultural sebagai bentuk respon terhadap permasalahan kemanusiaan. Penelitian ini merupakan penelitian analisis isi dengan menggunakan dokumen sebagai objeknya. Dari hasil kesimpulan disarankan untuk menggunakan buku ajar tersebut sebagai penunjang buku pokok yang sudah diteritkan Majelis Dikdasemen dalam mengajarkan materi hak asasi manusia. Kemudian, dalam penyusunan buku AIK dapat mengadopsi konsep penyusunan buku AIK berwawasan HAM yang lebih up to date dan bervariasi dalam metode pembelajarannya.

Use of natural ingredients to control growth of Clostridium perfringens in naturally cured frankfurters and hams.

Science.gov (United States)

Jackson, Armitra L; Kulchaiyawat, Charlwit; Sullivan, Gary A; Sebranek, Joseph G; Dickson, James S

2011-03-01

A major concern for processed meats marketed as natural/organic is that they do not contain nitrite in concentrations known to be most effective for inhibiting foodborne pathogens. Supplemental treatments to increase the level and consistency of antimicrobial protection in these products may be important to provide consumers with the degree of safety that they have come to expect from conventionally cured meats. Therefore, the objective of this study was to identify and test ingredients that might improve processed meat product safety without altering their natural/organic status. Eight treatments of hams and frankfurters were prepared: (A) uncured control (typical ingredients except nitrite and nitrate); (B) conventionally cured control (erythorbate, nitrite, and a lactate-diacetate blend); (C) natural nitrate cure (including starter culture containing Staphylococcus carnosus); (D) natural nitrate cure (culture and natural antimicrobial A containing a vinegar, lemon, and cherry powder blend); (E) natural nitrate cure (culture and antimicrobial B containing a cultured sugar and vinegar blend); (F) natural nitrite cure without additional antimicrobials; (G) natural nitrite cure with natural antimicrobial A; and (H) natural nitrite cure with antimicrobial B. For the hams, treatments C, D, E, and H impacted growth of Clostridium perfringens to the same extent (P cured control (approximately 2 log less growth over time than uncured control). For frankfurters, treatments D, G, and H had an effect (approximately 1 log) on growth equivalent to that of the conventionally cured control (P cured meats have more potential for pathogen growth than conventionally cured products, but supplemental natural ingredients offer safety improvement.

Australian Modernists in London: William Dobell’s The Dead Landlord and Patrick White’s The Ham Funeral

Directory of Open Access Journals (Sweden)

Denise Varney

2016-09-01

Full Text Available When Patrick White was awarded the Nobel Prize for Literature in 1973, it was primarily for his novels. Less well recognised is the significance of White’s dramatic literature and his involvement in the theatre. This article offers a new analysis of White’s first notable breakthrough into theatre and drama, The Ham Funeral, which he wrote in postwar London and which was produced in Adelaide in 1961. This article argues that a modernist idiom of 20th-century Australian drama can be found in this play that laid the groundwork for a poetics of language, image and theatricality. The play’s aesthetic modernism is found primarily in the blend of expressionist and surrealist elements, the poetic language, the alienated creative subject and the representation of sexuality and the unconscious. White’s thematics also become political, concerned with power, masculinity and gendered assumptions about rationality and emotion, poetry and the body. Having lived in London during the interwar years, White was also part of the networks that included Australian-born artists, and he was exposed to influences from visual arts as well as theatre. Of these, the artist William Dobell was central to the genesis of The Ham Funeral, as was the Polish-born modernist artist S. Ostoja-Kotkowski, who was critical to the design of the brooding expressionist set that set the standard for subsequent stage realisations of the play.

Simulations of linear and Hamming codes using SageMath

Science.gov (United States)

Timur, Tahta D.; Adzkiya, Dieky; Soleha

2018-03-01

Digital data transmission over a noisy channel could distort the message being transmitted. The goal of coding theory is to ensure data integrity, that is, to find out if and where this noise has distorted the message and what the original message was. Data transmission consists of three stages: encoding, transmission, and decoding. Linear and Hamming codes are codes that we discussed in this work, where encoding algorithms are parity check and generator matrix, and decoding algorithms are nearest neighbor and syndrome. We aim to show that we can simulate these processes using SageMath software, which has built-in class of coding theory in general and linear codes in particular. First we consider the message as a binary vector of size k. This message then will be encoded to a vector with size n using given algorithms. And then a noisy channel with particular value of error probability will be created where the transmission will took place. The last task would be decoding, which will correct and revert the received message back to the original message whenever possible, that is, if the number of error occurred is smaller or equal to the correcting radius of the code. In this paper we will use two types of data for simulations, namely vector and text data.

Accuracy of near infrared spectroscopy for prediction of chemical composition, salt content and free amino acids in dry-cured ham.

Science.gov (United States)

Prevolnik, Maja; Škrlep, Martin; Janeš, Lucija; Velikonja-Bolta, Spela; Škorjanc, Dejan; Čandek-Potokar, Marjeta

2011-06-01

The capability of near infrared (NIR) spectroscopy was examined for the purposes of quality control of the traditional Slovenian dry-cured ham "Kraški pršut." Predictive models were developed for moisture, salt, protein, non-protein nitrogen, intramuscular fat and free amino acids in biceps femoris muscle (n = 135). The models' quality was assessed using statistical parameters: coefficient of determination (R(2)) and standard error (se) of cross-validation (CV) and external validation (EV). Residual predictive deviation (RPD) was also assessed. Best results were obtained for salt content and salt percentage in moisture/dry matter (R(CV)(2)>0.90, RPD>3.0), it was satisfactory for moisture, non-protein nitrogen, intramuscular fat and total free amino acids (R(CV)(2) = 0.75-0.90, RPD = 2.0-3.0), while not so for protein content and proteolysis index (R(CV)(2) = 0.65-0.75, RPD<2.0). Calibrations for individual free amino acids yielded R(CV)(2) from 0.40 to 0.90 and RPD from 1.3 to 2.9. Additional external validation of models on independent samples yielded comparable results. Based on the results, NIR spectroscopy can replace chemical methods in quality control of dry-cured ham. Copyright © 2011 Elsevier Ltd. All rights reserved.

Inactivation kinetics of Escherichia coli O157:H7, Salmonella enterica Serovar Typhimurium, and Listeria monocytogenes in ready-to-eat sliced ham by near-infrared heating at different radiation intensities.

Science.gov (United States)

Ha, Jae-Won; Kang, Dong-Hyun

2014-07-01

The aim of this study was to investigate the inactivation kinetics of Salmonella enterica serovar Typhimurium, Escherichia coli O157:H7, and Listeria monocytogenes on ready-to-eat sliced ham by near-infrared (NIR) heating as a function of the processing parameter, radiation intensity. Precooked ham slices inoculated with the three pathogens were treated at different NIR intensities (ca. 100, 150, and 200 μW/cm(2)/nm). An increase in the applied radiation intensity resulted in a gradual increase of inactivation of all pathogens. The survival curves of the three pathogens exhibited both shoulder and tailing behavior at all light intensities. Among nonlinear models, the Weibull distribution and log-logistic model were used to describe the experimental data, and the statistical results (mean square error and R(2) values) indicated the suitability of the model for prediction. The log-logistic model more accurately described survival curves of the three pathogens than did the Weibull distribution at all radiation intensities. The output of this study and the proposed kinetics model would be beneficial to the deli meat industry for selecting the optimum processing conditions of NIR heating to meet the target pathogen inactivation on ready-to-eat sliced ham.

28 August 2013 - Director of Technical Quality Management Head of ESTEC Establishment European Space Agency F. Ongaro visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and Technology Department J.-P. Tock; visiting the ATLAS experimental area with ATLAS Deputy Spokesperson T. Wengler and signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by F. Bordry and V. Parma.

CERN Multimedia

Jean-Claude Gadmer

2013-01-01

28 August 2013 - Director of Technical Quality Management Head of ESTEC Establishment European Space Agency F. Ongaro visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and Technology Department J.-P. Tock; visiting the ATLAS experimental area with ATLAS Deputy Spokesperson T. Wengler and signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by F. Bordry and V. Parma.

Laser-light backscattering response to water content and proteolysis in dry-cured ham

DEFF Research Database (Denmark)

Fulladosa, E.; Rubio-Celorio, M.; Skytte, Jacob Lercke

2017-01-01

on the acquisition conditions used. Laser backscattering was influenced by both dryness and proteolysis intensity showing an average light intensity decrease of 0.2 when decreasing water content (1% weight loss) and increasing proteolysis (equivalent to one-hour enzyme action). However, a decrease of scattering area...... was only detected when the water content was decreased (618 mm(2) per 1% weight loss). Changes on scattering of light profiles were only observed when the water content changed. Although there is a good correlation between water content and LBI parameters when analysing commercial samples, proteolysis...... of laser incidence) and to analyse the laser-light backscattering changes caused by additional hot air drying and proteolysis of dry-cured ham slices. The feasibility of the technology to determine water content and proteolysis (which is related to textural characteristics) of commercial sliced dry...

JCSC_128_6_913_920_SI_a.doc

Indian Academy of Sciences (India)

bDepartment of Chemistry, Jalpaiguri Government Engineering College, Jalpaiguri, West Bengal, 735 102 India. cUniversità, degli Studi di Parma, ... Electronic absorption spectrum of the complex (conconcentration = 5.0 x 10-5 M, path length = 1.0 cm) in acetonitrile (inset shows d-d transition.) 3. Figure S5. PXRD pattern of ...

Tools for studying dry-cured ham processing by using computed tomography.

Science.gov (United States)

Santos-Garcés, Eva; Muñoz, Israel; Gou, Pere; Sala, Xavier; Fulladosa, Elena

2012-01-11

An accurate knowledge and optimization of dry-cured ham elaboration processes could help to reduce operating costs and maximize product quality. The development of nondestructive tools to characterize chemical parameters such as salt and water contents and a(w) during processing is of special interest. In this paper, predictive models for salt content (R(2) = 0.960 and RMSECV = 0.393), water content (R(2) = 0.912 and RMSECV = 1.751), and a(w) (R(2) = 0.906 and RMSECV = 0.008), which comprise the whole elaboration process, were developed. These predictive models were used to develop analytical tools such as distribution diagrams, line profiles, and regions of interest (ROIs) from the acquired computed tomography (CT) scans. These CT analytical tools provided quantitative information on salt, water, and a(w) in terms of content but also distribution throughout the process. The information obtained was applied to two industrial case studies. The main drawback of the predictive models and CT analytical tools is the disturbance that fat produces in water content and a(w) predictions.

Estimating the direct and indirect effects of secondary organic aerosols using ECHAM5-HAM

Directory of Open Access Journals (Sweden)

D. O'Donnell

2011-08-01

Full Text Available Secondary organic aerosol (SOA has been introduced into the global climate-aerosol model ECHAM5/HAM. The SOA module handles aerosols originating from both biogenic and anthropogenic sources. The model simulates the emission of precursor gases, their chemical conversion into condensable gases, the partitioning of semi-volatile condenable species into the gas and aerosol phases. As ECHAM5/HAM is a size-resolved model, a new method that permits the calculation of partitioning of semi-volatile species between different size classes is introduced. We compare results of modelled organic aerosol concentrations against measurements from extensive measurement networks in Europe and the United States, running the model with and without SOA. We also compare modelled aerosol optical depth against measurements from the AERONET network of grond stations. We find that SOA improves agreement between model and measurements in both organic aerosol mass and aerosol optical depth, but does not fully correct the low bias that is present in the model for both of these quantities. Although many models now include SOA, any overall estimate of the direct and indirect effects of these aerosols is still lacking. This paper makes a first step in that direction. The model is applied to estimate the direct and indirect effects of SOA under simulated year 2000 conditions. The modelled SOA spatial distribution indicates that SOA is likely to be an important source of free and upper tropospheric aerosol. We find a negative shortwave (SW forcing from the direct effect, amounting to −0.31 Wm⁻² on the global annual mean. In contrast, the model indicates a positive indirect effect of SOA of +0.23 Wm⁻², arising from the enlargement of particles due to condensation of SOA, together with an enhanced coagulation sink of small particles. In the longwave, model results are a direct effect of +0.02 Wm⁻² and an indirect effect of −0.03 Wm⁻²

Is designation of origin an important cue driving consumer loyalty behaviour? Evidence from scanner data on dry-cured ham

DEFF Research Database (Denmark)

Chrysochou, Polymeros; Giraud, Georges

2007-01-01

Reference to origin and region has become a factor of differentiation and added value for food product companies. Although previous studies argue that designation of origin can be considered as an extrinsic cue affecting consumer preferences, the main concern which still exists is whether...... designation of origin influences their actual purchase behaviour and, moreover, behavioural loyalty towards them. For measuring loyalty we applied the Dirichlet model on scanner supermarket data on dry-cured ham, a common local French food product. Results show that designation of origin...

Effects of the applications of oil drip onto surface and of the use of a temperature of 35°C for 4 days on some physicochemical, microbiological and sensory characteristics of dry-cured ham.

Science.gov (United States)

Sánchez-Molinero, F; Arnau, J

2014-10-01

The effects of: a) applications of oil drip (from aged salted pork fat) onto dry-cured ham surface and b) application of a temperature of 35°C for 4days after 234days of processing (HTST treatment) were evaluated. The oil application reduced moisture, proteolysis and white film in semimembranosus, microbial counts in adductor and the intensity of hollow extent, toasted flavour, adhesiveness, pastiness (in semimembranosus) and chewiness (in semimembranosus and biceps femoris) and increased the intensity of nutty flavour (in both muscles), aged flavour, hardness, fibrousness and overall liking (in semimembranosus). The HTST did not affect any ham characteristics. Copyright © 2014 Elsevier Ltd. All rights reserved.

Optimization of supercritical carbon dioxide treatment for the inactivation of the natural microbial flora in cubed cooked ham.

Science.gov (United States)

Ferrentino, Giovanna; Balzan, Sara; Spilimbergo, Sara

2013-02-15

This study aims to investigate the effects of supercritical carbon dioxide (SC-CO₂) treatment on the inactivation of the natural microbial flora in cubed cooked ham. Response surface methodology with a central composite design was applied to determine the optimal process conditions and investigate the effect of three independent variables (pressure, temperature and treatment time). Additionally, analyses of texture, pH and color together with a storage study of the product were performed to determine its microbial and qualitative stability. Response surface analysis revealed that 12 MPa, 50 °C, 5 min were the optimal conditions to obtain about 3.0, 1.6, and 2.5 Log(CFU/g) reductions of mesophilic aerobic bacteria, psychrophilic bacteria and lactic acid bacteria respectively. Inactivation to undetectable levels of yeasts and molds and coliforms was also obtained. A storage study of 30 days at 4 °C was carried out on the treated product (12 MPa, 50 °C, 5 min) monitoring microbial growth, pH, texture, and color parameters (L*, a*, b* and ΔE). Microbial loads slightly increased and after 30 days of storage reached the same levels detected in the fresh product. Color parameters (L*, a*, b*) showed slight variations while pH and texture did not change significantly. On the basis of the results obtained, SC-CO₂ can be considered a promising technique to microbiologically stabilize cubed cooked ham and, in general, cut/sliced meat products without affecting its quality attributes. Copyright © 2012 Elsevier B.V. All rights reserved.

Development of an integrated model for heat transfer and dynamic growth of Clostridium perfringens during the cooling of cooked boneless ham.

Science.gov (United States)

Amézquita, A; Weller, C L; Wang, L; Thippareddi, H; Burson, D E

2005-05-25

Numerous small meat processors in the United States have difficulties complying with the stabilization performance standards for preventing growth of Clostridium perfringens by 1 log10 cycle during cooling of ready-to-eat (RTE) products. These standards were established by the Food Safety and Inspection Service (FSIS) of the US Department of Agriculture in 1999. In recent years, several attempts have been made to develop predictive models for growth of C. perfringens within the range of cooling temperatures included in the FSIS standards. Those studies mainly focused on microbiological aspects, using hypothesized cooling rates. Conversely, studies dealing with heat transfer models to predict cooling rates in meat products do not address microbial growth. Integration of heat transfer relationships with C. perfringens growth relationships during cooling of meat products has been very limited. Therefore, a computer simulation scheme was developed to analyze heat transfer phenomena and temperature-dependent C. perfringens growth during cooling of cooked boneless cured ham. The temperature history of ham was predicted using a finite element heat diffusion model. Validation of heat transfer predictions used experimental data collected in commercial meat-processing facilities. For C. perfringens growth, a dynamic model was developed using Baranyi's nonautonomous differential equation. The bacterium's growth model was integrated into the computer program using predicted temperature histories as input values. For cooling cooked hams from 66.6 degrees C to 4.4 degrees C using forced air, the maximum deviation between predicted and experimental core temperature data was 2.54 degrees C. Predicted C. perfringens growth curves obtained from dynamic modeling showed good agreement with validated results for three different cooling scenarios. Mean absolute values of relative errors were below 6%, and deviations between predicted and experimental cell counts were within 0.37 log10

MEMBANGUN SISTEM HUKUM PANCASILA YANG MERDEKA DARI KORUPSI DAN MENJUNJUNG HAM

Directory of Open Access Journals (Sweden)

Teguh Prasetyo

2014-04-01

Sebagai negara yang sudah merdeka selama 68 tahun, Indonesia seharusnya sudah mempunyai sistem hukumnya sendiri yang sesuai dengan kepribadian bangsa Indonesia. Sistem hukum Indonesia tersebut harus dibangun berdasarkan Pancasila yang menampilkan karakteristik ke-Indonesia-an di tengah-tengah sistem hukum lain di dunia. Sistem hukum Pancasila merupakan suatu sistem hukum yang bermoral dan bermartabat. Bermoral berarti bahwa sistem hukum di Indonesia sistem hukum yang merdeka dari korupsi. Sedangkan sistem hukum yang bermartabat adalah sistem hukum yang menjunjung nilai-nilai kemanusiaan terutama di bidang HAM. Abstract Having been independent for 68 years, Indonesia should have had its own legal system that suits the character of the Indonesian nation. Indonesias legal system have to be constructed based on Pancasila which reflects all the characteristics of Indonesia particularity in the midst of other legal systems in the world. The legal system based on Pancasila is a legal system that emphasizes moral and human dignity. Legal morality means that the legal system in Indonesia is free from corruption. While the legal system with dignity is a legal system that upholds the values of humanity, especially in the field of human rights.

Influence of cooking process on protein fractions in cooked ham and mortadella

Directory of Open Access Journals (Sweden)

G. Vonghia

2011-03-01

Full Text Available The mortadella is a pork meat sausage (in natural or artificial bowel accurately triturated and mixed with little backfat cubes, salt, sodium nitrate and nitrite, spices and peppercorns, and then cooked in oven for many hours. The cooked ham is obtained from an anatomically completed piece of meat; the working process provides the addiction of salt and spices, the brine, the bones removal, the churning and the pressing, so the cured meat is first packed in a mould provided for this purpose, then cooked and after cooled and packed. The meat cooking is the last step in the cooked sausage production technology, and let us obtain a stable and eatable product. The effect of the heat and the lenght of processing are the main responsibles for modifications in water- and salt-soluble protein fractions. Indeed myofibrils denature themselves after cooking and consequently their solubility decreases; particularly the denaturation begins over 30°C in the myosin chain, instead the actin solubility begins to decrease over 60°C, being the actin more stable than myosin (Barbieri et al., 1997...

Genetic variation of loin and ham quality in Finnish Landrace and Large White pigs

Directory of Open Access Journals (Sweden)

M-L. SEVÓN-AIMONEN

2008-12-01

Full Text Available Selection potential for meat quality of economically important loin (longissimus and ham muscles (adductor, semimembranosus, biceps femoris has been assessed. Ultimate pH (pHu, meat colour (lightness, redness and yellowness, drip loss and two visually scored colour traits were recorded from 483 Finnish Landrace and 494 Finnish Large White station test pigs in a half-sib design. A univariate restricted maximum likelihood procedure was used to estimate variance components. The statistical model contained age at beginning of test, sex and time lapse from slaughter to dissection as fixed effects and slaughter batch, common environment of littermates and additive genetic effect of the animal as random effects. The average pHu values in adductor and semispinalis were between 5.6 and 6.1. The pHu were on average 5.4 and 5.5 in longissimus and semimembranosus respectively, with the latter two being lower than optimum values of 5.6 to 5.9. Lightness for semimembranosus turned to be clearly lighter (62 than for other muscles. Lightness for longissimus (56 was slightly lighter than optimum (from 48 to 54. The heritability varied from zero to 0.45 for pHu, from 0.02 to 0.34 for lightness, from 0.17 to 0.56 for redness, from zero to 0.28 for yellowness and from 0.05 to 0.16 for drip loss. Heritability for redness values was considerably higher than heritability for other meat quality traits. The heritability of quality traits spoke for possibilities for genetic improvement of meat quality. Genetic correlations between quality traits (pHu and lightness and average daily gain varied strongly among breeds and muscles. Genetic correlations between meat-% and pHu were in most cases high and unfavourable (rg from –0.36 to –0.68 except in longissimus, where it was 0.11. Genetic correlations between meat-% and lightness were unfavourable in Finnish Large White (from 0.47 to 0.92 but in Finnish Landrace estimates varied among muscles (from –0.40 to 0.47. Due to

A new Nawaz-Enscore-Ham-based heuristic for permutation flow-shop problems with bicriteria of makespan and machine idle time

Science.gov (United States)

Liu, Weibo; Jin, Yan; Price, Mark

2016-10-01

A new heuristic based on the Nawaz-Enscore-Ham algorithm is proposed in this article for solving a permutation flow-shop scheduling problem. A new priority rule is proposed by accounting for the average, mean absolute deviation, skewness and kurtosis, in order to fully describe the distribution style of processing times. A new tie-breaking rule is also introduced for achieving effective job insertion with the objective of minimizing both makespan and machine idle time. Statistical tests illustrate better solution quality of the proposed algorithm compared to existing benchmark heuristics.

Defective human T-cell lymphotropic virus type I (HTLV-I) provirus in seronegative tropical spastic paraparesis/HTLV-I-associated myelopathy (TSP/HAM) patients.

Science.gov (United States)

Ramirez, E; Fernandez, J; Cartier, L; Villota, C; Rios, M

2003-02-01

Infection with human T-cell lymphotropic virus type I (HTLV-I) have been associated with the development of the tropical spastic paraparesis/HTLV-I-associated myelopathy (TSP/HAM). We studied the presence of HTLV-I provirus in peripheral blood mononuclear cells (PBMC) from 72 Chilean patients with progressive spastic paraparesis by polymerase chain reaction: 32 seropositive and 40 seronegative cases. We amplified different genomic regions of HTLV-I using primers of 5' ltr, tax, env/tax, pX, pol and env genes. These genes were detected from all seropositive patients. The seronegative patients were negative with 5' ltr, pol, env, and pX primers. However, amplified product of tax and env/tax genes was detected from 16 and four seronegative patients, respectively. Three of them were positive with both genetic regions. The results of this study show that the complete HTLV-I provirus is found in 100% of seropositive cases. In seronegative cases, clinically very similar of seropositive cases, was found only tax gene in 42.5% (17/40) of patients. These results suggest the presence of a defective HTLV-I provirus in some seronegative patients with progressive spastic paraparesis, and suggest a pathogenic role of this truncate provirus for a group of TSP/HAM.

A tentative characterization of volatile compounds from Iberian Dry-Cured Ham according to different anatomical locations. A detailed study

Directory of Open Access Journals (Sweden)

Narváez-Rivas, Mónica

2010-12-01

Full Text Available The aim of this work was to carry out a characterization of the volatile fraction of 23 Iberian dry-cured hams by GC-iontrap- MS. Two different locations –subcutaneous fat and musclefrom the slices taken parallel to the femur from each ham were analyzed. The analyses were done by Gas Chromatography- Mass Spectrometry with a polar capillary column and after a previous extraction using the Purge and Trap method. A total of 109 volatile compounds were identified, twenty-eight of which for the first time in Iberian dry-cured ham (isopropanol, 4-methyl-5-decanol, 2-butyl-1-octanol, 2-etoxy-ethanol, 2-ethyl-phenol, 2-hexen-1-ol, 3,5-octadien-2-ol, 2-decen- 1-ol, 5-ethylcyclopent-1-enecarboxaldehyde, 2,4-heptadienal, 6-nonenal, cyclopentanone, 3-ethenyl-cyclohexanone, 2-methyl-cyclopentanone, 6-octen-2-one, 5-methyl-2-(1-methylethyl- cyclopentanone, 3,5-octadien-2-one, 2-hydroxymethyl- 2,3,3-trimethyl-oxirane, 2-ethyl-hexyl 2-propenoate, 1-methoxypentane, 2,3-dihydrofurane, 2-D-2-pentadecyl-1,3-dioxolane, hexyl octyl eter, eucalyptol, di-(3-methyl-buthyl eter, piperidine, isopropylamine and 2-ethenyl-pyridine.

El objetivo de este trabajo fue llevar a cabo una caracterización de la fracción volátil de 23 jamones curados de cerdo ibérico mediante GC-ion-trap-MS. Se analizaron dos zonas diferentes de las lonchas tomadas paralelas al fémur de cada jamón, Grasa subcutánea y magro. El análisis se realizó mediante cromatografía gaseosa en columna capilar de alta polaridad con detección de espectrometría de masas y extracción previa de la fracción volátil mediante purga y trampa. Un total de 109 compuestos volátiles fueron identificados, veintiocho de ellos descritos por primera vez en Jamón ibérico curado (isopropanol, 4-methyl-5-decanol, 2-butyl-1-octanol, 2-etoxy-ethanol, 2-ethyl-phenol, 2-hexen-1-ol, 3,5-octadien-2- ol, 2-decen-1-ol, 5-ethylcyclopent-1-enecarboxaldehyde, 2,4-heptadienal, 6-nonenal, cyclopentanone, 3-ethenyl

Ham Petrol Fiyat Artışlarının Enflasyonist Etkisi: Seçilmiş OECD Ülkeleri İçin Yapısal Kırılmalı Dinamik Panel Veri Analizi

Directory of Open Access Journals (Sweden)

Mehmet MERCAN

2015-11-01

Full Text Available Bu çalışmada; petrol ithalatçısı olan OECD üyesi seçilmiş 15 ülke için, 1960-2011 döneminde ham petrol ithal fiyatlarının enflasyon üzerindeki etkileri incelenmiştir. Analizde, herhangi bir ülkede meydana gelen bir makroekonomik şokun diğer ülkeleri de etkileyeceği varsayımını yani yatay kesit bağımlılığını dikkate alan panel birim kök ve eşbütünleşme testleri uygulanmış, seriler arasında eşbütünleşme ilişkisinin varlığı tespit edilmiştir. Uzun Dönem Eşbütünleşme Katsayıları Tahmin sonuçlarına göre ham petrol ithal fiyat artışları ve ekonomik büyümenin enflasyonu arttırdığı, ekonomik büyümenin enflasyonist etkisinin, ham petrol ithal fiyatlarının etkisinden daha fazla olduğu bulgusuna ulaşılmıştır.

Effects of a soybean-free diet supplied to Italian heavy pigs on fattening performance, and meat and dry-cured ham quality

OpenAIRE

Luca Sardi; Giuliano Zaghini; Giorgio Vignola; Eleonora Nannoni; Nico Brogna; Giovanna Martelli; Attilio L. Mordenti

2012-01-01

The aim of this study was to investigate the effects of a diet containing non-conventional (i.e. alternative to soybean meal) vegetable protein sources on fattening performance, and meat and dry-cured ham quality of heavy pigs. Fifty-six (Landrace x Large White) castrated males with an initial average body weight of 50 kg were allocated to two experimental groups: a control group in which pigs received a traditional soybean meal-based diet, and a treatment group in which soybean meal was repl...

Effects of varying levels of vegetable juice powder and incubation time on color, residual nitrate and nitrite, pigment, pH, and trained sensory attributes of ready-to-eat uncured ham.

Science.gov (United States)

Sindelar, J J; Cordray, J C; Sebranek, J G; Love, J A; Ahn, D U

2007-08-01

Vegetable juice powder (VJP) and a starter culture containing Staphylococcus carnosus have been identified as necessary ingredients for the manufacture of uncured, no-nitrate/nitrite-added meat products with quality and sensory attributes similar to traditional cured products. The objectives of this study were to determine the effects of varying concentrations of VJP and incubation time (MIN-HOLD) on quality characteristics, including lipid oxidation, color, and cured meat pigment concentrations, of ham over a 90-d storage period, compare residual nitrate and nitrite content, and determine if differences exist in sensory properties of finished products. Four ham treatments (TRT) (TRT 1: 0.20% VJP, 0 MIN-HOLD; TRT 2: 0.20% VJP, 120 MIN-HOLD; TRT 3: 0.35% VJP, 0 MIN-HOLD; TRT 4: 0.35% VJP, 120 MIN-HOLD) and a sodium nitrite-added control (C) were used for this study. No differences (P > 0.05) were observed between TRTs and C for CIE L*, a*, b*, and cured color measured by reflectance ratio. Lipid oxidation (TBARS) for combined TRTs and C revealed little change over time while the C had less (P 0.05) were reported for cured pigment concentration between TRTs and C. Trained sensory panel intensity ratings for ham and vegetable aroma, and flavor, color, and firmness showed that a high concentration (0.35%) of VJP resulted in the highest scores for undesirable vegetable aroma and flavor. Treatment combinations with a low concentration (0.20%) of VJP were comparable to the C for all sensory attributes.

Global anthropogenic aerosol effects on convective clouds in ECHAM5-HAM

Directory of Open Access Journals (Sweden)

U. Lohmann

2008-04-01

Full Text Available Aerosols affect the climate system by changing cloud characteristics in many ways. They act as cloud condensation and ice nuclei and may have an influence on the hydrological cycle. Here we investigate aerosol effects on convective clouds by extending the double-moment cloud microphysics scheme developed for stratiform clouds, which is coupled to the HAM double-moment aerosol scheme, to convective clouds in the ECHAM5 general circulation model. This enables us to investigate whether more, and smaller cloud droplets suppress the warm rain formation in the lower parts of convective clouds and thus release more latent heat upon freezing, which would then result in more vigorous convection and more precipitation. In ECHAM5, including aerosol effects in large-scale and convective clouds (simulation ECHAM5-conv reduces the sensitivity of the liquid water path increase with increasing aerosol optical depth in better agreement with observations and large-eddy simulation studies. In simulation ECHAM5-conv with increases in greenhouse gas and aerosol emissions since pre-industrial times, the geographical distribution of the changes in precipitation better matches the observed increase in precipitation than neglecting microphysics in convective clouds. In this simulation the convective precipitation increases the most suggesting that the convection has indeed become more vigorous.

Constitutive Relation of Engineering Material Based on SIR Model and HAM

Directory of Open Access Journals (Sweden)

Haoxiang He

2014-01-01

Full Text Available As an epidemic mathematical model, the SIR model represents the transition of the Susceptible, Infected, and Recovered. The profound implication of the SIR model is viewed as the propagation and dynamic evolutionary process of the different internal components and the characteristics in a complex system subject to external effect. The uniaxial stress-strain curve of engineering material represents the basic constitutive relation, which also represents the damage propagation in the units of the damaged member. Hence, a novel dynamic stress-strain model is established based on the SIR model. The analytical solution and the approximate solution for the proposed model are represented according to the homotopy analysis method (HAM, and the relationship of the solution and the size effect and the strain rate is discussed. In addition, an experiment on the size effect of confined concrete is carried out and the solution of SIR model is suitable for simulation. The results show that the mechanical mechanism of the parameters of the uniaxial stress-strain model proposed in this paper reflects the actual characteristics of the materials. The solution of the SIR model can fully and accurately show the change of the mechanical performance and the influence of the size effect and the strain rate.

Analysis of volatile compounds from Iberian hams: a review

Directory of Open Access Journals (Sweden)

Narváez-Rivas, M.

2012-10-01

Full Text Available This article provides information on the study of the volatile compounds in raw and dry-cured Iberian hams. Different volatile compounds are identified and studies carried out by different authors are presented. This article reviews the analytical methods that have been used to determine the different volatiles of these samples. Furthermore, all volatile compounds identified (a total of 411 volatiles have been collected in several tables according to different series of compounds: hydrocarbons, aldehydes, ketones, alcohols, esters and ethers, lactones, terpenes and chloride compounds, nitrogenous compounds, sulfur compounds and carboxylic acids. This review can be useful in subsequent research due to the complexity of the study.

En este artículo se proporciona información sobre el estudio de los compuestos volátiles del jamón ibérico tanto fresco como curado. Se presentan los diferentes compuestos volátiles identificados por distintos autores. Además, se evalúan los métodos analíticos que han sido utilizados para determinar dichos compuestos volátiles en este tipo de muestras. Todos los compuestos identificados y descritos en esta revisión (un total de 411 compuestos volátiles han sido agrupados en diversas tablas de acuerdo a las diferentes familias a que pertenecen: hidrocarburos, aldehídos, cetonas, alcoholes, ésteres y éteres, lactonas, terpenos, compuestos halogenados, compuestos nitrogenados, compuestos de azufre y ácidos carboxílicos. Debido a la complejidad de este estudio, la presente revisión puede ser muy útil en investigaciones posteriores.

Hierarchical Adaptive Means (HAM) clustering for hardware-efficient, unsupervised and real-time spike sorting.

Science.gov (United States)

Paraskevopoulou, Sivylla E; Wu, Di; Eftekhar, Amir; Constandinou, Timothy G

2014-09-30

This work presents a novel unsupervised algorithm for real-time adaptive clustering of neural spike data (spike sorting). The proposed Hierarchical Adaptive Means (HAM) clustering method combines centroid-based clustering with hierarchical cluster connectivity to classify incoming spikes using groups of clusters. It is described how the proposed method can adaptively track the incoming spike data without requiring any past history, iteration or training and autonomously determines the number of spike classes. Its performance (classification accuracy) has been tested using multiple datasets (both simulated and recorded) achieving a near-identical accuracy compared to k-means (using 10-iterations and provided with the number of spike classes). Also, its robustness in applying to different feature extraction methods has been demonstrated by achieving classification accuracies above 80% across multiple datasets. Last but crucially, its low complexity, that has been quantified through both memory and computation requirements makes this method hugely attractive for future hardware implementation. Copyright © 2014 Elsevier B.V. All rights reserved.

Evaluation of near-infrared pasteurization in controlling Escherichia coli O157:H7, Salmonella enterica serovar typhimurium, and Listeria monocytogenes in ready-to-eat sliced ham.

Science.gov (United States)

Ha, Jae-Won; Ryu, Sang-Ryeol; Kang, Dong-Hyun

2012-09-01

This study was conducted to investigate the efficacy of near-infrared (NIR) heating to reduce Salmonella enterica serovar Typhimurium, Escherichia coli O157:H7, and Listeria monocytogenes in ready-to-eat (RTE) sliced ham compared to conventional convective heating, and the effect of NIR heating on quality was determined by measuring the color and texture change. A cocktail of three pathogens was inoculated on the exposed or protected surfaces of ham slices, followed by NIR or conventional heating at 1.8 kW. NIR heating for 50 s achieved 4.1-, 4.19-, and 3.38-log reductions in surface-inoculated S. Typhimurium, E. coli O157:H7, and L. monocytogenes, respectively, whereas convective heating needed 180 s to attain comparable reductions for each pathogen. There were no statistically significant (P > 0.05) differences in reduction between surface- and internally inoculated pathogens at the end of NIR treatment (50 s). However, when treated with conventional convective heating, significant (P 0.05) different from those of nontreated samples. These results suggest that NIR heating can be applied to control internalized pathogens as well as surface-adhering pathogens in RTE sliced meats without affecting product quality.

Evaluation of electron beam irradiation for disinfection of turmeric fingers

Energy Technology Data Exchange (ETDEWEB)

Yasumoto, Kyoden; Fujino, Masayuki; Supriyadi (Kyoto Univ., Uji (Japan). Research Inst. for Food Science); Suzuki, Tetsuya; Hayashi, Toru

1991-08-01

Turmeric finger as one of the most popular spices has been widely used for food manufacturing. However, it has also been a major cause of bacterial infestation of food materials especially in curry, ham and sausage manufacturing. In this study decontamination of bacteria in turmeric finger by electron beam irradiation was evaluated by comparing with several other decontamination methods: i.e., boiling, microwave irradiation, treatment by twin screw extruder and gamma-ray irradiation. By estimation of colony counting on nutrient agar plate, turmeric finger without any treatment gave total viable cell at 10{sup 8}/g. Turmeric finger which was irradiated by electron beam at 10 kGy dose dramatically reduced thermotolerant cell population below self restriction level (<1000/g), which has been required by food hygiene law. The same level of sterilization effect was obtained only by gamma-ray irradiation at 10 kGy and 20 kGy. On the other hand, although treatment through twin screw extruder slightly reduced bacterial numbers, neither boiling nor microwave irradiation gave sufficient decontamination effect on turmeric fingers. (author).

Evaluation of electron beam irradiation for disinfection of turmeric fingers

International Nuclear Information System (INIS)

Yasumoto, Kyoden; Fujino, Masayuki; Supriyadi; Suzuki, Tetsuya; Hayashi, Toru.

1991-01-01

Turmeric finger as one of the most popular spices has been widely used for food manufacturing. However, it has also been a major cause of bacterial infestation of food materials especially in curry, ham and sausage manufacturing. In this study decontamination of bacteria in turmeric finger by electron beam irradiation was evaluated by comparing with several other decontamination methods: i.e., boiling, microwave irradiation, treatment by twin screw extruder and gamma-ray irradiation. By estimation of colony counting on nutrient agar plate, turmeric finger without any treatment gave total viable cell at 10 8 /g. Turmeric finger which was irradiated by electron beam at 10 kGy dose dramatically reduced thermotolerant cell population below self restriction level (<1000/g), which has been required by food hygiene law. The same level of sterilization effect was obtained only by gamma-ray irradiation at 10 kGy and 20 kGy. On the other hand, although treatment through twin screw extruder slightly reduced bacterial numbers, neither boiling nor microwave irradiation gave sufficient decontamination effect on turmeric fingers. (author)

Evaluation of electron beam irradiation for disinfection of turmeric fingers

International Nuclear Information System (INIS)

Yasumoto, K.; Fujino, M.; Supriyadi; Suzuki, T.; Hayashi, T.

1991-01-01

Turmeric finger as one of the most popular spices has been widely used for food manufacturing. However, it has also been a major cause of bacterial infestation of food materials especially in curry, ham and sausage manufacturing. In this study decontamination of bacteria in turmeric finger by electron beam irradiation was evaluated by comparing with several other decontamination methods: i.e., boiling, microwave irradiation, treatment by twin screw extruder and gamma-ray irradiation. By estimation of colony counting on nutrient agar plate, turmeric finger without any treatment gave total viable cell at 10 8 /g. Turmeric finger which was irradiated by electron beam at 10kGy dose dramatically reduced thermotolerant cell population below self restriction level (<1000/g), which has been required by food hygiene law. The same level of sterilization effect was obtained only by gamma-ray irradiation at 10kGy and 20kGy. On the other hand, although treatment through twin screw extruder slightly reduced bacterial numbers, neither boiling nor microwave irradiation gave sufficient decontamination effect on turmeric fingers

Valutazione degli elementi di struttura e monitoraggio microbiologico nel Comparto operatorio comune del Dipartimento ortopedico dell'Azienda ospedaliera di Parma

Directory of Open Access Journals (Sweden)

C. Pasquarella

2003-05-01

Full Text Available Obiettivi: scopo di questo studio, che si inserisce nell’ambito di un progetto multicentrico promosso dal Gruppo Italiano Studio Igiene Ospedaliera, è stato quello di valutare le condizioni ambientali e gestionali delle sale operatorie del comparto ortopedico dell’Azienda ospedaliera di Parma. Metodi: l’indagine, svolta nell’ottobre 2002, ha previsto la compilazione di un questionario, riguardante gli aspetti strutturali, impiantistici, organizzativi e gestionali, e l’effettuazione di un monitoraggio microbiologico ambientale nelle diverse aree del blocco operatorio. La carica microbica dell’aria è stata valutata utilizzando piastre di sedimentazione per la rilevazione dell’Indice Microbico Aria (IMA mentre per le superfici sono state impiegate membrane di nitrocellulosa. I campionamenti sono stati effettuati prima dell’inizio e durante l’attività chirurgica. Risultati: i dati ottenuti per mezzo del questionario hanno evidenziato condizioni generalmente buone, sia dal punto di vista strutturale che gestionale del comparto operatorio studiato. Per quanto riguarda il controllo microbiologico, nelle sale operatorie, in tutte le rilevazioni prima dell’attività si sono ottenuti valori di IMA uguali a 0; durante l’attività, si è registrato un valore massimo di IMA di 4 in quelle a flusso laminare e di 19 in quelle con flusso turbolento, al di sotto dei valori limite, rispettivamente di 5 e 25; i valori di contaminazione microbica delle superfici prima dell’attività hanno oscillato da un minimo di 0 ufc/cm2 a un massimo di 0,20 ufc/cm2; durante l’attività, solo in una rilevazione si è registrato un valore di 0,58 ufc/cm2, superiore al valore soglia stabilito. Anche negli altri ambienti del comparto operatorio la contaminazione microbica è risultata complessivamente al di sotto dei limiti di riferimento. Conclusioni: il questionario si è rivelato un valido strumento

Effects of irradiation on color and lipid oxidation of prosciutto

International Nuclear Information System (INIS)

Kong Qiulian; Qi Wenyuan; Yue Ling; Chen Zhijun; Bao Yingzi; Dai Xudong; Xu Yun

2011-01-01

This study dealt with the effect of irradiation on the color, ordor and lipid oxidation of prosciutto crudo. The hams were irradiated by γ-ray and electronic beam (EB). Changes of color, ordor, TBA value (TBARS), peroxide value (POV), carbonyl value and conjugated diene value were analyzed and compared with nonirradiated hams. Results showed that color index (a * ) of control, γ-ray irradiated and EB irradiated were 14.39, 9.45 and 11.71 respectively. γ-ray irradiation had been shown to have apparently detrimental effect on the color and ordor of hams, while EB irradiation had little detrimental effect. Irradiation increased POV and conjugated diene value, but the amounts of lipid oxidation products (TBARS, carbonyl value) were less than nonirradiated hams. (authors)

Dietary effects of oregano (Origanum vulgaris L. plant or sweet chestnut (Castanea sativa Mill. wood extracts on microbiological, chemical-physical characteristics and lipid oxidation of cooked ham during storage

Directory of Open Access Journals (Sweden)

David Ranucci

2015-12-01

Full Text Available The aim of this study was to evaluate the dietary effect of feeding pigs with diets enriched with sweet chestnut wood (Castanea sativa Mill. or oregano (Origanum vulgaris L. extract on the microbiological and chemical characteristics of cooked pork ham. Three groups of 10 pigs were fed with a control diet (CTRL, with the CTRL diet enriched with 0.2% of oregano extract (OR and with the CTRL diet enriched with 0.2% of sweet chestnut wood extract (SCW, respectively. Six cooked hams per group were produced, sliced and packaged under a modified atmosphere (N2:CO2=80:20 and stored at refrigeration temperature (4±1°C. Three packages per cooked ham were sampled for analyses at three different storage times (0, 10 and 20 days. At day 0 time, antioxidant capacity of the products (ORACFL assay and chemical composition were performed. At each sampling time, from all the samples the following analyses were performed: Total Microbial Count (TMC, Lactic Acid Bacteria count (LAB, Enterobacteriaceae count, Listeria monocytogenes, pH value, colour coordinates (L*, a*, b*, total basic volatile nitrogen (TBVN and thio-barbituric reactive substances (TBARs determinations. No differences in TMC, LAB and Enterobacteriaceae count, pH, TBVN, chemical composition and L* values were registered between the three groups at all the sampling times considered. No Listeria monocytogenes was detected in the samples tested. Significant differences were registered for ORACFL at 0 days, a* and b* values and TBARs value at 10 and 20 days of storage, with higher values for ORACFL, a* and b* values and lower values for TBARs in SCW and OR than CTRL. No antimicrobial effect could be recorded for OR and SCW but a higher oxidative stability, also highlighted by the colour maintenance, was observed in both OR and SCW.

Influência da embalagem na vida útil de presuntos fatiados Packing influence on the shelf life of sliced ham

Directory of Open Access Journals (Sweden)

Maria Cristina Bressan

2007-04-01

Full Text Available Visou-se com este trabalho, comparar a vida útil de presunto fatiado sem capa de gordura (condicionadas à temperatura entre -1 e 4ºC, usando os tratamentos: sistema de embalagem a vácuo (EV e sistema de embalagem com atmosfera modificada (AM (50% de N2 e 50% de O2, com os laminados flexíveis PET/PEBDL (AM1 e PVDC/EVA/PEBDL (AM2 sobre os parâmetros microbiológicos e físico-químicos, por 35 dias. As análises realizadas foram: contagem padrão em placas (CCP, contagem de fungos (CF, pH e umidade. Nas análises do dia inicial de trabalho verificou-se a contagem de The aim of this work was to compare the shelf-life of sliced ham without fat layer storage in a range of temperature between 1º and 4ºC using the following treatments: vacuum packing (VP and packing with modified atmosphere (MA (50% of N2 and 50% of O2 using flexible sheets of PEAD/LDPE (MA1 and PVDC/EVA/LDPE (MA2 on microbiological and physical chemical parameters for 35 days. Analysis of plate count of microorganisms, pH and humidity were conduced to evaluate the shelf-life of ham. In the first day of analyze the countings of Staphylococcus aureus had been inferior to 10² CFU/g and for the other microorganisms inferior to 10¹ CFU/g. The packed with modified atmosphere increased five days in the shelf-life of the product when compared to vacuum packing. The initial pH (6.4 increased to 6.55, 6.58 and 6.63 on VP MA1 and MA2, respectively. The treatment MA2 increased the shelf-life when compared to modified atmosphere (1.

Effects of illumination and packaging on non-heme iron and color attributes of sliced ham.

Science.gov (United States)

Li, H; Li, C B; Xu, X L; Zhou, G H

2012-08-01

This study was designed to investigate effects of illumination and packaging on color of cooked cured sliced ham during refrigeration, and the possibility of decomposition of nitrosylheme under light and oxygen exposure. Three illumination levels and three packaging films with different oxygen transmission rates (OTRs) were used in two separate experiments during 35 days storage, and pH value, a* value, nitrosylheme, residual nitrite and non-heme iron were evaluated. Packaging OTRs had significant effects (P0.05) nitrosylheme concentration during storage. For both groups, storage time had a significant effect (P<0.01) on a* value and nitrosylheme. Negative relationships between nitrosylheme and nitrite in the illumination group, and between nitrosylheme and non-heme iron in the packaging group were observed. Therefore, illumination level and packaging OTR had limited effects on overall pigment stability, but more discoloration and loss of redness occurred on the surface of products. Copyright © 2012 Elsevier Ltd. All rights reserved.

Analysis of nitrites and nitrates in hams and sausages by open-tubular capillary electrochromatography with a nanolatex-coated capillary column.

Science.gov (United States)

Zhang, Yanhao; Tian, Xiangyu; Guo, Yaxiao; Li, Haibin; Yu, Ajuan; Deng, Zhifen; Sun, Barry Baoguo; Zhang, Shusheng

2014-04-16

In this work, a new open-tubular capillary electrochromatography (OT-CEC) method with the nanolatex-coated column was proposed for the determination of nitrites and nitrates in foodstuffs. The method was simple and repeatable as a result of avoiding the introduction of an electroosmotic flow reverse additive (such as cetyltrimethylammonium chloride) in electrophoretic buffer. The limits of quantitation were 0.89 and 1.05 mg kg⁻¹ for nitrate and nitrite, respectively, whereas the overall recoveries ranged from 94 to 103%. The developed OT-CEC method was successfully applied for 12 samples, and the residue profiles of nitrites and nitrates in hams and sausages were obtained and evaluated.

Hamming Weight Counters and Comparators based on Embedded DSP Blocks for Implementation in FPGA

Directory of Open Access Journals (Sweden)

SKLYAROV, V.

2014-05-01

Full Text Available This paper is dedicated to the design, implementation and evaluation of fast FPGA-based circuits that compute Hamming weights for binary vectors and compare the results with fixed thresholds and variable bounds. It is shown that digital signal processing (DSP slices that are widely available in contemporary FPGAs may be used efficiently and they frequently provide the fastest and least resource consuming solutions. A thorough analysis and comparison of these with the best known alternatives both in hardware and in software is presented. The results are supported by numerous experiments in recent prototyping boards. A fully synthesizable hardware description language (VHDL specification for one of the proposed core components is given that is ready to be synthesized, implemented, tested and compared in any FPGA that contains embedded DSP48E1 slices (or alternatively DSP48A1 slices from previous generations. Finally, the results of comparisons are provided that include discussions of designs in an ARM processor combined with reconfigurable logic for very long vectors.

Evaluation of Key Dependent S-Box Based Data Security Algorithm using Hamming Distance and Balanced Output

Directory of Open Access Journals (Sweden)

Balajee Maram K.

2016-02-01

Full Text Available Data security is a major issue because of rapid evolution of data communication over unsecured internetwork. Here the proposed system is concerned with the problem of randomly generated S-box. The generation of S-box depends on Pseudo-Random-Number-Generators and shared-secret-key. The process of Pseudo-Random-Number-Generator depends on large prime numbers. All Pseudo-Random-Numbers are scrambled according to shared-secret-key. After scrambling, the S-box is generated. In this research, large prime numbers are the inputs to the Pseudo-Random-Number-Generator. The proposed S-box will reduce the complexity of S-box generation. Based on S-box parameters, it experimentally investigates the quality and robustness of the proposed algorithm which was tested. It yields better results with the S-box parameters like Hamming Distance, Balanced Output and Avalanche Effect and can be embedded to popular cryptography algorithms

Psychophysiological Assessment Methods (Including a Register of Psychophysiologists - on Microfiches) (Methodes d’Evaluation Psychophysiologique (Liste de Psychophysiologues Incluse sur Microfiches)

Science.gov (United States)

1994-05-01

of Neurology University of Parma Dipartmento di Psicologia , 289 Via del Quartiere, 4 Via S. Niccol6 93 43100 Parma 50125 Firenze University Centre for...Facultad de Psicologia 1105 AZ Amsterdam Universitat de Barcelona VieUiest 3 2 C/A Fiorensa s/n rjUnvsiy4,2 08028 Barcelona Department of Psychophysiology

KRITIK TEORI HUKUM FEMINIS TERHADAP UU NO. 1 TAHUN 1974 TENTANG PERKAWINAN: Suatu Upaya dalam Menegakkan Keadilan HAM Kaum Perempuan

Directory of Open Access Journals (Sweden)

Habib Shulton Asnawi

2016-09-01

Full Text Available In Indonesia, women still suffer discrimination and injustice. This is supported by the persistence of gender-biased laws not giving the protection of the rights of women, such as Law No. 1 of 1974 about Marriage. Women's issues that was settled in the line of traditional Islamic law (classical tending to be conservative and literal in understanding religious messages and doctrines, such as the patriarchal culture which puts women as beings lower position than men. Patriarchal culture which is done with legism legalized legislation in its application to the gender bias that is highly detrimental for women. The marginalization of women then occurs and is caused by the differences and gender inequalities that cause woman discomfort and not free. Therefore, all forms of injustice is a violation to Human Rights (HAM, a crime against human dignity and a form of discrimination that must be abolished. [Di Indonesia, perempuan masih mengalami diskriminasi dan ketidakadilan. Hal ini didukung oleh masih adanya undang-undang bias gender yang belum memberikan perlindungan terhadap hak-hak perempuan, seperti UU No.1 Tahun 1974 tentang Perkawinan. Isu-isu perempuan yang dimapankan di dalam UU tersebut sejalan Islam tradisional (klasik yang cenderung konservatif dan literal dalam memahami pesan-pesan keagamaan dan doktrin-doktrin yang ada, seperti budaya patriarkhis, yang menempatkan perempuan sebagai makhluk yang lebih rendah kedudukannya dari pada laki-laki. Budaya patriarkhis yang dilakukan dengan kecenderungan legisme itu telah melegalisir peraturan perundang-undangan bias gender ke dalam penerapannya yang sangat merugikan perempuan. Marginalisasi perempuan kemudian terjadi dan disebabkan oleh perbedaan  dan ketidakadilan gender yang menyebabkan ketidaknyamanan serta terbelenggunya kebebasan perempuan. Karena itu, segala bentuk ketidakadilan merupakan pelanggaran Hak Asasi Manusia (HAM, kajahatan terhadap martabat kemanusiaan dan bentuk diskriminasi yang

Effect of pasture on chestnut or acorn on fatty acid composition and aromatic profile of fat of Cinta Senese dry-cured ham

Directory of Open Access Journals (Sweden)

Franci, Oreste

2009-07-01

Full Text Available The objective of this study was to evaluate the effect of pasture on oak and chestnut grove on chemical and aromatic traits of Cinta Senese cured ham. Fifteen Cinta Senese barrows (124 kg of l.w. on average were allotted to three groups: one group (MI was reared outdoors in confined area and fed commercial feedstuff. The other two groups were raised under free-range conditions on acorn (AC or chestnut (CH woods. At slaughtering (148 kg of l.w. the right thighs were seasoned for 360 days, on average, to obtained cured hams. Results demonstrated that subcutaneous fat of ham of CH and AC groups, respect to CONC group, was the richest in MUFA (51.3 and 53.9 vs 49.5% respectively, because of the higher content of oleic acid (48.4 and 50.8 vs 46.2%, respectively. AC showed a lower percentage of PUFA than CH and CONC (13.8 vs 15.4 and 16.3%, respectively. As regard volatile compounds, AC, respect to CH and MI groups, showed the highest value of aldehydes (44.1 vs 30.3 and 33.5% respectively and ethers (4.04 vs 1.15 and 1.71% respectively.El objetivo de este estudio fue la evaluación de la composición de los ácidos grasos y de los compuestos volátiles del jamón curado Toscano obtenido de cerdos Cinta Senese alimentados con bellota, castaña o pienso. Quince cerdos de raza Cinta Senese fueron criados en extensivo: 5 fueron criados en bosque de bellota (AC, 5 en bosque de castaña (CH y 5 en un cercado y alimentados con pienso (MI. El día posterior al sacrificio se curaron los jamones. La composición de los ácidos grasos fue estadísticamente diferente entre los tipos de alimentación. La grasa de AC presentó el mayor porcentaje de AGMI total en comparación con CH y MI (51.3 y 53.9 vs 49.5% respectivamente gracias al mayor porcentaje de ácido oleico (48.4 y 50.8 vs 46.2%, respectivamente, y la menor de AGPI total (13.8 vs 15.4 y 16.3%, respectivamente. En relación a los compuestos volátiles, la grasa de AC, en comparación con CH y MI

Calculos de potenciais de ionização de algumas bases e aza-analogas utilizando o metodo semi-empirico HAM/3

OpenAIRE

Jose Jair Vianna Cirino

1994-01-01

Resumo: Inicialmente procedeu-se a otimização de geometrias das bases purinas guanina, 8-azaguanjna, xantina, 8-azaxantina e hipoxantina com o uso dos métodos semi-empíricos MNDO, AMI e MNDO-PM3. Nesta etapa também fez-se uso de métodos ab initio utilizando o conjunto de base cep-31G. Os potenciais de ionização dos elétrons do caroço das bases purinas foram calculados posteriormente por meio do método semi-empírico HAM/3 empregando as geometrias otimizadas pelos métodos semi-empíricos na etap...

APLICACIÓN DE LA DISTANCIA DE HAMMING EN LA EVALUACIÓN DE LA COMPOSICIÓN DE EQUIPOS DE PROYECTOS INFORMÁTICOS

OpenAIRE

Elizabeth Rodriguez Stiven; Naryana Linares Pons; Dailien More Soto; Yordan Portela Pozo

2014-01-01

El presente trabajo tiene como propósito realizar una evaluación de la composición de equipos de proyectos informáticos usando técnicas basadas en la comparación con un candidato ideal. Como parte de la investigación se realiza un análisis de la aplicación de esta técnica en la gestión de recursos humanos. Se presenta un modelo de evaluación de la composición de equipos de proyectos informáticos, qué usa como medida de comparación la Distancia de Hamming y como candidatos ideales el “Modelo d...

Influences of in-cloud aerosol scavenging parameterizations on aerosol concentrations and wet deposition in ECHAM5-HAM

Directory of Open Access Journals (Sweden)

B. Croft

2010-02-01

Full Text Available A diagnostic cloud nucleation scavenging scheme, which determines stratiform cloud scavenging ratios for both aerosol mass and number distributions, based on cloud droplet, and ice crystal number concentrations, is introduced into the ECHAM5-HAM global climate model. This scheme is coupled with a size-dependent in-cloud impaction scavenging parameterization for both cloud droplet-aerosol, and ice crystal-aerosol collisions. The aerosol mass scavenged in stratiform clouds is found to be primarily (>90% scavenged by cloud nucleation processes for all aerosol species, except for dust (50%. The aerosol number scavenged is primarily (>90% attributed to impaction. 99% of this impaction scavenging occurs in clouds with temperatures less than 273 K. Sensitivity studies are presented, which compare aerosol concentrations, burdens, and deposition for a variety of in-cloud scavenging approaches: prescribed fractions, a more computationally expensive prognostic aerosol cloud processing treatment, and the new diagnostic scheme, also with modified assumptions about in-cloud impaction and nucleation scavenging. Our results show that while uncertainties in the representation of in-cloud scavenging processes can lead to differences in the range of 20–30% for the predicted annual, global mean aerosol mass burdens, and near to 50% for accumulation mode aerosol number burden, the differences in predicted aerosol mass concentrations can be up to one order of magnitude, particularly for regions of the middle troposphere with temperatures below 273 K where mixed and ice phase clouds exist. Different parameterizations for impaction scavenging changed the predicted global, annual mean number removal attributed to ice clouds by seven-fold, and the global, annual dust mass removal attributed to impaction by two orders of magnitude. Closer agreement with observations of black carbon profiles from aircraft (increases near to one order of magnitude for mixed phase clouds

Inhibition of Listeria monocytogenes ATCC 19115 on ham steak by tea bioactive compounds incorporated into chitosan-coated plastic films

Directory of Open Access Journals (Sweden)

Vodnar Dan C

2012-07-01

Full Text Available Abstract Background The consumer demands for better quality and safety of food products have given rise to the development and implementation of edible films. The use of antimicrobial films can be a promising tool for controlling L. monocytogenes on ready to eat products. The aim of this study was to develop effective antimicrobial films incorporating bioactive compounds from green and black teas into chitosan, for controlling L. monocytogenes ATCC 19115 on vacuum-packaged ham steak. The effectiveness of these antimicrobial films was evaluated at room temperature (20°C for 10 days and at refrigerated temperature (4°C for 8 weeks. Results The HPLC results clearly show that relative concentrations of catechins and caffeine in green tea ranked EGCG>EGC>CAF>ECG>EC>C while in black tea extracts ranked CAF>EGCG>ECG>EGC>EC>C. The chitosan-coated plastic films incorporating green tea and black tea extracts shows specific markers identified by FTIR. Incorporating natural extracts into chitosan showed that the growth of L monocytogenes ATCC 19115 was inhibited. The efficacy of antimicrobial effect of tea extracts incorporated into chitosan-coated plastic film was dose dependent. However, chitosan-coated films without addition of tea extracts did not inhibit the growth of L. monocytogenes ATCC 19115. Chitosan-coated plastic films incorporating 4% Green tea extract was the most effective antimicrobial, reducing the initial counts from 3.2 to 2.65 log CFU/cm2 during room temperature storage and from 3.2 to 1–1.5 log CFU/cm2 during refrigerated storage. Conclusions Incorporation of tea extracts into the chitosan-coated films considerably enhanced their effectiveness against L. monocytogenes ATCC 19115. 4% Green tea incorporated into chitosan-coated plastic film had a better antilisterial effect than 2% green tea or 2% and 4% black tea. Data from this study would provide new formulation options for developing antimicrobial packaging films using tea

Effect of the inclusion of dry pasta by-products at different levels in the diet of typical Italian finishing heavy pigs: Performance, carcass characteristics, and ham quality.

Science.gov (United States)

Prandini, A; Sigolo, S; Moschini, M; Giuberti, G; Morlacchini, M

2016-04-01

The effect of pasta inclusion in finishing pig diets was evaluated on growth performance, carcass characteristics, and ham quality. Pigs (144) were assigned to 4 diets with different pasta levels: 0 (control, corn-based diet), 30, 60, or 80%. Pigs fed pasta had greater (linear, PPasta increased (quadratic, PPasta decreased (linear, Ppasta. Pasta could be considered as an ingredient in the diet for typical Italian finishing heavy pigs. Copyright © 2015 Elsevier Ltd. All rights reserved.

Survey of radon concentrations in three Italian towns

International Nuclear Information System (INIS)

Malanca, A.; Pessina, V.; Dallara, G.

1992-01-01

Radon-222 was measured in 187 dwellings in Parma, Reggio Emilia, and Orvieto. Samples were collected using activated carbon canisters, placed in basements and on the upper floors for at least 48 h in the period starting from January 1989 to July 1990. Gamma spectroscopy was used for the measurement of 222 Rn and its progeny. The data for the three towns show a lognormal distribution. Owing to the high radium concentration in building materials and underlying soil, high radon concentrations were observed in Orvieto's dwellings. Additional measurements carried out in 22 public schools of Parma and Reggio Emilia showed moderate radon concentrations, while significant radon levels were recorded in 37 castles and ancient buildings in Parma and Reggio Emilia provinces

Updated estimates of HAL n and RN- effects on pork quality: fresh and processed loin and ham.

Science.gov (United States)

Cherel, P; Glénisson, J; Figwer, P; Pires, J; Damon, M; Franck, M; Le Roy, P

2010-12-01

A 1000-pig F2 intercross QTL detection experimental population was generated using two commercial sire lines. Independent carriers of HAL n and RN- mutations (10% and 14%, respectively) were included in this population as control genotypes. The effects of HAL n and RN- heterozygous genotypes on fresh and transformed loins and hams were estimated using a mixed model methodology. The results document the unfavorable effects of both mutations on meat quality. Smaller effects of HAL Nn genotype compared to HAL nn or RN-rn+ genotypes were estimated. Interestingly, effects of HAL Nn genotype on meat pH and loin color could be insignificant at 24-h postmortem, but translate into higher water losses on storage and cooking, and result in tougher cooked loin. Using the same methodology, significant effects of the PRKAG3 (RN) I199 allele on ultimate pH values but not on glycolytic potential were observed. Copyright © 2010 The American Meat Science Association. Published by Elsevier Ltd. All rights reserved.

Hydrolyzed collagen, modified starch and guar gum addition in turkey ham Adição de colágeno hidrolisado, amido modificado e goma guar em presunto de peru

Directory of Open Access Journals (Sweden)

Rosa Cristina Prestes

2012-07-01

Full Text Available The main problems observed in cooked hams are bad sliceability and excessive fluid loss after cooking. To reduce these problems the industry uses non-meat ingredients such as soy protein and carrageenan, but under Brazilian law, it is not allowed to add starch or modified starch in hams. Three ingredients were tested in the present research: modified starch (0 to 2.0%, gum guar (0 to 0.30% and hydrolyzed collagen (0 to 2.0%, following a 2³ full factorial design with five repetitions in the central point. The guar gum produced low resistance to reheating, however in losses by cooling, the results were adequate. The hydrolyzed collagen tested did not give satisfactory results, showing low acceptance due to formation of gel in the ham and high losses. The developed products were not different from the commercial product in relation to texture (P>0.05. The formulation F6 (2.0% of modified starch was the one with the best results and greater acceptance as detected by the tasters. Based on the results obtained it seems appropriate to propose the legal permission of starch in ham or the creation of a new class of product in which starch addition would be allowed.Os principais problemas observados em presuntos são a má fatiabilidade e a perda excessiva de líquidos após o cozimento. Para reduzir esses problemas, a indústria utiliza ingredientes não cárneos, tais como a proteína de soja e a carragena, porém, segundo a legislação brasileira, não é permitida a adição de amido ou amido modificado. Neste trabalho, foram testados três ingredientes, em presunto cozido de peru: amido modificado (0 a 2,0%, goma guar (0 a 0,30% e colágeno hidrolisado (0 a 2,0%, seguindo um delineamento fatorial completo 2³ com cinco repetições no ponto central. A goma guar apresentou baixa resistência ao reaquecimento, no entanto, nas perdas por resfriamento, os resultados foram adequados. O colágeno hidrolisado testado não proporcionou resultados satisfat

Characterization of Thermo- and Detergent Stable Antigenic Glycosylated Cysteine Protease of Euphorbia nivulia Buch.-Ham. and Evaluation of Its Ecofriendly Applications

Directory of Open Access Journals (Sweden)

Shamkant B. Badgujar

2013-01-01

Full Text Available An antigenic glycosylated cysteine protease has been purified from the latex of Euphorbia nivulia Buch.-Ham. It exhibits remarkable protease activity in the presence of metal ions, oxidizing agents, organic solvents, and detergents. This enzyme showed potential role in leather processing industry due to its dehairing activity for animal hide without hydrolyzing fibrous proteins, producing, by this way, a better quality product. The enzyme can also be used for silver recovering from X-ray plates. In addition, the stability (temperature and surfactants and hydrolysis of blood stain data also revealed its application in detergent industries. Agriculturally, this protease finds application in biocontrol process against the infectious management of root knot nematode, Meloidogyne incognita. Biologically, it shows noticeable wound healing, haemostatic and antibacterial activity.

Changes in SPME-extracted volatile compounds from Iberian ham during ripening

Directory of Open Access Journals (Sweden)

García, Carmen

2009-07-01

Full Text Available A headspace SPME procedure was tested to study the evolution of volatile compounds during the ripening of Iberian hams from pigs reared in a Montanera system (outdoorbased, with acorn and pasture available and a HO-Pienso system (indoor-based, with a high oleic acid concentrate. The effect of the ripening time on volatile compounds was more marked than the effect of feeding system. Most volatile compounds affected by the ripening time were compounds that come from Strecker and Maillard reactions, which increased significantly ( p Un procedimiento de microextración en fase sólida (SPME en espacio de cabeza fue ensayado para estudiar la evolución de los compuestos volátiles durante la curación de Jamones Ibéricos de cerdos criados en régimen de montanera (en libertad, con bellotas y pasto disponible y un sistema OH-Pienso (estabulados, con un pienso alto en ácido oléico. El efecto del tiempo de curación en los compuestos volátiles fue más marcado que el efecto de la alimentación. La mayoría de los compuestos volátiles afectados por el tiempo de curación fueron compuestos que proceden de la reacción de Strecker y Maillard, que se incrementaron significativamente (p p < 0.05. Algunos de ellos (ácido butanoico, 2,6- dimetilpiracina y 1-octen-3-ol fueron más abundantes en jamones de Montanera que en jamones de Pienso. Estas pequeñas diferencias podrían ser importantes porque los compuestos involucrados han sido identificados como aromas del jamón Ibérico.

Effects of irradiation on color and lipid oxidation of prosciutto

International Nuclear Information System (INIS)

Kong Qiulian; Qi Wenyuan; Yue Ling; Chen Zhijun; Bao Yingzi; Dai Xudong; Xu Yun

2012-01-01

This study dealt with the effect of irradiation on the color, irradiation odor and lipid oxidation of prosciutto crudo. The hams were irradiated by γ-ray and electronic beam (EB). Changes of color, irradiation odor, TBA value (TBARS), peroxide value (POV), carbonyl value and conjugated diene value were analyzed and compared with non-irradiated hams. Results showed that color index (a * ) of control, γ-ray irradiated and EB irradiated were 14.39, 9.45 and 11.71 respectively. The ratios of a * /b * were different with the type of rays. The ratio of a * /b * of EB irradiation was same with control, while that of γ-ray irradiation was decreased apparently. γ-ray irradiation had been shown to have apparently detrimental effect on the color and odor of hams, while EB irradiation had little detrimental effect. Irradiation increased POV and conjugated diene value, but the amounts of lipid oxidation products (TBARS, carbonyl value) were less than nonirradiated hams. (authors)

Red wine and cardiovascular health the "French Paradox" revisited

OpenAIRE

Giuseppe Lippi; Massimo Franchini; Gian Cesare Guidi

2010-01-01

Giuseppe Lippi1, Massimo Franchini2, Gian Cesare Guidi31U.O. di Diagnostica Ematochimica, 2Servizio di Immunoematologia e Trasfusione, Dipartimento di Patologia e Medicina di Laboratorio, Azienda Ospedaliero, Universitaria di Parma, Parma, Italy; 3Sezione di Chimica Clinica, Dipartimento di Scienze Morfologico-Biomediche, Università degli Studi di Verona, Verona, ItalyAbstract: The healthful and nutritive properties of wine have been acknowledged for thousands of years, but the obs...

Analytical Model for Estimating the Zenith Angle Dependence of Terrestrial Cosmic Ray Fluxes.

Directory of Open Access Journals (Sweden)

Tatsuhiko Sato

Full Text Available A new model called "PHITS-based Analytical Radiation Model in the Atmosphere (PARMA version 4.0" was developed to facilitate instantaneous estimation of not only omnidirectional but also angular differential energy spectra of cosmic ray fluxes anywhere in Earth's atmosphere at nearly any given time. It consists of its previous version, PARMA3.0, for calculating the omnidirectional fluxes and several mathematical functions proposed in this study for expressing their zenith-angle dependences. The numerical values of the parameters used in these functions were fitted to reproduce the results of the extensive air shower simulation performed by Particle and Heavy Ion Transport code System (PHITS. The angular distributions of ground-level muons at large zenith angles were specially determined by introducing an optional function developed on the basis of experimental data. The accuracy of PARMA4.0 was closely verified using multiple sets of experimental data obtained under various global conditions. This extension enlarges the model's applicability to more areas of research, including design of cosmic-ray detectors, muon radiography, soil moisture monitoring, and cosmic-ray shielding calculation. PARMA4.0 is available freely and is easy to use, as implemented in the open-access EXcel-based Program for Calculating Atmospheric Cosmic-ray Spectrum (EXPACS.

The level of depression in lower back pain patient at outpatient of neurology Haji Adam Malik hospital Medan (RS HAM

Science.gov (United States)

Pardosi, M. C.; Loebis’, B.; Husada, M. S.

2018-03-01

The incidence of Lower Back Pain (LBP) in Indonesia is unclear. Various data in some developing countries stated that the LBP incidence is approximately 15% - 20% of the population. Because there is the unclear incidence of psychological symptoms such as depression on LBP, the researchers were interested in doing this research. A descriptive study was conducted to know the level of depression of patients with LBP in outpatient of neurology RS HAM Medan. Patients with LBP (n=78) in outpatient were examined BDI-II. The minimum depression was 47.44% (n=37), mild depression was 21.79% (n=17), moderate depression was 21.79% (n=17), severe depression was 8.98% (n=7). In conclusion, the level of depression in lower back pain patient at outpatient of neurology Haji Adam Malik Hospital Medan is higher at minimum depression.

The chemistry–climate model ECHAM6.3-HAM2.3-MOZ1.0

Directory of Open Access Journals (Sweden)

M. G. Schultz

2018-05-01

Full Text Available The chemistry–climate model ECHAM-HAMMOZ contains a detailed representation of tropospheric and stratospheric reactive chemistry and state-of-the-art parameterizations of aerosols using either a modal scheme (M7 or a bin scheme (SALSA. This article describes and evaluates the model version ECHAM6.3-HAM2.3-MOZ1.0 with a focus on the tropospheric gas-phase chemistry. A 10-year model simulation was performed to test the stability of the model and provide data for its evaluation. The comparison to observations concentrates on the year 2008 and includes total column observations of ozone and CO from IASI and OMI, Aura MLS observations of temperature, HNO3, ClO, and O3 for the evaluation of polar stratospheric processes, an ozonesonde climatology, surface ozone observations from the TOAR database, and surface CO data from the Global Atmosphere Watch network. Global budgets of ozone, OH, NOx, aerosols, clouds, and radiation are analyzed and compared to the literature. ECHAM-HAMMOZ performs well in many aspects. However, in the base simulation, lightning NOx emissions are very low, and the impact of the heterogeneous reaction of HNO3 on dust and sea salt aerosol is too strong. Sensitivity simulations with increased lightning NOx or modified heterogeneous chemistry deteriorate the comparison with observations and yield excessively large ozone budget terms and too much OH. We hypothesize that this is an impact of potential issues with tropical convection in the ECHAM model.

The chemistry-climate model ECHAM6.3-HAM2.3-MOZ1.0

Science.gov (United States)

Schultz, Martin G.; Stadtler, Scarlet; Schröder, Sabine; Taraborrelli, Domenico; Franco, Bruno; Krefting, Jonathan; Henrot, Alexandra; Ferrachat, Sylvaine; Lohmann, Ulrike; Neubauer, David; Siegenthaler-Le Drian, Colombe; Wahl, Sebastian; Kokkola, Harri; Kühn, Thomas; Rast, Sebastian; Schmidt, Hauke; Stier, Philip; Kinnison, Doug; Tyndall, Geoffrey S.; Orlando, John J.; Wespes, Catherine

2018-05-01

The chemistry-climate model ECHAM-HAMMOZ contains a detailed representation of tropospheric and stratospheric reactive chemistry and state-of-the-art parameterizations of aerosols using either a modal scheme (M7) or a bin scheme (SALSA). This article describes and evaluates the model version ECHAM6.3-HAM2.3-MOZ1.0 with a focus on the tropospheric gas-phase chemistry. A 10-year model simulation was performed to test the stability of the model and provide data for its evaluation. The comparison to observations concentrates on the year 2008 and includes total column observations of ozone and CO from IASI and OMI, Aura MLS observations of temperature, HNO3, ClO, and O3 for the evaluation of polar stratospheric processes, an ozonesonde climatology, surface ozone observations from the TOAR database, and surface CO data from the Global Atmosphere Watch network. Global budgets of ozone, OH, NOx, aerosols, clouds, and radiation are analyzed and compared to the literature. ECHAM-HAMMOZ performs well in many aspects. However, in the base simulation, lightning NOx emissions are very low, and the impact of the heterogeneous reaction of HNO3 on dust and sea salt aerosol is too strong. Sensitivity simulations with increased lightning NOx or modified heterogeneous chemistry deteriorate the comparison with observations and yield excessively large ozone budget terms and too much OH. We hypothesize that this is an impact of potential issues with tropical convection in the ECHAM model.

Propriedades da carne e perfil de ácidos graxos do pernil de catetos (Tayassu tajacu alimentados com torta de babaçu (Orbignya phalerata Meat properties and fatty acids profile of the ham of peccaries (Tayassu tajacu fed babassu (Orbignya phalerata meal

Directory of Open Access Journals (Sweden)

N.I. Albuquerque

2009-12-01

Full Text Available Analisaram-se as propriedades da carne e o perfil de ácidos graxos do pernil de catetos alimentados com dietas contendo diferentes porcentagens de torta de babaçu, usada como fonte energética alternativa substituindo parte do milho na alimentação, em sistemas de produção em cativeiro. Avaliou-se o pernil de 12 animais quanto às suas propriedades - perda de peso ao cozimento, força de cisalhamento, pH e capacidade de retenção de água-, depois extraiu-se o óleo da carne e determinou-se o perfil dos ácidos graxos. Não foram observados efeitos (P>0,05 das porcentagens de torta de babaçu sobre as propriedades da carne; os ácidos graxos (AG insaturados, mono e poli-insaturados, foram encontrados em maior quantidade (51,6-57,8% que os ácidos graxos saturados (42,2-48,4% na carne do pernil. Baseando-se na teoria de que os AG poli-insaturados ingeridos na dieta humana são responsáveis pela redução nos níveis séricos de colesterol, sugere-se que a carne de catetos seja uma boa fonte alternativa de proteína.The meat properties and the fatty acids profile of the ham of peccaries ham fed diets with different levels of babassu meal, used as an alternative energy source substituting part of corn on feeding peccaries in captivity, were studied. The ham meats of 12 animals were evaluated on their properties: cooking losses, shear force, pH, and water holding capacity. After that, the meat oil was extracted to determine the fatty acids contents. No effects (P>0.05 of the babassu meal levels on the meat properties were observed. The unsaturated fatty acids, mono and polyunsaturated, were found in higher quantity than the saturated fatty acids in the ham meat of peccaries. Based on the theory that the polyunsaturated fatty acids ingested in the human diet are responsible for reduction of the seric levels of cholesterol, it can be suggested that the peccary meat is a good alternative source of protein.

PREFACE: Joint European Magnetic Symposia - JEMS 2010

Science.gov (United States)

Spałek, Jozef

2011-07-01

łekChairman of JEMS 2010 Symposia 1. Plenary, Semi-plenary, Tutorials 2. Magnetization Processes Spin Excitations and Ultrafast DynamicsCoordinator: Andrzej Maziewski (Bialystok) 3. Hard Magnetic Materials and MagnetocaloricsCoordinator: Henryk Figiel (Kraków) 4. Magnetic HydridesCoordinators: Ladislav Havela (Praha), Zbigniew Tarnawski (Kraków) 5. Interface of Magnetic Thin FilmsCoordinators: Jürgen Fassbender (Dresden), N-T H Kim-Ngan (Kraków) 6. Magnonic CrystalsCoordinators: Bahram Djafari-Rouhani (Lille), Henryk Puszkarski (Poznan) 7. Magnetism of Metals, Alloys, and IntermetallicsCoordinator: Andrzej Szytula (Kraków) 8. Molecular MagnetismCoordinators: Stephen Blundell (Oxford), Maria Balanda (Kraków) 9. Magnetooptics of NanomagnetsCoordinators: Kamil Postava (Ostrava), Marek Kisielewski (Bialystok) 10. NanomagnetismCoordinators: Marek Przybylski (Halle), Jürgen Kirschner (Halle) 11. Other topics - Biomagnetism, Domain Walls, InstrumentationCoordinator: Henryk Figiel (Kraków) 12. Magnetic Perovskites and MultiferroicsCoordinator: Henryk Szymczak (Warszawa) 13. Magnetic Semiconductors and InsulatorsCoordinators: Klaus Baerner (Göttingen), Tadeusz Gron (Katowice) 14. Magnetic Shape Memory Effects and Related PhenomenaCoordinators: Oliver Gutfleisch (Dresden), Sebastian Fähler (Dresden) 15. Soft Magnetic MaterialsCoordinators: Julian González (San Sebastian), Krzysztof Kulakowski (Kraków) 16. SpintronicsCoordinator: Maciej Sawicki (Warszawa) 17. Strongly Correlated Electron Systems, Magnetism and SuperconductivityCoordinator: Andrzej Slebarski (Katowice) The next Joint European Magnetic Symposia, JEMS 2012, will be held in Parma, Italy, 9-14 September 2012.www.jems2012.itCo-Chairs:Franca Albertini, Institute of Materials for Electronics and Magnetism (IMEM), CNR, ParmaRoberto De Renzi, Department of Physics, University of Parma

Fungal communication requires the MAK-2 pathway elements STE-20 and RAS-2, the NRC-1 adapter STE-50 and the MAP kinase scaffold HAM-5.

Science.gov (United States)

Dettmann, Anne; Heilig, Yvonne; Valerius, Oliver; Ludwig, Sarah; Seiler, Stephan

2014-11-01

Intercellular communication is critical for the survival of unicellular organisms as well as for the development and function of multicellular tissues. Cell-to-cell signaling is also required to develop the interconnected mycelial network characteristic of filamentous fungi and is a prerequisite for symbiotic and pathogenic host colonization achieved by molds. Somatic cell-cell communication and subsequent cell fusion is governed by the MAK-2 mitogen activated protein kinase (MAPK) cascade in the filamentous ascomycete model Neurospora crassa, yet the composition and mode of regulation of the MAK-2 pathway are currently unclear. In order to identify additional components involved in MAK-2 signaling we performed affinity purification experiments coupled to mass spectrometry with strains expressing functional GFP-fusion proteins of the MAPK cascade. This approach identified STE-50 as a regulatory subunit of the Ste11p homolog NRC-1 and HAM-5 as cell-communication-specific scaffold protein of the MAPK cascade. Moreover, we defined a network of proteins consisting of two Ste20-related kinases, the small GTPase RAS-2 and the adenylate cyclase capping protein CAP-1 that function upstream of the MAK-2 pathway and whose signals converge on the NRC-1/STE-50 MAP3K complex and the HAM-5 scaffold. Finally, our data suggest an involvement of the striatin interacting phosphatase and kinase (STRIPAK) complex, the casein kinase 2 heterodimer, the phospholipid flippase modulators YPK-1 and NRC-2 and motor protein-dependent vesicle trafficking in the regulation of MAK-2 pathway activity and function. Taken together, these data will have significant implications for our mechanistic understanding of MAPK signaling and for homotypic cell-cell communication in fungi and higher eukaryotes.

CD1a, HAM56, CD68 and S-100 are present in lesional skin biopsies from patients affected by autoimmune blistering diseases

Directory of Open Access Journals (Sweden)

Ana Maria Abreu Velez

2014-04-01

Full Text Available Introduction: Previous research on autoimmune skin blistering diseases (ABD has primarily focused on the humoral immune response; moreover, little attention has been given to the potential role of the antigen presenting cells (APCs in lesional skin. Aim: The purpose of our study was to immunophenotype selected APC in the lesional skin of ABDs, utilizing immunohistochemistry (IHC stains. Materials and Methods: We utilized IHC to stain for dendritic cells (DC, staining with CD1a, CD68, HAM56, and S-100 in lesional skin from 30 patients with endemic pemphigus foliaceus (EPF, 15 controls from the EPF endemic area, and 15 healthy controls from the USA. We also tested archival biopsies from patients with selected ABD, including 30 patients with bullous pemphigoid (BP, 20 with pemphigus vulgaris (PV, 8 with pemphigus foliaceus (PF and 14 with dermatitis herpetiformis (DH and 2 with epidermolysis bullosa acquisita (EBA. Results: Cells stained by CD68, HAM56 and S-100 were present in the majority of the ABD skin biopsies; these cells were located primarily in perivascular infiltrates surrounding dermal vessels subjacent to the blisters. However, these cells were also noted within the blisters, in vessels supplying dermal eccrine glands and ducts, and in areas of dermal endothelial-mesenchymal cell junction-like structures, especially in BP cases. In our CD1a staining, the number and location of positive staining cells varied with each disease, being abundant in most ABD in the epidermis suprajacent to the blisters, or in the epidermis surrounding the blister site if the blister site epidermis was missing. In the control biopsies, most did not display positive IHC staining, with the exception of a few CD1a positive cells in the epidermis Conclusion: Our findings confirm positive IHC staining for APCs in areas of the skin besides the disease blisters. Our findings suggest that the antigen presentation in ABD proceeds in areas distant from the blister site

Omanimeline peenar / Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2012-01-01

Taimi võib istutusalasse valida erineval põhimõttel: värvi, otstarbe, ühe perekonna või liigi taimede järgi. Üks võimalus on teha aeda perekonna- või suguvõsapeenar, kus kasvavad pereliikmete või sugulaste nimedega taimed. Oma nimega taimi otsi järgmistelt lehekülgedelt: http://apps.rhs.org.uk/rhsplantfinder/; http://apps.rhs.uk/horticulturaldatabase.index.asp

Decellularized human amniotic membrane: more is needed for an efficient dressing for protection of burns against antibiotic-resistant bacteria isolated from burn patients.

Science.gov (United States)

Gholipourmalekabadi, M; Bandehpour, M; Mozafari, M; Hashemi, A; Ghanbarian, H; Sameni, M; Salimi, M; Gholami, M; Samadikuchaksaraei, A

2015-11-01

Human amniotic membranes (HAMs) have attracted the attention of burn surgeons for decades due to favorable properties such as their antibacterial activity and promising support of cell proliferation. On the other hand, as a major implication in the health of burn patients, the prevalence of bacteria resistant to multiple antibiotics is increasing due to overuse of antibiotics. The aim of this study was to investigate whether HAMs (both fresh and acellular) are an effective antibacterial agent against antibiotic-resistant bacteria isolated from burn patients. Therefore, a HAM was decellularized and tested for its antibacterial activity. Decellularization of the tissue was confirmed by hematoxylin and eosin (H&E) and 4,6-diamidino-2-phenylindole (DAPI) staining. In addition, the cyto-biocompatibility of the acellular HAM was proven by the cell viability test (3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide, MTT) and scanning electron microscopy (SEM). The resistant bacteria were isolated from burns, identified, and tested for their susceptibility to antibiotics using both the antibiogram and polymerase chain reaction (PCR) techniques. Among the isolated bacteria, three blaIMP gene-positive Pseudomonas aeruginosa strains were chosen for their high resistance to the tested antibiotics. The antibacterial activity of the HAM was also tested for Klebsiella pneumoniae (American Type Culture Collection (ATCC) 700603) as a resistant ATCC bacterium; Staphylococcus aureus (mecA positive); and three standard strains of ATCC bacteria including Escherichia coli (ATCC 25922), Pseudomonas aeruginosa (ATCC 27833), and S. aureus (ATCC 25923). Antibacterial assay revealed that only the latter three bacteria were susceptible to the HAM. All the data obtained from this study suggest that an alternative strategy is required to complement HAM grafting in order to fully protect burns from nosocomial infections. Copyright © 2015 Elsevier Ltd and ISBI. All rights reserved.

Technological and sensory quality of restructured low-fat cooked ham containing liquid whey Características tecnológicas e sensoriais de apresuntados com baixo teor de gordura elaborados com soro de leite

Directory of Open Access Journals (Sweden)

Monalisa Pereira Dutra

2012-02-01

Full Text Available The use of liquid whey to replace water (at 0, 25, 50, 75 or 100% in a restructured cooked ham formulation was studied and several technological and sensory quality properties were determined. The test results showed no statistically significant differences (P 0.05 less reddish (a* value reduction and more grayish and yellowish (lesser C* and higher h values with higher whey additions. A lower (P 0.05. These results suggest that up to 38% natural fresh liquid whey can be added to a restructured cooked ham formulation with similar results to products cured with a conventional formulation.As propriedades tecnológicas e sensoriais de apresuntados elaborados com soro de leite em substituição à água de formulação (0, 25, 50, 75 ou 100% foram avaliadas. Não foram observadas diferenças significativas (P > 0,05 nos testes de perda de peso (cozimento, refrigeração, reaquecimento e ciclo de congelamento e na textura objetiva (teste TPA. No entanto, para a cor objetiva (CIELAB, as amostras se apresentaram (P 0,05 afetada. Esses resultados sugerem que até 38% de soro de leite natural e fresco pode ser adicionado a uma formulação de apresuntado com resultados similares aos produtos curados com uma formulação convencional.

Do early changes in the HAM-D-17 anxiety/somatization factor items affect treatment outcome among depressed outpatients? Comparison of two controlled trials of St John’s Wort (Hypericum Perforatum) versus an SSRI

Science.gov (United States)

Bitran, Stella; Farabaugh, Amy H; Ameral, Victoria E; LaRocca, Rachel A; Clain, Alisabet J; Fava, Maurizio; Mischoulon, David

2011-01-01

Objective To assess whether early changes in HAM-D-17 anxiety/somatization items predict remission in two controlled studies of hypericum perforatum (St. John’s wort) versus an SSRI for major depressive disorder (MDD). Methods The Hypericum Depression Trial Study Group (NIMH) study randomized 340 subjects to hypericum, sertraline, or placebo for 8 weeks. The MGH study randomized 135 subjects to hypericum, fluoxetine, or placebo for 12 weeks. We examined whether remission was associated with early changes in anxiety/somatization symptoms. Results In the NIMH study, significant associations were observed between remission and early improvement in the anxiety-psychic item (sertraline arm), somatic-gastrointestinal item (hypericum arm), and somatic symptoms-general (placebo arm). None of the three treatment arms of the MGH study showed significant associations between anxiety/somatization symptoms and remission. When both study samples were pooled, we found associations for anxiety-psychic (SSRI arm), somatic-gastrointestinal and hypochondriasis (hypericum arm), and anxiety-psychic and somatic symptoms-general (placebo arm). In the entire sample, remission was associated with improvement in the anxiety-psychic, somatic-gastrointestinal, and somatic symptoms-general items. Conclusions The number and type of anxiety/somatization items associated with remission varied depending on the intervention. Early scrutiny of the HAM-D-17 anxiety/somatization items may help predict remission of MDD. PMID:21278577

Detection of Biogenic Amines in Xuanwei Ham by HPLC%宣威火腿中生物胺的HPLC测定

Institute of Scientific and Technical Information of China (English)

廖国周; 王桂瑛; 曹锦轩; 程志斌

2011-01-01

Biogenic amines content was investigated in Xuanwei ham.Samples were extracted with 0.4 mol/L HClO4,and then derived with dansyl chloride.Separation was achieved using ZORBAX XDB-C18 column and identification,and a quantitative analysis of biogenic amines fraction was carried out using a HPLC system with DAD.Results showed that the linear ranges were 0.5~20 μg/mL,the limit of detection was 0.05~0.1 μg/mL,the recoveries were 81.58%~95.58% and the relative standard deviation were 2.48%~5.85% for eight biogenic amines.Six biogenic amines were detected in Xuanwei ham,the content of β-phenylethylamine,putrescine,cadaverine,tyramine,spermidine and spermine were 0.56 mg/100g,1.45 mg/100g,0.37 mg/100g,3.62 mg/100g,1.26 mg/100g and 4.28 mg/100g,respectively.%以宣威火腿为对象分析其中8种生物胺含量,样品通过0.4 mol/L高氯酸提取后以丹磺酰氯柱前衍生,经ZORBAX XDB-C18柱分离以配备二极管阵列检测器的HPLC对生物胺进行测定。结果表明,该方法中8种生物胺的线性范围为0.5～20μg/mL,检测限为0.05～0.1μg/mL,回收率为81.58%～95.58%,相对标准偏差为2.48%～5.85%,该方法线性范围广,灵敏度和准确度高,可满足定量分析的要求。在宣威火腿中检测出6种生物胺,其中苯乙胺0.56 mg/100g,腐胺1.45 mg/100g,尸胺0.37 mg/100g,酪胺3.62 mg/100g,亚精胺1.26 mg/100g,精胺4.28 mg/100g。

Enhanced inactivation of food-borne pathogens in ready-to-eat sliced ham by near-infrared heating combined with UV-C irradiation and mechanism of the synergistic bactericidal action.

Science.gov (United States)

Ha, Jae-Won; Kang, Dong-Hyun

2015-01-01

The objective of the study described in this article was, first, to investigate the effect of the simultaneous application of near-infrared (NIR) heating and UV irradiation on inactivation of Escherichia coli O157:H7, Salmonella enterica serovar Typhimurium, and Listeria monocytogenes in ready-to-eat (RTE) sliced ham and as well as its effect on product quality and, second, to elucidate the underlying mechanisms of the synergistic bactericidal action of NIR heating and UV irradiation. With the inoculation amounts used, simultaneous NIR-UV combined treatment for 70 s achieved 3.62, 4.17, and 3.43 log CFU reductions of E. coli O157:H7, S. Typhimurium, and L. monocytogenes, respectively. For all three pathogens, the simultaneous application of both technologies resulted in an additional log unit reduction as a result of their synergism compared to the sum of the reductions obtained after the individual treatments. To investigate the mechanisms of NIR-UV synergistic injury for a particular microorganism in a food base, we evaluated the effect of four types of metabolic inhibitors using the overlay method and confirmed that damage to cellular membranes and the inability of cells to repair these structures due to ribosomal damage were the primary factors related to the synergistic lethal effect. Additionally, NIR-UV combined treatment for a maximum of 70 s did not alter the color values or texture parameters of ham slices significantly (P > 0.05). These results suggest that a NIR-UV combined process could be an innovative antimicrobial intervention for RTE meat products. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

APLICACIÓN DE LA DISTANCIA DE HAMMING EN LA EVALUACIÓN DE LA COMPOSICIÓN DE EQUIPOS DE PROYECTOS INFORMÁTICOS

Directory of Open Access Journals (Sweden)

Elizabeth Rodriguez Stiven

2014-06-01

Full Text Available El presente trabajo tiene como propósito realizar una evaluación de la composición de equipos de proyectos informáticos usando técnicas basadas en la comparación con un candidato ideal. Como parte de la investigación se realiza un análisis de la aplicación de esta técnica en la gestión de recursos humanos. Se presenta un modelo de evaluación de la composición de equipos de proyectos informáticos, qué usa como medida de comparación la Distancia de Hamming y como candidatos ideales el “Modelo de Referencia de Equipo de Proyectos Informáticos”. Por último se realiza un análisis del por ciento de evaluaciones correctas realizadas por el modelo y se valida el esquema de clasificación del modelo usando técnicas estadísticas.

BVOC-aerosol-climate interactions in the global aerosol-climate model ECHAM5.5-HAM2

Directory of Open Access Journals (Sweden)

R. Makkonen

2012-11-01

Full Text Available The biosphere emits volatile organic compounds (BVOCs which, after oxidation in the atmosphere, can partition on the existing aerosol population or even form new particles. The large quantities emitted provide means for a large potential impact on both aerosol direct and indirect effects. Biogenic responses to atmospheric temperature change can establish feedbacks even in rather short timescales. However, due to the complexity of organic aerosol partitioning, even the sign of these feedbacks is of large uncertainty. We use the global aerosol-climate model ECHAM5.5-HAM2 to explore the effect of BVOC emissions on new particle formation, clouds and climate. Two BVOC emission models, MEGAN2 and LPJ-GUESS, are used. MEGAN2 shows a 25% increase while LPJ-GUESS shows a slight decrease in global BVOC emission between years 2000 and 2100. The change of shortwave cloud forcing from year 1750 to 2000 ranges from −1.4 to −1.8 W m⁻² with 5 different nucleation mechanisms. We show that the change in shortwave cloud forcing from the year 2000 to 2100 ranges from 1.0 to 1.5 W m⁻². Although increasing future BVOC emissions provide 3–5% additional CCN, the effect on the cloud albedo change is modest. Due to simulated decreases in future cloud cover, the increased CCN concentrations from BVOCs can not provide significant additional cooling in the future.

Auto- and hetero-associative memory using a 2-D optical logic gate

Science.gov (United States)

Chao, Tien-Hsin

1989-06-01

An optical associative memory system suitable for both auto- and hetero-associative recall is demonstrated. This system utilizes Hamming distance as the similarity measure between a binary input and a memory image with the aid of a two-dimensional optical EXCLUSIVE OR (XOR) gate and a parallel electronics comparator module. Based on the Hamming distance measurement, this optical associative memory performs a nearest neighbor search and the result is displayed in the output plane in real-time. This optical associative memory is fast and noniterative and produces no output spurious states as compared with that of the Hopfield neural network model.

Protein removal from waste brines generated during ham salting through acidification and centrifugation.

Science.gov (United States)

Gutiérrez-Martínez, Maria del Rosario; Muñoz-Guerrero, Hernán; Alcaína-Miranda, Maria Isabel; Barat, José Manuel

2014-03-01

The salting step in food processes implies the production of large quantities of waste brines, having high organic load, high conductivity, and other pollutants with high oxygen demand. Direct disposal of the residual brine implies salinization of soil and eutrophication of water. Since most of the organic load of the waste brines comes from proteins leaked from the salted product, precipitation of dissolved proteins by acidification and removal by centrifugation is an operation to be used in waste brine cleaning. The aim of this study is optimizing the conditions for carrying out the separation of proteins from waste brines generated in the pork ham salting operation, by studying the influence of pH, centrifugal force, and centrifugation time. Models for determining the removal of proteins depending on the pH, centrifugal force, and time were obtained. The results showed a high efficacy of the proposed treatment for removing proteins, suggesting that this method could be used for waste brine protein removal. The best pH value to be used in an industrial process seems to be 3, while the obtained results indicate that almost 90% of the proteins from the brine can be removed by acidification followed by centrifugation. A further protein removal from the brine should have to be achieved using filtrating techniques, which efficiency could be highly improved as a consequence of the previous treatment through acidification and centrifugation. Waste brines from meat salting have high organic load and electrical conductivity. Proteins can be removed from the waste brine by acidification and centrifugation. The total protein removal can be up to 90% of the initial content of the waste brine. Protein removal is highly dependent on pH, centrifugation rate, and time. © 2014 Institute of Food Technologists®

On the radiation exposure in temporomandibular joint examinations

International Nuclear Information System (INIS)

Rother, U.; Hildebrandt, K.H.

1979-01-01

The radiation exposure caused by standardized examinations of the temporomandibular joint has been determined with the aid of 660 exposures of an Alderson phantom. Comparative examinations were performed with the classic contact technique according to Parma to elucidate the results obtained. The lowest surface exposure was observed in contact examinations of the temporomandibular joint. Application of a flat cone led to a 13-fold reduction in surface exposure compared to contact examinations according to Parma. Furthermore, radiation exposure strongly decreased from the irradiation field to the adjacent area if a cone (flat cone and ear cone) was used. (author)

Representation of the West African Monsoon System in the aerosol-climate model ECHAM6-HAM2

Science.gov (United States)

Stanelle, Tanja; Lohmann, Ulrike; Bey, Isabelle

2017-04-01

The West African Monsoon (WAM) is a major component of the global monsoon system. The temperature contrast between the Saharan land surface in the North and the sea surface temperature in the South dominates the WAM formation. The West African region receives most of its precipitation during the monsoon season between end of June and September. Therefore the existence of the monsoon is of major social and economic importance. We discuss the ability of the climate model ECHAM6 as well as the coupled aerosol climate model ECHAM6-HAM2 to simulate the major features of the WAM system. The north-south temperature gradient is reproduced by both model versions but all model versions fail in reproducing the precipitation amount south of 10° N. A special focus is on the representation of the nocturnal low level jet (NLLJ) and the corresponding enhancement of low level clouds (LLC) at the Guinea Coast, which are a crucial factor for the regional energy budget. Most global climate models have difficulties to represent these features. The pure climate model ECHAM6 is able to simulate the existence of the NLLJ and LLC, but the model does not represent the pronounced diurnal cycle. Overall, the representation of LLC is worse in the coupled model. We discuss the model behaviors on the basis of outputted temperature and humidity tendencies and try to identify potential processes responsible for the model deficiencies.

Improvement and implementation of a parameterization for shallow cumulus in the global climate model ECHAM5-HAM

Science.gov (United States)

Isotta, Francesco; Spichtinger, Peter; Lohmann, Ulrike; von Salzen, Knut

2010-05-01

Convection is a crucial component of weather and climate. Its parameterization in General Circulation Models (GCMs) is one of the largest sources of uncertainty. Convection redistributes moisture and heat, affects the radiation budget and transports tracers from the PBL to higher levels. Shallow convection is very common over the globe, in particular over the oceans in the trade wind regions. A recently developed shallow convection scheme by von Salzen and McFarlane (2002) is implemented in the ECHAM5-HAM GCM instead of the standard convection scheme by Tiedtke (1989). The scheme of von Salzen and McFarlane (2002) is a bulk parameterization for an ensemble of transient shallow cumuli. A life cycle is considered, as well as inhomogeneities in the horizontal distribution of in-cloud properties due to mixing. The shallow convection scheme is further developed to take the ice phase and precipitation in form of rain and snow into account. The double moment microphysics scheme for cloud droplets and ice crystals implemented is consistent with the stratiform scheme and with the other types of convective clouds. The ice phase permits to alter the criterion to distinguish between shallow convection and the other two types of convection, namely deep and mid-level, which are still calculated by the Tiedtke (1989) scheme. The lunching layer of the test parcel in the shallow convection scheme is chosen as the one with maximum moist static energy in the three lowest levels. The latter is modified to the ``frozen moist static energy'' to account for the ice phase. Moreover, tracers (e.g. aerosols) are transported in the updraft and scavenged in and below clouds. As a first test of the performance of the new scheme and the interaction with the rest of the model, the Barbados Oceanographic and Meteorological EXperiment (BOMEX) and the Rain In Cumulus over the Ocean experiment (RICO) case are simulated with the single column model (SCM) and the results are compared with large eddy

Linnulaul avas aianduskeskuse / Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2006-01-01

AS Trigon Gardening avas märtsis kodu- ja aianduskeskuse Hortes. 60 miljonit krooni maksma läinud keskuse planeeris ning ehitas Hollandi firma Thermoflor BV, üldehitustööd teostas OÜ Celander Ehitus

Prevalence and antibiotic resistance of Enterococcus spp. isolated from retail cheese, ready-to-eat salads, ham, and raw meat.

Science.gov (United States)

Pesavento, G; Calonico, C; Ducci, B; Magnanini, A; Lo Nostro, A

2014-08-01

Food specimens were analyzed in order to research Enterococcus spp.: 636 samples of raw meat (227 beef, 238 poultry, and 171 pork), 278 samples of cheese (110 fresh soft cheese and 168 mozzarella cheese), 214 samples of ready-to-eat salads, and 187 samples of ham. 312 strains of Enterococcus spp samples were isolated, then identified and submitted to susceptibility tests against 11 antimicrobial agents. The predominant species were Enterococcus faecalis in raw meat and Enterococcus faecium in retail products. Low percentages of microorganisms were resistant to vancomycin (3.53%), teicoplanin (2.24%), linezolid (0.32%), and amoxicillin in combination with clavulanic acid (0.32%). A high percentage of resistance was noted in E. faecalis at high level gentamicin (21.9%) and tetracycline (60.6%). In general, strains of E. faecalis were more resistant than E. faecium. Enterococci should be considered not only potential pathogens, but also a reservoir of genes encoding antibiotic resistance which can be transferred to other microorganisms. Continuous monitoring of their incidence and emerging resistance is important in order to identify foods which potentially represent a real risk to the population, and to ensure effective treatment of human enterococcal infections. Copyright © 2014 Elsevier Ltd. All rights reserved.

The Validity of the Different Versions of the Hamilton Depression Scale in Separating Remission Rates of Placebo and Antidepressants in Clinical Trials of Major Depression

DEFF Research Database (Denmark)

Kyle, Phillip Raphael; Lemming, Ole Michael; Timmerby, Nina

2016-01-01

. The traditional HAM-D17 version was compared with the shorter HAM-D6 and the longer HAM-D21 or HAM-D24 in a fixed-dose placebo-controlled vortioxetine study. Clinical Global Impression of Severity scores were used to establish standardized cutoff scores for remission across each scale. Using these cutoff scores......Our objective was to validate the different versions of the Hamilton Depression Scale (HAM-D) both psychometrically (scalability) and clinically in discriminating antidepressants from placebo in terms of remission rates in an 8-week clinical trial in the acute treatment of major depression...... in the longer HAM-D versions indicated smaller discriminating validity over placebo. The HAM-D6 indicated a dose effect on remission for vortioxetine in both moderate and severe major depression. The brief HAM-D6 was thus found superior to HAM-D17, HAM-D21, and HAM-D24 both in terms of scalability...

Effects of sous-vide method at different temperatures, times and vacuum degrees on the quality, structural, and microbiological properties of pork ham.

Science.gov (United States)

Jeong, Kiyoung; O, Hyeonbin; Shin, So Yeon; Kim, Young-Soon

2018-04-10

This study evaluated the influence of different factors on pork hams cooked by sous-vide method. The quality and structural and microbiological properties of the treated samples were compared with those of controls. Samples were subjected to treatment at different combinations of temperature (61 °C or 71 °C), time (45 or 90 min), and vacuum degree (98.81% or 96.58%). The control sample was air packaged and boiled for 45 min in boiling water. Temperature and vacuum degree affected quality properties, while the effect of time was limited. Samples cooked at 61 °C showed higher moisture content, redness, and pink color of the meat juice, whereas samples cooked at 71 °C showed higher cooking loss rate, lightness, and volatile basic nitrogen values. Texture analysis indicated tenderer meat for the treatment group than the control. No microbial growth was detected in any treatment groups. Meat cooked at 61 °C and 98.81% vacuum showed more spacious arrangement of meat fiber. Copyright © 2018 Elsevier Ltd. All rights reserved.

Phosphorus and suspended sediment load estimates for the Lower Boise River, Idaho, 1994-2002

Science.gov (United States)

Donato, Mary M.; MacCoy, Dorene E.

2004-01-01

The U.S. Geological Survey used LOADEST, newly developed load estimation software, to develop regression equations and estimate loads of total phosphorus (TP), dissolved orthophosphorus (OP), and suspended sediment (SS) from January 1994 through September 2002 at four sites on the lower Boise River: Boise River below Diversion Dam near Boise, Boise River at Glenwood Bridge at Boise, Boise River near Middleton, and Boise River near Parma. The objective was to help the Idaho Department of Environmental Quality develop and implement total maximum daily loads (TMDLs) by providing spatial and temporal resolution for phosphorus and sediment loads and enabling load estimates made by mass balance calculations to be refined and validated. Regression models for TP and OP generally were well fit on the basis of regression coefficients of determination (R2), but results varied in quality from site to site. The TP and OP results for Glenwood probably were affected by the upstream wastewater-treatment plant outlet, which provides a variable phosphorus input that is unrelated to river discharge. Regression models for SS generally were statistically well fit. Regression models for Middleton for all constituents, although statistically acceptable, were of limited usefulness because sparse and intermittent discharge data at that site caused many gaps in the resulting estimates. Although the models successfully simulated measured loads under predominant flow conditions, errors in TP and SS estimates at Middleton and in TP estimates at Parma were larger during high- and low-flow conditions. This shortcoming might be improved if additional concentration data for a wider range of flow conditions were available for calibrating the model. The average estimated daily TP load ranged from less than 250 pounds per day (lb/d) at Diversion to nearly 2,200 lb/d at Parma. Estimated TP loads at all four sites displayed cyclical variations coinciding with seasonal fluctuations in discharge

Analysis of nucleation events in the European boundary layer using the regional aerosol–climate model REMO-HAM with a solar radiation-driven OH-proxy

Directory of Open Access Journals (Sweden)

J.-P. Pietikäinen

2014-11-01

Full Text Available This work describes improvements in the regional aerosol–climate model REMO-HAM in order to simulate more realistically the process of atmospheric new particle formation (NPF. A new scheme was implemented to simulate OH radical concentrations using a proxy approach based on observations and also accounting for the effects of clouds upon OH concentrations. Second, the nucleation rate calculation was modified to directly simulate the formation rates of 3 nm particles, which removes some unnecessary steps in the formation rate calculations used earlier in the model. Using the updated model version, NPF over Europe was simulated for the periods 2003–2004 and 2008–2009. The statistics of the simulated particle formation events were subsequently compared to observations from 13 ground-based measurement sites. The new model shows improved agreement with the observed NPF rates compared to former versions and can simulate the event statistics realistically for most parts of Europe.

Restless legs syndrome: a new entity of neuropathic pain? Treatment with prolonged release oxycodone/naloxone combination

Directory of Open Access Journals (Sweden)

Gemignani F

2016-04-01

Full Text Available Franco Gemignani,1 Andrea Melpignano,1,2 Giulia Milioli,1,2 Silvia Riccardi,1,2 Liborio Parrino1,2 1Neurology Unit, Department of Neurosciences, University of Parma, Parma, Italy; 2Sleep Disorders Center, Department of Neurosciences, University of Parma, Parma, Italy Abstract: Restless legs syndrome (RLS is a disorder of sensorimotor integration characterized by an urge to move the legs when at rest, especially at night or in the evening, which is relieved by movement. Sensory symptoms may be prominent, often exhibiting features consistent with neuropathic pain. Iron deficiency and genetic factors are implicated in RLS causation in most patients. The pathogenetic model of impaired circadian dopaminergic modulation of sensorimotor integration circuitry at the spinal level is fitting with the co-occurrence of movement disorders, sensory symptoms, and sleep disruption in RLS. Accordingly, levodopa and dopamine agonists are effective for RLS symptoms, which compensate for the impaired descending control by diencephalo-spinal dopa(minergic pathway. Dopamine agonists are usually indicated as the first-line therapy, but their use in long-term treatment is often complicated by augmentation and impulse control disorder, thus alpha-2-delta ligands also are now considered the first line of treatment. It has been recognized that endogenous opioid system is also involved in the mechanisms generating RLS, possibly through an impaired modulation of pain pathways. Opioids can be considered as an alternative therapy, particularly in patients with augmentation and/or refractory to other treatments. Recently introduced prolonged-release oxycodone–naloxone was efficacious for short-term treatment of patients with severe RLS inadequately controlled with previous treatment. It will be important to assess whether opioids, as well as other drugs, are especially effective in definite RLS subtypes such as the painful phenotype. Keywords: small fiber neuropathy

The effect of different concentrations of citric acid on motility patterns of bovine epididymal sperms in Hams F10 milieu

Directory of Open Access Journals (Sweden)

K Abdy

2008-11-01

Full Text Available The aim of this study was to investigate the effect of three concentration of citric acid on motility patterns of bovine epididymal sperms. For this purpose, 50 pairs of bovine testicles were collected immediately after slaughter form urmia abattoir and transferred to the laboratory alongside 5oc ice pack. Epididymal tail sperms were collected with a few incisions in vascular areas and transferred to hams f10 milieu with 10% fetal calf serum and counted after 15 minutes of incubation at 37oc in Co2 incubator. Concentrations of 50 million sperms per ml were proposal and in the normal sperm pH rang of 6.7-7.4, 0.1, 0.2 and 0.3 normal concentration of citric acid were added to sperm continuity micro tubes (normal concentration of acid equals 7 mg/ml of bovine serum and at 15, 30, 45, 60, 90, 120, 180, 240 and 360 minutes the motility patterns of epididymal sperms were evaluated using the computer assisted sperms analyzing (CASA method. Data were analyzed with one-way ANOVA using the SPSS 15 software. The results indicated significant differences in various indices of sperm motility patterns (Curvilinear   Velocity, Straight-line Velocity, Average Path Velocity, Mean Angel Degree, Amplitude of Lateral Head Displacement, Beat-Cross Frequency, Linearity, Wobble particularly at 0.3 normal concentration of citric acid compared with the control.

Biological Activity Alterations of Human Amniotic Membrane Pre and Post Irradiation Tissue Banking.

Science.gov (United States)

Nemr, Waleed; Bashandy, A S; Araby, Eman; Khamiss, O

Innate immunity of Human Amniotic Membrane (HAM) and its highly active secretome that rich with various types of growth factors and anti-inflammatory substances proposed it as a promising material for many medical studies and applications. This study evaluate the biological activity of cultivated HAM pre and post tissue banking process in which freeze-dried HAM was sterilized by 25 KGray (kGy) dose of γ radiation. The HAM's antimicrobial activity, viability, growth of isolated human amniotic epithelial cells (HAECs), hematopoietic stimulation of co-cultivated murine bone marrow cells (mammalian model), scaffold efficiency for fish brain building up (non-mammalian model) and self re-epithelialization after trypsin denuding treatment were examined as supposed biological activity features. Native HAM revealed viability indications and was active to kill all tested microorganisms; 6 bacterial species (3 Gram-positive and 3 Gram-negative) and Candida albicans as a pathogenic fungus. Also, HAM activity promoted colony formation of murine hematopoietic cells, Tilapia nilotica brain fragment building-up and self re-epithelialization after trypsin treatment. In contrary, radiation-based tissue banking of HAM caused HAM cellular death and consequently lacked almost all of examined biological activity features. Viable HAM was featured with biological activity than fixed HAM prepared by irradiation tissue banking.

Effects of partial replacement of corn and soybean meal with sunflower cake in pig diets on ham fatty acid composition/ Efeitos da substituição parcial de milho e farelo de soja por torta de girassol na dieta de suínos sobre a composição em ácidos graxos do pernil

Directory of Open Access Journals (Sweden)

Nilson Evelázio de Souza

2007-08-01

Full Text Available Forty-eight pigs (24 barrows and 24 gilts, Landrace X Large White with initial liveweight of 22.69 kg were subjected to four treatments: diets with 0, 5, 10, and 15% of sunflower cake (SFC. No significant (P > 0.05 effect of dietary treatment was observed on crude protein (19.6%, total fat (15.3%, ash (0.89%, and moisture (63.9% contents of ham. Fatty acids in all ham (Biceps femoris, Semimembranosus and Semitendinosus were significantly influenced by diets. Palmitic, oleic, and linoleic acids were the most abundant fatty acids in both diets and pork meat. Linoleic acid (18:2n-6 was the most abundant fatty acid under SFC-based diets. Its levels were also higher in ham of pigs fed SFC diets (T2, T3, and T4 with 15.79, 18.66, and 22.85%, respectively than in that of pig fed the control diet (13.73%. Incorporation of 5, 10, and 15% SFC in pig diet markedly decreased the proportion of monounsaturated and saturated fatty acids and increased polyunsaturated fatty acids in ham (P Quarenta e oito suínos (24 fêmeas e 24 machos, Landrace x Large White com peso vivo inicial de 22.69 kg foram submetidos a quatro tratamentos: dietas com 0 , 5, 10 e 15% de torta de girassol (SFC. Não foram observados efeitos significativos (p > 0.05 nas dietas para os teores de proteína total (19,6%, gordura total (15,3%, cinzas (0,89% e umidade (63,9% nos pernis. Os ácidos graxos foram significativamente influenciados pelas dietas. Os ácidos palmítico, oléico e linoléico foram os ácidos graxos mais abundantes tanto nas dietas como no pernil como um todo (Biceps femoris, Semimembranosus and Semitendinosus. Ácido linoléico (18:2n-6 foi o ácido graxo mais abundante nas dietas SFC. Seus níveis também foram maiores em pernis de suínos alimentados com dietas com SFC (T2, T3 e T4 com 15,8, 18,7 e 22,9%, respectivamente em relação aos suínos que se alimentaram com a dieta controle (13,7%. Incorporação de 5, 10, 15% de SFC em dietas de suínos, diminuem a propor

[Alessandro Laurinsich, the key player in the progress of paediatrics in the 20(th) century].

Science.gov (United States)

Farnetani, I; Farnetani, F

2007-02-01

Alessandro Laurinsich was one of the greatest Italian paediatricians of the 20(th) century. He was born in Monfalcone (it was the province of Trieste, but now it belongs to Gorizia) on 29(th) May 1899. After having completed secondary school in Trieste, he obtained a medical degree with honours in 1922 at the University of Naples and entered the paediatric clinic run by Rocco Jemma. Laurinsich was in charge of teaching at the clinic of infectious diseases from 1937 to 1940. During this period he focused on the study of tuberculosis in children, the first applications of pnemoencephalography in Italy, but also studied different malignant tumors of the kidney, neurological and psychological disorders in children, as well as educational problems. In 1940 he had a teaching post in the peadiatric clinic at the University of Siena and remained until 1945 when he moved to Parma. He worked with illegitimate children as well as evacuees. During the 1945-46 academic year, Alessandro Laurinsich was called to direct the paediatric clinic of Parma University where he created a series of paediatric centres and took many initiatives in the area. In 1961 he was offered the paediatric teaching post at the University of Milan, but inexplicably refused it. He was Dean of the faculty of Medicine from 1956 to 1968. He passed away on 2(nd) February 1969 in Parma.

Effects of Locus Bean Gum, Kappa Carrageenan and Iota Carrageenan on the Syneresis, Texture and Some Sensory Characteristics of Cooked Ham / Efecto de la Goma de Algarrobo, la Carragenina Kappa y la Carragenina Iota Sobre la Sinéresis, Textura y Algunas C

Directory of Open Access Journals (Sweden)

César Augusto Sepúlveda Cossio

2013-12-01

Full Text Available The current study evaluated the effect of the additionof locus bean gum (LBG, Kappa carrageenan (KC and Iotacarrageenan (IC on some characteristics of cooked ham. For this purpose, a 2% mixture of LBG: KC: IC was added to the formula of a cooked ham standard brine, established according to the following ratios of 14 treatments (T: (T1: 100% IC; (T2: 100% KC; (T3: 50: 50 LBG: KC mixture; (T4: 50: 50 LBG: IC mixture; (T5: 33.33: 66.67KC: IC mixture; (T6: 66.67: 33.33 KC: IC mixture; (T7: 25: 75 LBG: KC mixture; (T8: 25: 75 LBG: IC mixture; (T9: 50: 16.17: 33.33 LBG: KC: IC mixture; (T10: 50: 33.33: 16.17 LBG: KC: IC mixture; (T11: 25: 56.25: 18.75 LBG: KC: IC mixture; (T12: 25: 18.75: 56.25 LBG: KC: ICmixture; (T13: 12.5: 43.75: 43.75 LBG: KC: IC mixture and (T14: 37.5: 31.25: 31.25 LBG: KC: IC mixture. For all brines, the cooked ham was prepared and extended to 100%, and characteristics of hardness and elasticity were evaluated 14 and 28 days after manufacturing, through a texture analysis profile (TAP; along with syneresis in the packaging (purges by gravimetric analysis and, hardness, elasticityand general appearance; and sensory attributes through a sensory analysis. The lowest syneresis was shown for T11 and the lowest predicted syneresis by a third grade polynomial was shown in the mixtures 18.12: 64.46: 17.42 and 16.36: 65.56: 18.08 of LBG: KC: IC for days 14 and 28, respectively, with a syneresis value of 0.88%and 2.83%; the highest instrumental hardness (TAP was found inT7, and the highest predicted hardness at 14 days was found in mixture 24.72: 75.28 of LBG: KC, with a value of 22.74 N, while the highest predicted elasticity coinciding with a high hardness region was found in mixture 26.21: 67.82 : 8.98 of LBG: KC: IC, with a value of 0.93. In the sensory analysis, T7 and T11 (sampling points closer to these optimal were those that received the best scores in the evaluated parameters.

Imeasi Inglismaal : [Trentham Estate]/ Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2011-01-01

Inglismaa keskosas Staffordshire'i krahvkonnas on üks selle maa külastatavamaid paiku - Trentham Estate. See on suur vabaajakompleks, kuhu kuuluvad kaubanduskeskus, aianduskauplus, ahvide mets, seiklusrada, taimedest labürint, hotell ja aed, mis jaguneb mitmeks omanäoliseks alaks. Hollandi maastikuarhitekt Piet Oudolf on kujundanud preeriaaia, Itaalia aia taastamine usaldati Tom Stuart-Smithile.

Systematic review on strength training in Parkinson’s disease: an unsolved question

Directory of Open Access Journals (Sweden)

Ramazzina I

2017-03-01

Full Text Available Ileana Ramazzina,1 Benedetta Bernazzoli,2 Cosimo Costantino1 1Department of Biomedical, Biotechnological and Translational Sciences, 2Department of Clinical and Experimental Medicine, Graduate School of Rehabilitation and Physical Medicine, University of Parma, Parma, Italy Abstract: The purpose of this study was to investigate the effectiveness of strength training, performed against a different resistance from body weight, in improving motor and nonmotor symptoms in patients with Parkinson’s disease (PD. The following electronic databases were searched: PubMed, Physiotherapy Evidence Database, Cochrane Central Register of Controlled Trials, Scopus, and Web of Science. The review was conducted and reported in accordance with the PRISMA statement. Thirteen high-quality randomized controlled trials were included. Strength training performed against external resistance is well tolerated and appears to be a suitable physical activity to improve both physical parameters and quality of life parameters of PD subjects. However, although the study intervention included strength training, only a few selected studies assessed the improvement of muscle strength. Despite the encouraging results, it is difficult to establish a correlation between strength training and the improvements made. Our review highlights the lack of common intent in terms of study design and the presence of different primary and secondary outcomes. Accordingly, further studies are needed to support the beneficial effects of different types of strength training in PD subjects and to underline the superiority of strength training in PD patients with respect to other training. Keywords: Parkinson’s disease, strength training, muscle strength

Covalent lanthanide(III) macrocyclic complexes: the bonding nature and optical properties of a promising single antenna molecule.

Science.gov (United States)

Rabanal-León, Walter A; Páez-Hernández, Dayán; Arratia-Pérez, Ramiro

2014-12-21

The present work is focused on the elucidation of the electronic structure, bonding nature and optical properties of a series of low symmetry (C2) coordination compounds of type [Ln(III)HAM](3+), where "Ln(III)" are the trivalent lanthanide ions: La(3+), Ce(3+), Eu(3+) and Lu(3+), while "HAM" is the neutral six-nitrogen donor macrocyclic ligand [C22N6H26]. This systematic study has been performed in the framework of the Relativistic Density Functional Theory (R-DFT) and also using a multi-reference approach via the Complete Active Space (CAS) wavefunction treatment with the aim of analyzing their ground state and excited state electronic structures as well as electronic correlation. Furthermore, the use of the energy decomposition scheme proposed by Morokuma-Ziegler and the electron localization function (ELF) allows us to characterize the bonding between the lanthanide ions and the macrocyclic ligand, obtaining as a result a dative-covalent interaction. Due to a great deal of lanthanide optical properties and their technological applications, the absorption spectra of this set of coordination compounds were calculated using the time-dependent density functional theory (TD-DFT), where the presence of the intense Ligand to Metal Charge Transfer (LMCT) bands in the ultraviolet and visible region and the inherent f-f electronic transitions in the Near-Infra Red (NIR) region for some lanthanide ions allow us to propose these systems as "single antenna molecules" with potential applications in NIR technologies.

Lipid stability of ham and fresh sausages of pigs treated with diets containing high levels of phytic acidEstabilidade lipídica do pernil e da linguiça frescal de suínos tratados com dietas com alta concentração de ácido fítico

Directory of Open Access Journals (Sweden)

Piero Agostini da Silva

2011-12-01

Full Text Available The experiment evaluated the effects of different periods of inclusion of defatted corn germ meal (DCGM, as a principal ingredient and source of phytic acid in the rations of finishing swine, on the chemical and sensorial characteristics and on the preservation of lipid oxidation of ham and the fresh sausage. Twenty four borrows with 75.408 ± 4.407 kg of initial weight and 123 days of age, with the same genetic basis were used. The experimental treatments were represented by the inclusion of 50% of DCGM in the finishing swine rations during 0, 7, 14 and 21 days before of slaughter, where were defined four treatments. The pigs were fed ad libitum during 28 days. After the slaughter, it was collected the ham of the half carcass and samples of the ham’s muscles were used to elaborate the fresh sausages. The approximate chemical composition, the color and the lipid stability of ham and fresh sausage were evaluated. The experimental design was a randomized blocks (based on initial pigs weight with 6 replications per treatment. There were no regression effects over the evaluated parameters, where the DCGM did not affect the approximate chemical composition and the color of the samples. There were no differences between the treatments for ham and fresh sausage for the lipid stability according the different periods of inclusion of DCGM. The high inclusion of DCGM in the finishing pig rations until 21 days before the slaughter didn’t improve the quality characteristics and the oxidation of ham and fresh sausage. experimento avaliou o efeito de diferentes períodos de inclusão do farelo de gérmen de milho desengordurado (FGMD, como principal ingrediente e fonte de ácido fítico em rações de suínos em fase de terminação, sobre as características químicas, sensoriais e de preservação da oxidação no pernil e na linguiça frescal. Foram utilizados 24 suínos machos de mesma genética comercial com peso médio inicial de 75,408 ± 4,407 kg

Intravenous methylprednisolone in HTLV-I associated myelopathy/tropical spastic paraparesis (HAM/TSP Metilprednisolona endovenosa na mielopatia associada ao HTLV-I/Paraparesia Espástica Tropical (MAH/PET

Directory of Open Access Journals (Sweden)

Abelardo Q-C Araújo

1993-09-01

Full Text Available HTLV-I (Human T-lymphotropic virus type I associated myelopathy/tropical spastic paraparesis (HAM/TSP is an immunomediated myelopathy induced by the HTLV-I. Some patients, specially those from Japan, seem to have a good response to steroid treatment. However, this has not been found in other regions of the world. High dose intravenous methylprednisolone has been used with success in patients with relapses of multiple sclerosis (MS, another autoimmune disease of the central nervous system. To test the effectiveness of methylprednisolone in patients with HAM/TSP, we devised an open trial in 23 patients. We found a very limited benefit of this form of treatment in these patients. Only one patient, who had the shortest disease duration (five months in the whole group, showed a sustained benefit. We speculate that those patients with a shorter history, with presumably less demye-lination and more inflammatory lesions, would show a better response to immunossupressive treatments.A mielopatia associada ao protovírus T-linfotrópico humano (HTLV-I, também conhecida como paraparesia espástica tropical associada ao HTLV-I (MAH/PET, constitui enfermidade imunomediada desencadeada pela infecção pelo HTLV-I. Nesta condição tem sido demonstrada, particularmente em pacientes japoneses, boa resposta clínica à terapêutica com corticosteróides. Este efeito benéfico todavia não foi encontrado em todas as regiões do mundo. Pulsoterapia com metilprednisolona endovenosa tem sido utilizada com sucesso em pacientes com esclerose múltipla, outro exemplo de doença auto-imune do sistema nervoso central, especialmente durante as fases de exacerbação da doença. Objetivando testar a eficácia da pulsoterapia com metilprednisolona em pacientes com MAH/PET, conduzimos estudo aberto em 23 doentes. Não constatamos efeito benéfico significativo desta forma de tratamento na maioria dos enfermos estudados. Apenas um dos pacientes, o qual exibia o menor tempo de

Sampling and systematic error in a burrow index to measure relative population size in the common vole

Czech Academy of Sciences Publication Activity Database

Lisická, L.; Heroldová, Marta; Losík, J.; Tkadlec, Emil

-, supp. (2006), s. 81 ISSN 1825-5272. [Rodens & Spatium /10./. 24.07.2006-28.07.2006, Parma] Institutional research plan: CEZ:AV0Z60930519 Keywords : common vole * population size Subject RIV: EH - Ecology, Behaviour

Application of human amniotic mesenchymal cells as an allogeneic transplantation cell source in bone regenerative therapy

Energy Technology Data Exchange (ETDEWEB)

Tsuno, Hiroaki [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Department of Oral and Maxillofacial Surgery, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Yoshida, Toshiko [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Nogami, Makiko [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Department of Orthopedic Surgery, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Koike, Chika; Okabe, Motonori [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Noto, Zenko [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Department of Oral and Maxillofacial Surgery, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Arai, Naoya; Noguchi, Makoto [Department of Oral and Maxillofacial Surgery, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan); Nikaido, Toshio, E-mail: tnikaido@med.u-toyama.ac.jp [Department of Regenerative Medicine, Graduate School of Medicine and Pharmaceutical Sciences for Research, University of Toyama, 2630 Sugitani Toyama, Toyama 930-0194 (Japan)

2012-12-01

Autogenous mesenchymal stem cells (MSCs) have therapeutic applications in bone regenerative therapy due to their pluripotency. However, the ability of MSCs to proliferate and differentiate varies between donors. Furthermore, alternative sources of MSCs are required for patients with contraindications to autogenous cell therapy. The aim of this study was to evaluate the potential of mesenchymal cells from the human amniotic membrane (HAM) as a source of cells for allogeneic transplantation in bone regenerative therapy. Cells that retained a proliferative capacity of more than 50 population doubling level were distinguished from other HAM cells as HAM{alpha} cells and induced to osteogenic status-their in vivo osteogenesis was subsequently investigated in rats. It was found that HAM{alpha} cells were spindle shaped and were positive for MSC markers and negative for hematopoietic stem cell markers. Alkaline phosphatase activity and calcium deposition increased with osteogenic status of HAM{alpha} cells. The expression of osteocalcin mRNA was increased in HAM{alpha} cells cultured on calcium phosphate scaffolds. Moreover, xenografted HAM{alpha} cells remained viable and produced extracellular matrix for several weeks. Thus, this study suggests that human amniotic mesenchymal cells possess osteogenic differentiation potential and could be applied to allogeneic transplantation in bone regenerative therapy. - Highlights: Black-Right-Pointing-Pointer Human amniotic mesenchymal cells include cells (HAM{alpha} cells) that have the properties of MSCs. Black-Right-Pointing-Pointer HAM{alpha} cells have excellent osteogenic differentiation potential. Black-Right-Pointing-Pointer Osteogenic differentiation ability of HAM{alpha} was amplified by calcium phosphate scaffolds. Black-Right-Pointing-Pointer HAM{alpha} cells can be applicable to allogeneic cell transplantation in bone regenerative therapy.

Potential of yeasts isolated from dry-cured ham to control ochratoxin A production in meat models.

Science.gov (United States)

Peromingo, Belén; Núñez, Félix; Rodríguez, Alicia; Alía, Alberto; Andrade, María J

2018-03-02

The environmental conditions reached during the ripening of dry-cured meat products favour the proliferation of moulds on their surface. Some of these moulds are hazardous to consumers because of their ability to produce ochratoxin A (OTA). Biocontrol using Debaryomyces hansenii could be a suitable strategy to prevent the growth of ochratoxigenic moulds and OTA accumulation in dry-cured meat products. The aim of this work was to evaluate the ability of two strains of D. hansenii to control the growth and OTA production of Penicillium verrucosum in a meat model under water activities (a w ) values commonly reached during the dry-cured meat product ripening. The presence of D. hansenii strains triggered a lengthening of the lag phase and a decrease of the growth rate of P. verrucosum in meat-based media at 0.97 and 0.92 a w . Both D. hansenii strains significantly reduced OTA production (between 85.16 and 92.63%) by P. verrucosum in the meat-based medium at 0.92 a w . Neither absorption nor detoxification of OTA by D. hansenii strains seems to be involved. However, a repression of the expression of the non-ribosomal peptide synthetase (otanpsPN) gene linked to the OTA biosynthetic pathway was observed in the presence of D. hansenii. To confirm the protective role of D. hansenii strains, they were inoculated together with P. verrucosum Pv45 in dry-fermented sausage and dry-cured ham slices. Although P. verrucosum Pv45 counts were not affected by the presence of D. hansenii in both meat matrices, a reduction of OTA amount was observed. Therefore, the effect of D. hansenii strains on OTA accumulation should be attributed to a reduction at transcriptional level. Consequently, native D. hansenii can be useful as biocontrol agent in dry-cured meat products for preventing the hazard associated with the presence of OTA. Copyright © 2018 Elsevier B.V. All rights reserved.

Depression and anxiety in hyperthyroidism.

Science.gov (United States)

Demet, Mehmet Murat; Ozmen, Bilgin; Deveci, Artuner; Boyvada, Sibel; Adigüzel, Hakan; Aydemir, Omer

2002-01-01

Our objective was to determine symptomatology of depression and anxiety in patients with untreated hyperthyroidism and compare with euthyroid patients. Thirty-two patients with hyperthyroidism (high free T3 and free T4, and suppressed TSH) and 30 euthyroid (normal free T3, free T4, and TSH) controls attending the Endocrinology Out-Patient Department at Celal Bayar University Hospital in Manisa, Turkey were included in the study. Hormonal screening was performed by immunoassay and hemagglutination method. For psychiatric assessment, Hospital Anxiety and Depression Scale [HAD], Hamilton Depression Rating Scale [HAM-D], and Hamilton Anxiety Rating Scale [HAM-A] were used. There was no difference between the two groups in terms of demographic features. Total scores obtained both from HAM-D and HAM-A were significantly greater in the hyperthyroidism group than that of the euthyroid group (p weight loss (HAM-D#16), insomnia (HAM-A#4), and cardiovascular symptoms (HAM-A#8) were significantly more frequent in the hyperthyroidism group. By Wilks lambda discriminant analysis, psychomotor agitation (HAM-D#9), weight loss (HAM-D#16), and insomnia (HAM-A#4) were found as the discriminating symptoms for the hyperthyroidism group, whereas somatic anxiety (HAM-A#11) and loss of interest (HAD#14) were distinguishing symptoms of the euthyroidism group. Hyperthyroidism and syndromal depression-anxiety have overlapping features that can cause misdiagnosis during acute phase. For differential diagnosis, one should follow-up patients with hyperthyroidism with specific hormonal treatment and evaluate persisting symptoms thereafter. In addition to specific symptoms of hyperthyroidism, psychomotor retardation, guilt, muscle pain, energy loss, and fatigue seem to appear more frequently in patients with comorbid depression and hyperthyroidism; thus, presence of these symptoms should be a warning sign to nonpsychiatric professionals for the need for psychiatric consultation.

Study of volatile alcohols and esters from the subcutaneous fat during ripening of Iberian dry-cured ham. A tool for predicting the dry-curing time; Estudio de los alcoholes y ésteres volátiles de la grasa subcutánea durante la maduración del jamón ibérico. Una herramienta para predecir el tiempo de curación

Energy Technology Data Exchange (ETDEWEB)

Narvaez-Rivas, M.; Gallardo, E.; Leon-Camacho, M.

2016-07-01

Variations in the amounts of volatile alcohols and esters from subcutaneous fat have been assessed during the dry-curing process (1022 days) of Iberian ham according to a purge and trap-gas chromatography-mass spectroscopy method, using the same hams throughout the process. During processing time, the subcutaneous adipose tissues of ten hams obtained from five Iberian pigs fed on acorns and pasture were sampled and analyzed once per month. Fifteen alcohols and five esters have been identified. All volatile alcohols detected in this work have been previously identified by other authors on Iberian ham, except 3-buten-2-ol, 5-methyl-3-hexanol and 2-isononanol. A linear discriminant analysis (LDA) was applied and the two discriminant functions were obtained using backward stepwise analysis retaining the following variables: butyl ester formic acid, 1-penten-3-ol, methyl ester 2-propenoic acid, 5-methyl-3-hexanol, 1-nonanol, ethyl ester pentanoic acid, ethyl ester hexanoic acid, 2-isononanol, ethanol and 3-buten-2-ol. A complete separation among the three periods was obtained, suggesting that the retained variables are powerful descriptors to distinguish samples from these three dry-curing stages. [Spanish] Se han evaluado durante el proceso de curación (1022 días), las variaciones en los contenidos de alcoholes y ésteres volátiles de la grasa subcutánea del jamón ibérico mediante la técnica de acoplamiento purga y trampa- cromatografía de gases-espectrometría de masas, utilizando los mismos jamones a lo largo de todo el proceso. Durante el tiempo de curación se muestreó y analizó una vez al mes el tejido adiposo subcutáneo de diez jamones procedente de cinco cerdos ibéricos alimentados con bellotas y pastos. Se han identificado quince alcoholes y cinco ésteres volátiles. Todos los alcoholes descritos en este trabajo han sido identificados previamente por otros autores en el jamón ibérico, excepto el 3-buten-2-ol, el 5-metil-3-hexanol y el 2

Food Service Alternatives for Meals Away from the Dining Facility

Science.gov (United States)

1984-06-01

Chicken Salad Ham Salad Italian Cold Cuts Roast Beef Ham Turkey Hot Meatball with Cheese Hot Sausage Egg Roll Fried Rice Beef and Vegetables Desserts...Salami Provolone American Cheese Swiss Cheese Tuna Salad Egg Salad Chicken Salad Ham Salad *Hot Sausage *Hot Meatball with Cheese Chili Beef...Cake Ham Brownies Hot Sausage Puddings Hot Meatball with Cheese Jello Shaved Steak with Pie Eggs Cookies Cheese Cole Slaw Onions Macaroni Salad Peppers

Evaluation of Human Amniotic Membrane as a Wound Dressing for Split-Thickness Skin-Graft Donor Sites

Directory of Open Access Journals (Sweden)

Denys J. Loeffelbein

2014-01-01

Full Text Available Human amniotic membrane (HAM has been used as a biomaterial in various surgical procedures and exceeds some qualities of common materials. We evaluated HAM as wound dressing for split-thickness skin-graft (STSG donor sites in a swine model (Part A and a clinical trial (Part B. Part A: STSG donor sites in 4 piglets were treated with HAM or a clinically used conventional polyurethane (PU foil (n=8 each. Biopsies were taken on days 5, 7, 10, 20, 40, and 60 and investigated immunohistochemically for alpha-smooth muscle actin (αSMA: wound contraction marker, von Willebrand factor (vWF: angiogenesis, Ki-67 (cell proliferation, and laminin (basement membrane integrity. Part B: STSG donor sites in 45 adult patients (16 female/29 male were treated with HAM covered by PU foam, solely by PU foam, or PU foil/paraffin gauze (n=15 each. Part A revealed no difference in the rate of wound closure between groups. HAM showed improved esthetic results and inhibitory effects on cicatrization. Angioneogenesis was reduced, and basement membrane formation was accelerated in HAM group. Part B: no difference in re-epithelialization/infection rate was found. HAM caused less ichor exudation and less pruritus. HAM has no relevant advantage over conventional dressings but might be a cost-effective alternative.

DILL teeb Tallinna kolmandas maailmas tuntuks / Virve Liivanõmm

Index Scriptorium Estoniae

Liivanõmm, Virve

2010-01-01

DILL on Euroopa kolme ülikooli (Oslo, Parma, Tallinna) ingliskeelne magistriõppekava peamiselt kolmandatest riikidest tudengitele, mida Euroopa Liit rahastab Erasmus Mundus programmi raames. Eestis koordineerib ja juhendab enamikku Tallinnas tehtavatest magistritöödest TLÜ infoteaduste instituudi lektor Sirje Virkus

A pulse radiolytic study of some radiosensitizing and radioprotective substances

International Nuclear Information System (INIS)

Sjoeberg, L.

1981-01-01

The one-electron reduction potentials for substituted nitroimidazoles and nitrobenzenes in aqueous solution have been correlated to their electron affinities calculated by the semiempirical quantum mechanical method HAM/3. This procedure implies the validity of a Hammet like equation for the substances studied. Glutathione has been shown to compete with oxygen for radiation induced radicals. Hence the reaction of the hydroxyl radical with glutathione in neutral and alkaline aqueous solution was investigated in some detail. A reaction scheme involving a pH dependent formation of thiyl, and carbon centered radicals is given. (Auth.)

Combining pain therapy with lifestyle: the role of personalized nutrition and nutritional supplements according to the SIMPAR Feed Your Destiny approach

Directory of Open Access Journals (Sweden)

De Gregori M

2016-12-01

Full Text Available Manuela De Gregori,1–3 Carolina Muscoli,2,4,5 Michael E Schatman,2,6 Tiziana Stallone,2,7 Fabio Intelligente,2,8 Mariangela Rondanelli,2,9 Francesco Franceschi,2,10 Laura Isabel Arranz,2,11 Silvia Lorente-Cebrián,2,12 Maurizio Salamone,2,13,14 Sara Ilari,2,5 Inna Belfer,2,15 Massimo Allegri2,16,17 1Pain Therapy Service, Fondazione IRCCS Policlinico San Matteo, Pavia, Italy; 2Study in Multidisciplinary Pain Research Group, 3Young Against Pain Group, Parma, Italy; 4Department of Health Sciences, Institute of Research for Food Safety and Health, University “Magna Graecia” of Catanzaro, Parma, Italy; 5IRCCS San Raffaele Pisana, Roccelletta di Borgia, Catanzaro, Italy; 6US Pain Foundation, Bellevue, WA, USA; 7ENPAB, Rome, 8Chronic Pain Service Anestesia Day-Surgery, IRCCS Humanitas Research Hospital, Rozzano, 9Department of Public Health, Section of Human Nutrition and Dietetics, Azienda di Servizi alla Persona di Pavia, University of Pavia, Pavia, 10Institute of Internal Medicine, Catholic University of Rome, Rome, Italy; 11Department of Nutrition, Food Sciences and Gastronomy, University of Barcelona, Barcelona, 12Department of Nutrition, Food Science and Physiology, Center for Nutrition Research, University of Navarra, Pamplona, Spain; 13Metagenics Italia srl, Milano, 14Italian Lifestyle Medicine Association, Bari, Italy; 15Faculty of Dentistry, McGill University, Montreal, QC, Canada; 16Department of Surgical Sciences, University of Parma, 17Anesthesia, Intensive Care and Pain Therapy Service, Azienda Ospedaliero, Universitaria of Parma, Parma, Italy Abstract: Recently, attention to the lifestyle of patients has been rapidly increasing in the field of pain therapy, particularly with regard to the role of nutrition in pain development and its management. In this review, we summarize the latest findings on the role of nutrition and nutraceuticals, microbiome, obesity, soy, omega-3 fatty acids, and curcumin supplementation as key elements in

Generalized anxiety disorder and the Hamilton Anxiety Rating Scale in Parkinson's disease Transtorno de ansiedade generalizada e a Escala de Ansiedade de Hamilton na doença de Parkinson

Directory of Open Access Journals (Sweden)

Arthur Kummer

2010-08-01

Full Text Available Anxiety is common in Parkinson's disease (PD, but studies concerning specific anxiety disorders are scarce. Essential psychometric properties of anxiety rating scales are also lacking. OBJECTIVE: To investigate general anxiety disorder (GAD in PD and psychometric properties of the Hamilton Anxiety Rating Scale (Ham-A. METHOD: Ninety-one PD patients underwent neurological and psychiatric examination, which included the MINI-Plus, the Ham-A and the Hamilton Depression Rating Scale (Ham-D. RESULTS: GAD was present in 30.8% of PD patients. Patients with GAD had longer disease duration (p=0.044 and were in use of higher doses of levodopa (p=0.034. They also tended to have more motor fluctuations and dyskinesias. The group with GAD scored higher in Ham-A (pAnsiedade é comum na doença de Parkinson (DP, mas estudos sobre transtornos de ansiedade específicos são ainda escassos. Faltam também estudos sobre propriedades psicométricas essenciais das escalas de ansiedade. OBJETIVO: Investigar o transtorno de ansiedade generalizada (TAG na DP e propriedades psicométricas da Escala de Ansiedade de Hamilton (Ham-A. MÉTODO: Noventa e um pacientes com DP se submeteram a exames neurológico e psiquiátrico, que incluiu o MINI-Plus, a Ham-A e a Escala de Depressão de Hamilton (Ham-D. RESULTADOS: TAG esteve presente em 30,8% dos participantes. Pacientes com TAG tinham maior duração de doença (p=0,044 e estavam em uso de maiores doses de levodopa (p=0,034. Também havia uma tendência desses pacientes terem mais flutuações motoras e discinesias. O grupo com TAG pontuou mais alto na Ham-A (p<0,001, nas subescalas somática (p<0,001 e psíquica da Ham-A (p<0,001, e na Ham-D (p=0,004. A Ham-A mostrou boa consistência interna (alfa de Cronbach=0,893 e um ponto de corte de 10/11 é sugerido para triar o TAG. CONCLUSÃO: TAG é freqüente na DP e a Ham-A pode ser um instrumento útil para triar esse transtorno.

The Interday Measurement Consistency of and Relationships Between Hamstring and Leg Musculo-articular Stiffness.

Science.gov (United States)

Waxman, Justin P; Schmitz, Randy J; Shultz, Sandra J

2015-10-01

Hamstring stiffness (K(HAM)) and leg stiffness (K(LEG)) are commonly examined relative to athletic performance and injury risk. Given these may be modifiable, it is important to understand day-to-day variations inherent in these measures before use in training studies. In addition, the extent to which K(HAM) and K(LEG) measure similar active stiffness characteristics has not been established. We investigated the interday measurement consistency of K(HAM) and K(LEG), and examined the extent to which K(LEG) predicted K(HAM) in 6 males and 9 females. K(HAM) was moderately consistent day-to-day (ICC(2,5) = .71; SEM = 76.3 N·m(-1)), and 95% limits of agreement (95% LOA) revealed a systematic bias with considerable absolute measurement error (95% LOA = 89.6 ± 224.8 N·m(-1)). Day-to-day differences in procedural factors explained 59.4% of the variance in day-to-day differences in K(HAM). Bilateral and unilateral K(LEG) was more consistent (ICC(2,3) range = .87-.94; SEM range = 1.0-2.91 kN·m(-1)) with lower absolute error (95% LOA bilateral= -2.0 ± 10.3; left leg = -0.36 ± 3.82; right leg = -1.05 ± 3.61 kN·m(-1)). K(LEG) explained 44% of the variance in K(HAM) (P consistent and precise K(HAM) measures. The ease and consistency of K(LEG), and moderate correlation with K(HAM), may steer clinicians toward K(LEG) when measuring lower-extremity stiffness for screening studies and monitoring the effectiveness of training interventions over time.

Auto and hetero-associative memory using a 2-D optical logic gate

Science.gov (United States)

Chao, Tien-Hsin (Inventor)

1992-01-01

An optical system for auto-associative and hetero-associative recall utilizing Hamming distance as the similarity measure between a binary input image vector V(sup k) and a binary image vector V(sup m) in a first memory array using an optical Exclusive-OR gate for multiplication of each of a plurality of different binary image vectors in memory by the input image vector. After integrating the light of each product V(sup k) x V(sup m), a shortest Hamming distance detection electronics module determines which product has the lowest light intensity and emits a signal that activates a light emitting diode to illuminate a corresponding image vector in a second memory array for display. That corresponding image vector is identical to the memory image vector V(sup m) in the first memory array for auto-associative recall or related to it, such as by name, for hetero-associative recall.

Dimensionality and predictive validity of the HAM-Nat, a test of natural sciences for medical school admission.

Science.gov (United States)

Hissbach, Johanna C; Klusmann, Dietrich; Hampe, Wolfgang

2011-10-14

Knowledge in natural sciences generally predicts study performance in the first two years of the medical curriculum. In order to reduce delay and dropout in the preclinical years, Hamburg Medical School decided to develop a natural science test (HAM-Nat) for student selection. In the present study, two different approaches to scale construction are presented: a unidimensional scale and a scale composed of three subject specific dimensions. Their psychometric properties and relations to academic success are compared. 334 first year medical students of the 2006 cohort responded to 52 multiple choice items from biology, physics, and chemistry. For the construction of scales we generated two random subsamples, one for development and one for validation. In the development sample, unidimensional item sets were extracted from the item pool by means of weighted least squares (WLS) factor analysis, and subsequently fitted to the Rasch model. In the validation sample, the scales were subjected to confirmatory factor analysis and, again, Rasch modelling. The outcome measure was academic success after two years. Although the correlational structure within the item set is weak, a unidimensional scale could be fitted to the Rasch model. However, psychometric properties of this scale deteriorated in the validation sample. A model with three highly correlated subject specific factors performed better. All summary scales predicted academic success with an odds ratio of about 2.0. Prediction was independent of high school grades and there was a slight tendency for prediction to be better in females than in males. A model separating biology, physics, and chemistry into different Rasch scales seems to be more suitable for item bank development than a unidimensional model, even when these scales are highly correlated and enter into a global score. When such a combination scale is used to select the upper quartile of applicants, the proportion of successful completion of the curriculum

Dimensionality and predictive validity of the HAM-Nat, a test of natural sciences for medical school admission

Directory of Open Access Journals (Sweden)

Hissbach Johanna C

2011-10-01

Full Text Available Abstract Background Knowledge in natural sciences generally predicts study performance in the first two years of the medical curriculum. In order to reduce delay and dropout in the preclinical years, Hamburg Medical School decided to develop a natural science test (HAM-Nat for student selection. In the present study, two different approaches to scale construction are presented: a unidimensional scale and a scale composed of three subject specific dimensions. Their psychometric properties and relations to academic success are compared. Methods 334 first year medical students of the 2006 cohort responded to 52 multiple choice items from biology, physics, and chemistry. For the construction of scales we generated two random subsamples, one for development and one for validation. In the development sample, unidimensional item sets were extracted from the item pool by means of weighted least squares (WLS factor analysis, and subsequently fitted to the Rasch model. In the validation sample, the scales were subjected to confirmatory factor analysis and, again, Rasch modelling. The outcome measure was academic success after two years. Results Although the correlational structure within the item set is weak, a unidimensional scale could be fitted to the Rasch model. However, psychometric properties of this scale deteriorated in the validation sample. A model with three highly correlated subject specific factors performed better. All summary scales predicted academic success with an odds ratio of about 2.0. Prediction was independent of high school grades and there was a slight tendency for prediction to be better in females than in males. Conclusions A model separating biology, physics, and chemistry into different Rasch scales seems to be more suitable for item bank development than a unidimensional model, even when these scales are highly correlated and enter into a global score. When such a combination scale is used to select the upper quartile of

Factor structure and dimensionality of the two depression scales in STAR*D using level 1 datasets.

Science.gov (United States)

Bech, P; Fava, M; Trivedi, M H; Wisniewski, S R; Rush, A J

2011-08-01

The factor structure and dimensionality of the HAM-D(17) and the IDS-C(30) are as yet uncertain, because psychometric analyses of these scales have been performed without a clear separation between factor structure profile and dimensionality (total scores being a sufficient statistic). The first treatment step (Level 1) in the STAR*D study provided a dataset of 4041 outpatients with DSM-IV nonpsychotic major depression. The HAM-D(17) and IDS-C(30) were evaluated by principal component analysis (PCA) without rotation. Mokken analysis tested the unidimensionality of the IDS-C(6), which corresponds to the unidimensional HAM-D(6.) For both the HAM-D(17) and IDS-C(30), PCA identified a bi-directional factor contrasting the depressive symptoms versus the neurovegetative symptoms. The HAM-D(6) and the corresponding IDS-C(6) symptoms all emerged in the depression factor. Both the HAM-D(6) and IDS-C(6) were found to be unidimensional scales, i.e., their total scores are each a sufficient statistic for the measurement of depressive states. STAR*D used only one medication in Level 1. The unidimensional HAM-D(6) and IDS-C(6) should be used when evaluating the pure clinical effect of antidepressive treatment, whereas the multidimensional HAM-D(17) and IDS-C(30) should be considered when selecting antidepressant treatment. Copyright © 2011 Elsevier B.V. All rights reserved.

Impact of coupled heat and moisture transfer effects on buildings energy consuption

Directory of Open Access Journals (Sweden)

Ferroukhi Mohammed Yacine

2017-01-01

Full Text Available Coupled heat, air, and moisture transfers through building envelope have an important effect on prediction of building energy requirements. Several works were conducted in order to integrate hygrothermal transfers in dynamic buildings simulations codes. However, the incorporation of multidirectional hygrothermal transfer analysis in the envelope into building simulation tools is rarely considered. In this work, coupled heat, air, and moisture (HAM transfer model in multilayer walls was established. Thereafter, the HAM model is coupled dynamically to a building behavior code (BES.The coupling concerns a co-simulation between COMSOL Multiphysics and TRNSYS software. Afterward, the HAM-BES co-simulation accuracy was verified. Then, HAM-BES co-simulation platform was applied to a case study with various types of climates (temperate, hot and humid, cold and humid. Three simulations cases were carried out. The first simulation case consists of the TRNSYS model without HAM transfer model. The second simulation case, 1-D HAM model for the envelope was integrated in TRNSYS code. For the third one, 1-D HAM model for the wall and 2-D HAM model for thermal bridges were coupled to the thermal building model of TRNSYS. Analysis of the results confirms the significant impact of 2-D envelope hygrothermal transfers on the indoor thermal and moisture behavior of building as well as on the energy building assessment. These conclusions are shown for different studied climates.

Optimization of Replacing Pork Meat with Yellow Worm (Tenebrio molitor L.) for Frankfurters

Science.gov (United States)

Paik, Hyun-Dong

2017-01-01

The effects of replacing pork meat with yellow mealworms on the physicochemical properties and sensory characteristics of frankfurters were investigated in this study. The control (50% pork ham), T1 (45% pork ham + 5% yellow mealworm), T2 (40% pork ham + 10% yellow mealworm), T3 (35% pork ham + 15% yellow mealworm), T4 (30% pork ham + 20% yellow mealworm), T5 (25% pork ham + 25% yellow mealworm), and T6 (20% pork ham + 30% yellow mealworm) were prepared, replacing lean pork meat with yellow mealworm. The moisture content, lightness, sarcoplasmic protein solubility, hardness, gumminess, chewiness, and apparent viscosity of frankfurters with yellow mealworm were lower than those of the control (pmealworm were higher than those of the control (pmealworm concentrations (pmealworm concentrations had lower color, flavor, off-flavor, and juiciness scores. The overall acceptability was not significantly different in the control, T1, and T2 (p>0.05). Thus, the results of this study showed that replacing lean pork meat with up to 10% yellow mealworm successfully maintained the quality of frankfurters at a level similar to that of the regular control frankfurters. PMID:29147084

Possible etiologies for tropical spastic paraparesis and human T lymphotropic virus I-associated myelopathy

Directory of Open Access Journals (Sweden)

V. Zaninovic'

2004-01-01

Full Text Available The epidemiology of tropical spastic paraparesis/human T lymphotropic virus I (HTLV-I-associated myelopathy (TSP/HAM is frequently inconsistent and suggests environmental factors in the etiology of these syndromes. The neuropathology corresponds to a toxometabolic or autoimmune process and possibly not to a viral disease. Some logical hypotheses about the etiology and physiopathology of TSP and HAM are proposed. Glutamate-mediated excitotoxicity, central distal axonopathies, cassava, lathyrism and cycad toxicity may explain most cases of TSP. The damage caused to astrocytes and to the blood-brain barrier by HTLV-I plus xenobiotics may explain most cases of HAM. Analysis of the HTLV-I/xenobiotic ratio clarifies most of the paradoxical epidemiology of TSP and HAM. Modern neurotoxicology, neuroimmunology and molecular biology may explain the neuropathology of TSP and HAM. It is quite possible that there are other xenobiotics implicated in the etiology of some TSP/HAMs. The prevention of these syndromes appears to be possible today.

Mavi Yengecin (Callinectes Sapidus Rathbun 1896 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

Directory of Open Access Journals (Sweden)

Hasan H. Atar

2015-02-01

Full Text Available Bu araştırmada, mavi yengecin (Callinectes sapiduset verimi ile etinin kuru madde, su, ham protein, ham yağ ve ham kül gibi besin maddelerinin belirlenmesi amaçlanmıştır. Mavi yengecin canlı ağırlık ortalaması 128.044±10.71 g, ortalama toplam et miktarı 24.365±2.25 g ve toplam et verimi % 23.060 olarak saptanmıştır. Besin maddeleri ile ilgili analiz sonuçlarına göre; mavi yengecin etinde ortalama su, kuru madde, ham protein, ham yağ, ham kül, kalsiyum ve fosfor oranları kıskaçta sırasıyla %77.40, % 22.60, %17.60, % 0.22, % 3.20, %0.20, %0.18 ve abdomende sırasıyla %77.80, %22.20, %17.50, %2.40, %0.37, %0.09, % 0.04 olarak tespit edilmiştir.

A Preliminary Study of Human Amniotic Membrane as a Potential Chondrocyte Carrier

Directory of Open Access Journals (Sweden)

L Boo

2009-11-01

Full Text Available PURPOSE: To investigate the feasibility of using processed human amniotic membrane (HAM to support the attachment and proliferation of chondrocytes in vitro which in turn can be utilised as a cell delivery vehicle in tissue engineering applications. METHODS: Fresh HAM obtained from patients undergoing routine elective caesarean sections was harvested, processed and dried using either freeze drying (FD or air drying (AD methods prior to sterilisation by gamma irradiation. Isolated, processed and characterised rabbit autologous chondrocytes were seeded on processed HAM and cultured for up to three weeks. Cell attachment and proliferation were examined qualitatively using inverted brightfield microscopy. RESULTS: Processed HAM appeared to allow cell attachment when implanted with chondrocytes. Although cells seeded on AD and FD HAM did not appear to attach as strongly as those seeded on glycerol preserved intact human amniotic membrane, these cells to be proliferated in cell culture conditions. CONCLUSION: Preliminary results show that processed HAM promotes chondrocyte attachment and proliferation.

AcEST: BP921023 [AcEST

Lifescience Database Archive (English)

Full Text Available p|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila me... 33 0.56 sp|Q6K...Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 Length = 990 Score

On convergence of homotopy analysis method and its application to ...

African Journals Online (AJOL)

In this paper, we have used the homotopy analysis method (HAM) to obtain approximate solution of fractional integro-differential equations (FIDEs). Convergence of HAM is considered for this kind of equations. Also some examples are given to illustrate the high efficiency and precision of HAM. Keywords: Fractional ...

Peenrad Tornide väljakul Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2009-01-01

Juunist oktoobrini toimub Tallinnas Tornide väljakul esimest korda rahvusvaheline aiandusfestival, mille raames rajatakse linnamüüri äärde parki pea 30 tarbeaeda teemadel "Keskaja aed" ja "21. sajandi tarbeaed"

Evaluation of simulated aerosol properties with the aerosol-climate model ECHAM5-HAM using observations from the IMPACT field campaign

Directory of Open Access Journals (Sweden)

G.-J. Roelofs

2010-08-01

Full Text Available In May 2008, the measurement campaign IMPACT for observation of atmospheric aerosol and cloud properties was conducted in Cabauw, The Netherlands. With a nudged version of the coupled aerosol-climate model ECHAM5-HAM we simulate the size distribution and chemical composition of the aerosol and the associated aerosol optical thickness (AOT for the campaign period. Synoptic scale meteorology is represented realistically through nudging of the vorticity, the divergence, the temperature and the surface pressure. Simulated concentrations of aerosol sulfate and organics at the surface are generally within a factor of two from observed values. The monthly averaged AOT from the model is 0.33, about 20% larger than observed. For selected periods of the month with relatively dry and moist conditions discrepancies are approximately −30% and +15%, respectively. Discrepancies during the dry period are partly caused by inaccurate representation of boundary layer (BL dynamics by the model affecting the simulated AOT. The model simulates too strong exchange between the BL and the free troposphere, resulting in weaker concentration gradients at the BL top than observed for aerosol and humidity, while upward mixing from the surface layers into the BL appears to be underestimated. The results indicate that beside aerosol sulfate and organics also aerosol ammonium and nitrate significantly contribute to aerosol water uptake. The simulated day-to-day variability of AOT follows synoptic scale advection of humidity rather than particle concentration. Even for relatively dry conditions AOT appears to be strongly influenced by the diurnal cycle of RH in the lower boundary layer, further enhanced by uptake and release of nitric acid and ammonia by aerosol water.

Editorial: Merawat Hak Asasi Manusia

Directory of Open Access Journals (Sweden)

Atip Latipulhayat

2016-08-01

Full Text Available Kita semua mahfum, sejarah hak asasi manusia (HAM, terutama kemunculan instrumen-instrumen HAM selalu dilatarbelakangi oleh kulminasi berbagai pelanggaran HAM. Absolutisme monarki Inggris di masa lalu berangsur-angsur melahirkan satu demi satu instrumen HAM, mulai dari Magna Charta (1215 yang sifatnya sangat elitis hingga Bill of Rights 1689 yang dianggap sebagai kemenangan rakyat (Jimly Asshidiqie: 2006, hlm. 87. Demikian pula pada level internasional, solidaritas penghapusan perbudakan pada abad 18-19, melahirkan kelembagaan dan berbagai dokumen HAM yang tak selalu mulus, mulai dari Liga Bangsa-Bangsa, International Labour Organization (ILO, dan berbagai konvensi internasional-nya hingga kehadiran Perserikatan Bangsa-Bangsa (PBB dan the International Bill of Rights: UDHR, ICCPR, dan ICESCR (Rhona K.M. Smith, et.al.: 2008, hlm. 32-36.

Anti-Oxidative and Anti-Inflammation Activities of Pork Extracts.

Science.gov (United States)

Gil, Juae; Kim, Dongwook; Yoon, Seok-Ki; Ham, Jun-Sang; Jang, Aera

2016-01-01

This study was conducted to evaluate the antioxidative and anti-inflammatory effects of boiled pork powder (BPP) and hot water extract powder (HWEP) from 4 cuts of meat from Landrace × Yorkshire × Duroc (LYD). The highest DPPH radical scavenging activities determined were from BPP of Boston butt (13.65 M TE) and HWEP of loin (19.40 M TE) and ham (21.45 M TE). The 2,2-azino-bis-3-ethylbenzothiazoline-6-sulfonic acid (ABTS) radical scavenging activities of BPP from shoulder ham (39.28 M TE) and ham (39.43 M TE) were higher than those of other meat cuts, while HWEP of ham exhibited the highest ABTS radical scavenging activity. A higher oxygen radical absorbance capacity was determined for BPP from ham (198.35 M TE) and in HWEP from loin (204.07 M TE), Boston butt (192.85 M TE), and ham (201.36 M TE). Carnosine content of BPP and HWEP from loin and were determined to be 106.68 and 117.77 mg/g on a dry basis, respectively. The anserine content of BPP (5.26 mg/g, dry basis) and HWEP (6.79 mg/g, dry basis) of shoulder ham exhibited the highest value as compared to the extracts from the other meat cuts. The viability of RAW 264.7 cells was increased with increasing HWEP from loin and ham treatment. In addition, the expression of IL-6 and TNF-α was significantly reduced by HWEP from loin and ham, in a dose dependent manner. These results suggested that boiled pork and hot water extract of pork have antioxidative and cytokine inhibitory effects.

Resistant starch lowers postprandial glucose and leptin in overweight adults consuming a moderate-to-high-fat diet: a randomized-controlled trial.

Science.gov (United States)

Maziarz, Mindy Patterson; Preisendanz, Sara; Juma, Shanil; Imrhan, Victorine; Prasad, Chandan; Vijayagopal, Parakat

2017-02-21

High-amylose maize resistant starch type 2 (HAM-RS2) stimulates gut-derived satiety peptides and reduces adiposity in animals. Human studies have not supported these findings despite improvements in glucose homeostasis and insulin sensitivity after HAM-RS2 intake which can lower adiposity-related disease risk. The primary objective of this study was to evaluate the impact of HAM-RS2 consumption on blood glucose homeostasis in overweight, healthy adults. We also examined changes in biomarkers of satiety (glucagon-like peptide-1 [GLP-1], peptide YY [PYY], and leptin) and body composition determined by anthropometrics and dual-energy x-ray absorptiometry, dietary intake, and subjective satiety measured by a visual analogue scale following HAM-RS2 consumption. Using a randomized-controlled, parallel-arm, double-blind design, 18 overweight, healthy adults consumed either muffins enriched with 30 g HAM-RS2 (n = 11) or 0 g HAM-RS2 (control; n = 7) daily for 6 weeks. The HAM-RS2 and control muffins were similar in total calories and available carbohydrate. At baseline, total PYY concentrations were significantly higher 120 min following the consumption of study muffins in the HAM-RS2 group than control group (P = 0.043). Within the HAM-RS2 group, the area under the curve (AUC) glucose (P = 0.028), AUC leptin (P = 0.022), and postprandial 120-min leptin (P = 0.028) decreased independent of changes in body composition or overall energy intake at the end of 6 weeks. Fasting total PYY increased (P = 0.033) in the HAM-RS2 group, but changes in insulin or total GLP-1 were not observed. Mean overall change in subjective satiety score did not correlate with mean AUC biomarker changes suggesting the satiety peptides did not elicit a satiation response or change in overall total caloric intake. The metabolic response from HAM-RS2 occurred despite the habitual intake of a moderate-to-high-fat diet (mean range 34.5% to 39.4% of total calories). Consuming 30�

Re-evaluation of the definition of remission on the 17-item Hamilton Depression Rating Scale based on recovery in health-related quality of life in an observational post-marketing study.

Science.gov (United States)

Sawamura, Jitsuki; Ishigooka, Jun; Nishimura, Katsuji

2018-01-16

Although a score of less than 7 for the 17-item Hamilton Depression Rating Scale (HAM-D17) has been widely adopted to define remission of depression, a full recovery from depression is closely related to the patient's quality of life as well. Accordingly, we re-evaluated this definition of remission using HAM-D17 in comparison with the corresponding score for health-related quality of life (HRQOL) measured by the SF-36. Using the data for depressive patients reported by GlaxoSmithKline K.K. (Study No. BRL29060A/863) in a post-marketing observational study of paroxetine, with a sample size of n = 722, multivariate logistic regression was performed with the HAM-D17 score as a dependent variable and with each of the eight domain scores of HRQOL (from the SF-36) transformed into a binominal form according to the national standard value for Japan. Then, area under curve of receiver operating characteristic analyses were conducted. Based on the obtained results, a multivariate analysis was performed using the HAM-D17 score in a binomial form with HAM-D17 as a dependent variable and with each of the eight HRQOL domain scores (SF-36) as binominalized independent variables. A cutoff value for the HAM-D17 score of 5 provided the maximum ROC-AUC at "0.864." The significantly associated scores of the eight HRQOL domains (SF-36) were identified for the HAM-D17 cutoff values of ≥5 and ≤4. The scores for physical functioning (odds ratio, 0.473), bodily pain (0.557), vitality (0.379), social functioning (0.540), role-emotion (0.265), and mental health (0.467) had a significant negative association with the HAM-D17 score (p < 0.05), and HRQOL domain scores for HAM-D17 ≥ 5 were significantly lower compared with those for HAM-D17 ≤ 4. A cutoff value for HAM-D17 of less than or equal to 4 was the best candidate for indicating remission of depression when the recovery of HRQOL is considered. Restoration of social function and performance should be considered

Dietary habits in women with recurrent idiopathic calcium nephrolithiasis

Directory of Open Access Journals (Sweden)

Meschi Tiziana

2012-03-01

Full Text Available Abstract Background Nutrition has been widely recognized to influence the risk of kidney stone formation. Therefore the aim of our study was to assess: a whether usual diet of women with idiopathic calcium nephrolithiasis (ICN living in Parma (Northern-Italy is different compared to healthy controls, b how their diet differs from Italian National guidelines and c whether it is related to nephrolithiasis clinical course. Methods 143 women with recurrent ICN (mean age 43 ± 13 ys and 170 healthy women (mean age 42 ± 11 ys were enrolled. All women completed a food frequency questionnaire for the last 60-days and a 3-day dietary diary analysed with a dedicated software. Results Stone formers showed a higher consumption of sausages, ham, meat and sweets than healthy controls (43.1% vs 11.1%, 29.4% vs 13.9%, 21.6% vs 4.2%, 66.7% vs 18.1%, p 40 years, the differences described above were amplified in the class ≤30 years, where nephrolithiasis presented a more serious course (shorter recurrence interval, greater stone-rate. In this age group the intake of fruit and vegetables was notably lower than guideline recommendations. Conclusions We conclude that the usual diet of women with recurrent ICN is different from controls and characterized by low intake of fruits and vegetables and higher consumption of simple sugars and foods with high protein and salt content. This dietary imbalance could play a role in the ICN pathogenesis, especially in younger women. This work was financed by grants from Italian Ministry of University and Research as part of a larger project about the prevention of kidney stones (PRIN 2005063822 and by Fondazione per la Ricerca Scientifica Termale (FoRST. No potential conflict of interest relevant to this paper was reported.

[The physiotherapic aspect of omeral epicondilitis (author's transl)].

Science.gov (United States)

Marenghi, P; Tella, G C

1976-01-01

The Authors describe history, etiopatogenesis, clinic, therapy of omeral epicondilitis, very frequent affection. Physiotherapic aspects are studied by different methods. The indications are different compared to clinical aspect, pain modality, relapse eventuality. They conclude with personal considerations based on what observed in Orthopedic Clinica of Parma University.

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GTRHNVGFMVIDALSKKLGIEVSRLKFKSLMGEGHFKGEKVILLK 60 ... Query: 121 LNSEDFPRVRIGIGKPEDGDLVRHVLGRFSDEEKKVIDEAVERAAEAVIDIMENGIE...HAM 180 ... LNSEDFPRVRIGIGKPEDGDLVRHVLGRFSDEEKKVIDEAVERAAEAVIDIMENGIE...HAM Sbjct: 121 LNSEDFPRVRIGIGKPEDGDLVRHVLGRFSDEEKKVIDEAVERAAEAVIDIMENGIEHAM 180 ...

Chemical and physical parameters of dried salted pork meat

Directory of Open Access Journals (Sweden)

Petronela Cviková

2016-07-01

Full Text Available The aim of the present study was analysed and evaluated chemical and physical parameters of dried salted pork neck and ham. Dried salted meat is one of the main meat products typically produced with a variety of flavors and textures. Neck (14 samples and ham (14 samples was salted by nitrite salt mixture during 1week. The nitrite salt mixture for salting process (dry salting was used. This salt mixture contains: salt, dextrose, maltodextrin, flavourings, stabilizer E316, taste enhancer E621, nitrite mixture. The meat samples were dried at 4 °C and relative humudity 85% after 1 week salting. The weight of each sample was approximately 1 kg. After salting were vacuum-packed and analysed after 1 week. The traditional dry-cured meat such as dry-cured ham and neck obtained after 12 - 24 months of ripening under controlled conditions. The average protein content was significantly (p <0.001 lower in dried pork neck in comparison with dried salted pork ham. The average intramuscular fat was significantly (p <0.001 lower in dried pork ham in comparison with dried salted pork neck. The average moisture was significantly lower (p ≤0.05 in dried salted ham in comparison with dried pork neck. The average pH value was 5.50 in dried salted pork ham and 5.75 in dried salted pork neck. The content of arginine, phenylalanine, isoleucine, leucine and threonine in dried salted ham was significantly lower (p <0.001 in comparison with dried salted pork neck. The proportion of analysed amino acids from total proteins was 56.31% in pork salted dried ham and 56.50% in pork salted dried neck.  Normal 0 21 false false false EN-GB X-NONE X-NONE Normal 0 21 false false false SK X-NONE X-NONE

Beyaz Kum Midyesinin (Chamelea gallina L., 1758 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

Directory of Open Access Journals (Sweden)

Murtaza Ölmez

2015-02-01

Full Text Available Bu araştırmada, beyaz kum midyesinin (Chamelea gaHina et verimi ile etinin kuru madde, su, ham protein, ham yağ ve ham kül gibi besin maddelerinin belirlenmesi amaçlanmıştır. Beyaz kum midyesinin canlı ağırlık ortalaması 3.464±0.075 g, kabuk ağırlığı 2.307 ± 0.052 g ve yenilebilir et ağırlığı 1.157±0.029 g olarak belirlenmiş, % 66.60'ını kabuk, % 33.40'ını yenilebilir etin oluşturduğu saptanmıştır. Kimyasal analiz sonuçlarına göre;beyaz kum midyesinin etinde ortalama su oranı % 85.76, kuru madde % 14.24, ham protein % 8.49, ham yağ % 0.54, ham kül % 2.27, kalsiyum % 0.27 ve fosfor % 0.13 olarak tespit edilmiştir.

T CD4+ cells count among patients co-infected with human immunodeficiency virus type 1 (HIV-1 and human T-cell leukemia virus type 1 (HTLV-1: high prevalence of tropical spastic paraparesis/HTLV-1-associated myelopathy (TSP/HAM Contagens de células T CD4+ na co-infecção HIV-1 e HTLV-1: alta prevalência da paraparesia espástica tropical/mielopatia associada ao HTLV-1

Directory of Open Access Journals (Sweden)

Jorge Casseb

2007-08-01

Full Text Available INTRODUCTION: HIV positive patients co-infected with HTLV-1 may have an increase in their T CD4+ cell counts, thus rendering this parameter useless as an AIDS-defining event. OBJECTIVE: To study the effects induced by the co-infection of HIV-1 and HTLV-1 upon CD4+ cells. MATERIAL AND METHODS: Since 1997, our group has been following a cohort of HTLV-1-infected patients, in order to study the interaction of HTLV-1 with HIV and/or with hepatitis C virus (HCV, as well as HTLV-1-only infected asymptomatic carriers and those with tropical spastic paraparesis/HTLV-1 associated myelopathy (TSP/HAM. One hundred and fifty HTLV-1-infected subjects have been referred to our clinic at the Institute of Infectious Diseases "Emílio Ribas", São Paulo. Twenty-seven of them were also infected with HIV-1 and HTLV-1-infection using two ELISAs and confirmed and typed by Western Blot (WB or polymerase chain reaction (PCR. All subjects were evaluated by two neurologists, blinded to the patient's HTLV status, and the TSP/HAM diagnostic was based on the World Health Organization (WHO classification. AIDS-defining events were in accordance with the Centers for Disease Control (CDC classification of 1988. The first T CD4+ cells count available before starting anti-retroviral therapy are shown compared to the HIV-1-infected subjects at the moment of AIDS defining event. RESULTS: A total of 27 HIV-1/HTLV-1 co-infected subjects were identified in this cohort; 15 already had AIDS and 12 remained free of AIDS. The median of T CD4+ cell counts was 189 (98-688 cells/mm³ and 89 (53-196 cells/mm³ for co-infected subjects who had an AIDS-defining event, and HIV-only infected individuals, respectively (p = 0.036. Eight of 27 co-infected subjects (30% were diagnosed as having a TSP/HAM simile diagnosis, and three of them had opportunistic infections but high T CD4+ cell counts at the time of their AIDS- defining event. DISCUSSION: Our results indicate that higher T CD4+ cells

Hypercortisolemia is associated with severity of bone loss and depression in hypothalamic amenorrhea and anorexia nervosa.

Science.gov (United States)

Lawson, Elizabeth A; Donoho, Daniel; Miller, Karen K; Misra, Madhusmita; Meenaghan, Erinne; Lydecker, Janet; Wexler, Tamara; Herzog, David B; Klibanski, Anne

2009-12-01

Anorexia nervosa (AN) and functional hypothalamic amenorrhea (HA) are associated with low bone density, anxiety, and depression. Women with AN and HA have elevated cortisol levels. Significant hypercortisolemia, as in Cushing's disease, causes bone loss. It is unknown whether anxiety and depression and/or cortisol dysregulation contribute to low bone density in AN or HA. Our objective was to investigate whether hypercortisolemia is associated with bone loss and mood disturbance in women with HA and AN. We conducted a cross-sectional study in a clinical research center. We studied 52 women [21 healthy controls (HC), 13 normal-weight women with functional HA, and 18 amenorrheic women with AN]. Serum samples were measured every 20 min for 12 h overnight and pooled for average cortisol levels. Bone mineral density (BMD) was assessed by dual-energy x-ray absorptiometry (DXA) at anteroposterior and lateral spine and hip. Hamilton Rating Scales for Anxiety (HAM-A) and Depression (HAM-D) were administered. BMD was lower in AN and HA than HC at all sites and lower in AN than HA at the spine. On the HAM-D and HAM-A, AN scored higher than HA, and HA scored higher than HC. Cortisol levels were highest in AN, intermediate in HA, and lowest in HC. HAM-A and HAM-D scores were associated with decreased BMD. Cortisol levels were positively associated with HAM-A and HAM-D scores and negatively associated with BMD. Hypercortisolemia is a potential mediator of bone loss and mood disturbance in these disorders.

The BRiCS in the spotlight: a research agenda

OpenAIRE

SCAFFARDI LUCIA; FEDERICO VERONICA

2014-01-01

On November 6–7, 2014, the University of Parma (Italy) hosted a profound two-day discussion on the BRICS, i.e. Brazil, Russia, India, China and South Africa, a relatively new actor in the international arena, gathering the most innovative research and the leading experts and scholars.

Neolithic Occupation of Svratka Alluvial Plain; Case Study from Brno-Přízřenice, Czech Republic

Czech Academy of Sciences Publication Activity Database

Parma, D.; Vejrostová, L.; Lisá, Lenka; Bajer, A.; Pacina, J.; Gottwald, Z.

2015-01-01

Roč. 6, č. 2 (2015), s. 181-193 ISSN 1804-848X Institutional support: RVO:67985831 Keywords : alluvial zone * buried soils * prehistoric occupation * dark earth * geoarchaeology * micromorphology * grain size analysis * magnetic proxies Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.iansa.eu/papers/IANSA-2015-02-parma.pdf

The RAND Online Measure Repository for Evaluating Psychological Health and Traumatic Brain Injury Programs. The RAND Toolkit, Volume 2

Science.gov (United States)

2014-01-01

tempo may raise the risk for mental health challenges. During this time, the U.S. Department of Defense (DoD) has implemented numerous programs to...and were based on the constraints of each electronic database. However, most searches were variations on a basic three-category format: The first...Gerontology, 1983, 38: 111–116. Iannuzzo RW, Jaeger J, Goldberg JF, Kafantaris V, Sublette ME. “Development and Reliability of the Ham-D/MADRS

An analysis of correlations among four outcome scales employed in clinical trials of patients with major depressive disorder

Directory of Open Access Journals (Sweden)

Ahmed Saeeduddin

2009-01-01

Full Text Available Abstract Background The 17-item Hamilton Depression Rating Scale (HAM-D17 remains the 'gold standard' for measuring treatment outcomes in clinical trials of depressed patients. The Montgomery Ǻsberg Depression Rating Scale (MADRS, Clinical Global Impressions-Severity (CGI-S and -Improvement (CGI-I scales are also widely used. Objective This analysis of data from 22 double-blind, placebo-controlled clinical studies of venlafaxine in adult patients with major depressive disorder was aimed at assessing correlations among these 4 scales. Methods Changes from baseline for MADRS, HAM-D17 and CGI-S, and end point CGI-I scores and response (≥50% decrease from baseline HAM-D17 or MADRS, or CGI-S or CGI-I score ≤2 were analysed. Pearson correlation coefficients were calculated for all pairs of the four scales (HAM-D17/MADRS, HAM-D17/CGI-S, HAM-D17/CGI-I, MADRS/CGI-S, MADRS/CGI-I, CGI-S/CGI-I at different time points. Effect sizes were calculated using the Cohen d. Results Correlations were significant at all time points (p 17 or CGI-S for continuous measures and response. Conclusion Although MADRS and CGI-I were more sensitive to treatment effects, HAM-D17, MADRS, CGI-S and CGI-I scores present a consistent picture of response to venlafaxine treatment.

Macedonio Melloni between physics and political commitment

International Nuclear Information System (INIS)

Colombi, E.

2014-01-01

Macedonio Melloni is an outstanding figure in the scientific world of the nineteenth century. His life can be divided into two main periods, and the interruption is due to his deep involvement in the political risings that shaked Europe in 1831. In the first period, he was a professor at the School of Physics of the University of Parma. Since the very beginning, he devoted a special attention to the properties of radiant heat, and the theoretical insights about the nature of thermal phenomena were doubled by a smart attitude in improving the laboratory tools. The political events of 1830-31 caused stir inside the University of Parma. Melloni delivered a celebrated speech, leading to stormy meetings, the closure of the School of Physics of the University, the arrests and deportations of students. Nevertheless they gained support from the whole town: Parma in fact rose up and a provisional government was formed of which Melloni himself became a member. Accounts on these events can be found in the documents of the 'Archivio di Stato' (the Public Records Office), as well as in the diary of Lombardini, the Chancellor of the University, and in the short stories by Gallenga (a deported student), besides letters and memories of Melloni himself. The subsequent exile, apart from difficulties in private and familiar life, gave him the chance of establishing relations and collaborations with the scientific European circles. Thus, the 1831 uprising caused both dramatic changes and rich opportunities in the career of a patriot who, as others in the same period, was divided between political engagement and scientific passion.

Reduction of painful area as new possible therapeutic target in post-herpetic neuropathic pain treated with 5% lidocaine medicated plaster: a case series

Directory of Open Access Journals (Sweden)

Casale R

2014-06-01

Full Text Available Roberto Casale,1,2 Maria Di Matteo,3,7 Cristina E Minella,4,7 Guido Fanelli,5,7 Massimo Allegri4,6,71Department of Clinical Neurophysiology and Pain Rehabilitation Unit, Foundation Salvatore Maugeri, IRCCS, Pavia, 2EFIC Montescano School, Montescano, 3Anesthesia and Intensive Care I, 4Pain Therapy Service, Fondazione IRCCS Policlinico San Matteo, Pavia, 5Department of Anesthesia, Intensive Care and Pain Therapy, Azienda Ospedaliera Universitaria Parma, University of Parma, Parma, 6Department of Clinical, Surgical, Diagnostic and Pediatric Science, University of Pavia, Pavia, 7Study In Multidisciplinary Pain Research Group, Parma, ItalyAbstract: Post-herpetic neuralgia (PHN is neuropathic pain persisting after an acute episode of herpes zoster, and is associated with severe pain and sensory abnormalities that adversely affect the patient's quality of life and increase health care costs. Up to 83% of patients with PHN describe localized neuropathic pain, defined as “a type of neuropathic pain characterized by consistent and circumscribed area(s of maximum pain”. Topical treatments have been suggested as a first-line treatment for localized neuropathic pain. Use of 5% lidocaine medicated plaster could reduce abnormal nervous peripheral discharge and via the plaster could have a “protective” function in the affected area. It has been suggested that use of this plaster could reduce pain as well as the size of the painful area. To evaluate this possible outcome, we retrospectively reviewed eight patients with PHN, treated using 5% lidocaine medicated plaster. During a follow-up period of 3 months, we observed good pain relief, which was associated with a 46% reduction in size of the painful area after one month (from 236.38±140.34 cm2 to 128.80±95.7 cm2 and a 66% reduction after 3 months (81.38±59.19 cm2. Our study cohort was composed mainly of elderly patients taking multiple drugs to treat comorbidities, who have a high risk of drug�

Psychological Symptoms in Obesity and Related Factors.

Science.gov (United States)

Değirmenci, Taner; Kalkan-Oğuzhanoğlu, Nalan; Sözeri-Varma, Gülfizar; Özdel, Osman; Fenkçi, Semin

2015-03-01

This study aimed to investigate the relationship between levels of depression and anxiety symptoms and quality of life, self-esteem in obesity. Fifty-two subjects whose Body Mass Index (BMI) is 30 kg/m 2 and over and 43 control whose BMI is normal were recruited for this study. The socio demographic data form, Hamilton Depression Rating Scale (HAM-D17), Hamilton Anxiety Rating Scale (HAM-A), Quality of Life Scale Short Form (WHOQOL-Brief-TR), Coopersmith Self Esteem Scale (CSES), The Eating Attitudes (EAT), were applied to the participants. In this study most of the patients are women, married, postgraduated and live in urban areas. It was determined to scores of HAM-D17, HAM-A and EAT are higher in obese group than control group; WHOQOL-Brief-TR physical field scores was lower in obese group than control group. CSES scores wasn't difference between obese and control group. In obese group, there was HAM-D17 and HAM-A scores a negative correlation between quality of life physical field score, negative correlation between CSES score, positive correlation between EAT scale score. There is no correlation between scores of HAM-D17 and HAM-A and BMI. Our results suggest that depressive and anxiety levels are high in induvidual with obesity. They have problems in eating attitudes and their quality of life especially physical field is poor. The psychological symptoms have negative effects on the quality of life, self-esteem, and eating attitudes. Our results suggest that psychiatric support to improving positive effects quality of life and self-esteem in individual with obesity.

Evaluation of the effect of Spiritual care on patients with generalized anxiety and depression: a randomized controlled study.

Science.gov (United States)

Sankhe, A; Dalal, K; Save, D; Sarve, P

2017-12-01

The present study was conducted to assess the effect of spiritual care in patients with depression, anxiety or both in a randomized controlled design. The participants were randomized either to receive spiritual care or not and Hamilton anxiety rating scale-A (HAM-A), Hamilton depression rating scale-D (HAM-D), WHO-quality of life-Brief (WHOQOL-BREF) and Functional assessment of chronic illness therapy - Spiritual well-being (FACIT-Sp) were assessed before therapy and two follow-ups at 3 and 6 week. However, with regard to the spiritual care therapy group, statistically significant differences were observed in both HAM-A and HAM-D scales between the baseline and visit 2 (p scales during the follow-up periods for the control group of participants. When the scores were compared between the study groups, HAM-A, HAM-D and FACIT-Sp 12 scores were significantly lower in the interventional group as compared to the control group at both third and sixth weeks. This suggests a significant improvement in symptoms of anxiety and depression in the spiritual care therapy group than the control group; however, large randomized controlled trials with robust design are needed to confirm the same.

Electron/electron acoustic instability

International Nuclear Information System (INIS)

Gary, S.P.

1987-01-01

The electron acoustic wave becomes a normal mode of an unmagnetized collisionless plasma in the presence of two electron components with similar densities, but strongly disparate temperatures. The characteristic frequency of this mode is the plasma frequency of the cooler electron component. If these two electron components have a relative drift speed several times the thermal speed of the cooler component, the electron/electron acoustic instability may arise. This paper describes the parametric dependences of the threshold drift speed and maximum growth rate of this instability, and compares these with the same properties of the electron/ion acoustic instability. Under the condition of zero current, the electron/ion acoustic instability typically has the lower threshold drift speed, so that observation of the electron/electron acoustic instability is a strong indication of the presence of an electrical current in the plasma

EFECTO DE LA ADICIÓN DE CARRAGENINA KAPPA I.II Y GOMA TARA SOBRE CARACTERÍSTICAS DE CALIDAD DEL JAMÓN DE CERDO PICADO Y COCIDO EFFECT OF THE ADDITION OF KAPPA I.II CARRAGEENAN AND TARA GUM ON QUALITY CHARACTERISTICS OF COOKED AND CHOPPED PORK HAMS

Directory of Open Access Journals (Sweden)

Diego Alonso Restrepo Molina

2010-12-01

Full Text Available Se evaluaron sinéresis, color y dureza instrumental y, sensorialmente las características de olor, sabor, color y dureza en jamones inyectados, cocidos y picados de cerdo, los cuales se habían elaborado aplicando en la salmuera de inyección una mezcla de hidrocoloides compuesta por carragenina kappa I.II y goma tara en una proporción de 79:21, en niveles del 1% y 1,2%, usando tres repeticiones para el estudio. Los jamones así elaborados se compararon contra un jamón testigo, elaborado sin el uso de estos hidrocoloides. Los valores obtenidos para los atributos, se analizaron mediante un diseño de una sola vía, con 5 repeticiones en el tiempo (0, 10, 20, 28 y 34 días, dando un arreglo factorial. Los resultados muestran que el tratamiento 2 (1,2% presentó la menor liberación de agua y la mayor dureza. No se registró diferencia entre los tratamientos y el testigo para la característica elasticidad. El testigo mostró las mejores características de color, olor y sabor sensoriales. La edad influyó en las características dureza y sinéresis en forma determinante, señalando el período desde el día 15 hasta el día 28 como aquel en que más se agudiza la sinéresis, siendo ésta más notable en el testigo que no contenía hidrocoloide.Characteristics of quality, color, texture and sineresis (instrumental and, odor, flavor, color and hardness (sensory of injected, cooked and chopped pork hams were assessed, which were manufactured using a mix of hydrocolloids in the brine of injection comprised by kappa I.II carrageenan and tara gum in a 79:21 ratio, at levels of 1% and 1.2%, using three replicates for the study; the finished hams were compared with a control ham, manufactured without the use of these hydrocolloids. The values obtained for the attributes, were analyzed through a one way design, with 5 repetitions in time (0, 10, 20, 28 and 34 days, providing a factorial arrangement. The results showed that the treatment 2 (1

Elections to the Senior Staff Advisory Committee (“The Nine”) 2016

CERN Multimedia

Malika Meddahi, ex-spokesperson of the Nine

2016-01-01

The electronic voting process for the Senior Staff Advisory Committee (“The Nine”) was closed on Monday 22 August 2016 at 23:59.    Of the 544 Senior Staff members eligible to vote, 270 voted. This represents a participation of 50% to be compared to 52% in 2015, to 59% in 2014, 63% in 2013, 61% in 2012, 43% in 2011, 44% in 2010, 57% in 2009, 53% in 2008, 63% in 2007, and 64% in 2006. The results are: Total votes:  270 Valid votes:  268 (of which 4 blanks) Null votes:  2   Electoral group 1 (Research Physicists) Candidate Dept Votes Result David Enterria EP 31   Andreas Hoecker EP 107 ELECTED   Electoral group 2 (Applied Physicists, Engineers, Computer Scientists) Candidate Dept Votes Result Latchezar Betev EP 16   Maria Dimou IT 34   Vittorio Parma TE ...

Expansion in CD39+ CD4+ Immunoregulatory T Cells and Rarity of Th17 Cells in HTLV-1 Infected Patients Is Associated with Neurological Complications

Science.gov (United States)

Hasenkrug, Aaron M.; Bruno, Fernanda R.; Carvalho, Karina I.; Wynn-Williams, Harry; Neto, Walter K.; Sanabani, Sabri S.; Segurado, Aluisio C.; Nixon, Douglas F.; Kallas, Esper G.

2013-01-01

HTLV-1 infection is associated with several inflammatory disorders, including the neurodegenerative condition HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). It is unclear why a minority of infected subjects develops HAM/TSP. CD4+ T cells are the main target of infection and play a pivotal role in regulating immunity to HTLV and are hypothesized to participate in the pathogenesis of HAM/TSP. The CD39 ectonucleotidase receptor is expressed on CD4+ T cells and based on co-expression with CD25, marks T cells with distinct regulatory (CD39+CD25+) and effector (CD39+CD25−) function. Here, we investigated the expression of CD39 on CD4+ T cells from a cohort of HAM/TSP patients, HTLV-1 asymptomatic carriers (AC), and matched uninfected controls. The frequency of CD39+ CD4+ T cells was increased in HTLV-1 infected patients, regardless of clinical status. More importantly, the proportion of the immunostimulatory CD39+CD25− CD4+ T-cell subset was significantly elevated in HAM/TSP patients as compared to AC and phenotypically had lower levels of the immunoinhibitory receptor, PD-1. We saw no difference in the frequency of CD39+CD25+ regulatory (Treg) cells between AC and HAM/TSP patients. However, these cells transition from being anergic to displaying a polyfunctional cytokine response following HTLV-1 infection. CD39−CD25+ T cell subsets predominantly secreted the inflammatory cytokine IL-17. We found that HAM/TSP patients had significantly fewer numbers of IL-17 secreting CD4+ T cells compared to uninfected controls. Taken together, we show that the expression of CD39 is upregulated on CD4+ T cells HAM/TSP patients. This upregulation may play a role in the development of the proinflammatory milieu through pathways both distinct and separate among the different CD39 T cell subsets. CD39 upregulation may therefore serve as a surrogate diagnostic marker of progression and could potentially be a target for interventions to reduce the development of

Prognostic parameterization of cloud ice with a single category in the aerosol-climate model ECHAM(v6.3.0)-HAM(v2.3)

Science.gov (United States)

Dietlicher, Remo; Neubauer, David; Lohmann, Ulrike

2018-04-01

A new scheme for stratiform cloud microphysics has been implemented in the ECHAM6-HAM2 general circulation model. It features a widely used description of cloud water with two categories for cloud droplets and raindrops. The unique aspect of the new scheme is the break with the traditional approach to describe cloud ice analogously. Here we parameterize cloud ice by a single category that predicts bulk particle properties (P3). This method has already been applied in a regional model and most recently also in the Community Atmosphere Model 5 (CAM5). A single cloud ice category does not rely on heuristic conversion rates from one category to another. Therefore, it is conceptually easier and closer to first principles. This work shows that a single category is a viable approach to describe cloud ice in climate models. Prognostic representation of sedimentation is achieved by a nested approach for sub-stepping the cloud microphysics scheme. This yields good results in terms of accuracy and performance as compared to simulations with high temporal resolution. Furthermore, the new scheme allows for a competition between various cloud processes and is thus able to unbiasedly represent the ice formation pathway from nucleation to growth by vapor deposition and collisions to sedimentation. Specific aspects of the P3 method are evaluated. We could not produce a purely stratiform cloud where rime growth dominates growth by vapor deposition and conclude that the lack of appropriate conditions renders the prognostic parameters associated with the rime properties unnecessary. Limitations inherent in a single category are examined.

A resistant-starch enriched yogurt: fermentability, sensory characteristics, and a pilot study in children

Science.gov (United States)

Aryana, Kayanush; Greenway, Frank; Dhurandhar, Nikhil; Tulley, Richard; Finley, John; Keenan, Michael; Martin, Roy; Pelkman, Christine; Olson, Douglas; Zheng, Jolene

2015-01-01

The rising prevalence of obesity and the vulnerability of the pediatric age group have highlighted the critical need for a careful consideration of effective, safe, remedial and preventive dietary interventions.  Amylose starch (RS2) from high-amylose maize (HAM) ferments in the gut and affects body weight.   One hundred and ten children, of 7-8 (n=91) or 13-14 (n=19) years of age scored the sensory qualities of a yogurt supplemented with either HAM-RS2 or an amylopectin starch.  The amylopectin starch yogurt was preferred to the HAM-RS2-enriched yogurt by 7-8 year old panelists ( Pyogurt than for HAM-RS2-enriched yogurt ( Pyogurt in 74% of subjects.  Four children consumed a HAM-RS2-enriched yogurt for four weeks to test its fermentability in a clinical trial.  Three adolescents, but not the single pre-pubertal child, had reduced stool pH ( P=0.1) and increased stool short-chain fatty acids (SCFAs) ( Pfermentation and isobutyrate ( P=0.01) from protein fermentation post-treatment suggesting a favorable change to the gut microbiota.  HAM-RS2 was not modified by pasteurization of the yogurt, and may be a palatable way to increase fiber intake and stimulate colonic fermentation in adolescents.  Future studies are planned to determine the concentration of HAM-RS2 that offers the optimal safe and effective strategy to prevent excessive fat gain in children. PMID:26925221

Balance, functional mobility, and fall occurrence in patients with human T-cell lymphotropic virus type-1-associated myelopathy/tropical spastic paraparesis: a cross-sectional study.

Science.gov (United States)

Fonseca, Erika Pedreira da; Sá, Katia Nunes; Nunes, Rebeca Freitas Reis; Ribeiro Junior, Antônio Carlos; Lira, Síntia Freitas Bastos; Pinto, Elen Beatriz

2018-01-01

Human T-cell lymphotropic virus type-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP) may lead to reduced functional mobility and balance. It is important to establish specific parameters that identify these changes and predict the risk of falls in these patients. The aim was to compare balance, functional mobility, and occurrence of falls among patients with and without HAM/TSP and to suggest values to predict the risk of falls in these patients. A cross-sectional study in patients with and without HAM/TSP involved balance assessments based on the berg balance scale (BBS) and functional mobility evaluation based on the timed up and go (TUG) test. From reports of falls, the sensitivity, specificity, and best cutoff points for the risk of falls assessed by these instruments were established using the receiver-operating characteristic (ROC) curve; 5% alpha was considered. We selected 42 participants: 29 with HAM/TSP and 13 without HAM/TSP. There was a statistically significant difference in the occurrence of falls, balance, and functional mobility between the groups (prisk of falls were defined as 50 points for the BBS and 12.28 seconds for the TUG test. Patients with HAM/TSP present reduced functional mobility and balance in relation to those without HAM/TSP. The risk of falls increased for these patients can be evaluated by the values ​​of 50 points using the BBS and 12.28 seconds using the TUG test.

Discrepancies between self and observer ratings of depression. The relationship to demographic, clinical and personality variables.

Science.gov (United States)

Enns, M W; Larsen, D K; Cox, B J

2000-10-01

The observer-rated Hamilton depression scale (HamD) and the self-report Beck Depression Inventory (BDI) are among the most commonly used rating scales for depression, and both have well demonstrated reliability and validity. However, many depressed subjects have discrepant scores on these two assessment methods. The present study evaluated the ability of demographic, clinical and personality factors to account for the discrepancies observed between BDI and HamD ratings. The study group consisted of 94 SCID-diagnosed outpatients with a current major depressive disorder. Subjects were rated with the 21-item HamD and completed the BDI and the NEO-Five Factor Inventory. Younger age, higher educational attainment, and depressive subtype (atypical, non-melancholic) were predictive of higher BDI scores relative to HamD observer ratings. In addition, high neuroticism, low extraversion and low agreeableness were associated with higher endorsement of depressive symptoms on the BDI relative to the HamD. In general, these predictive variables showed a greater ability to explain discrepancies between self and observer ratings of psychological symptoms of depression compared to somatic symptoms of depression. The study does not determine which aspects of neuroticism and extraversion contribute to the observed BDI/HamD discrepancies. Depression ratings obtained with the BDI and HamD are frequently discordant and a number of patient characteristics robustly predict the discrepancy between these two rating methods. The value of multi-modal assessment in the conduct of research on depressive disorders is re-affirmed.

Electronics and electronic systems

CERN Document Server

Olsen, George H

1987-01-01

Electronics and Electronic Systems explores the significant developments in the field of electronics and electronic devices. This book is organized into three parts encompassing 11 chapters that discuss the fundamental circuit theory and the principles of analog and digital electronics. This book deals first with the passive components of electronic systems, such as resistors, capacitors, and inductors. These topics are followed by a discussion on the analysis of electronic circuits, which involves three ways, namely, the actual circuit, graphical techniques, and rule of thumb. The remaining p

Electrons, Electronic Publishing, and Electronic Display.

Science.gov (United States)

Brownrigg, Edwin B.; Lynch, Clifford A.

1985-01-01

Provides a perspective on electronic publishing by distinguishing between "Newtonian" publishing and "quantum-mechanical" publishing. Highlights include media and publishing, works delivered through electronic media, electronic publishing and the printed word, management of intellectual property, and recent copyright-law issues…

Rocco Ungaro, 40 years of Calixarene chemistry

NARCIS (Netherlands)

Reinhoudt, David

2016-01-01

During the Calix2015 conference that took place in Giardini Naxos in July of this year, the first C. David Gutsche Award for Calixarene Chemistry was awarded to one of the founders of the field, Professor Rocco Ungaro of the University of Parma. In this paper, Rocco Ungaro’s seminal contributions to

Minding the Gap between Neuroscientific and Psychoanalytic Understanding of Autism

Science.gov (United States)

Mitrani, Judith

2010-01-01

This paper offers an integrative approach to the increasingly complex puzzle of autistic spectrum disorders. The author demonstrates how the work of one group of neuroscientists in Parma, on a special class of brain cells called "mirror neurons", and the work of researchers at the University of California in San Diego, applying these…

Biological Effects of Laser Radiation. Volume I. Review of the Literature on Biological Effects of Laser Radiation-to 1965.

Science.gov (United States)

1978-10-17

ailsur-der stu-dy. Y’c~zcro-p c e:zuto s- zsne nodules -whi ch Iw r su- sbl : irracdiated revealed sho. -cyes c -,t-,i~lrg nut o-. -- "at ae thzan vale...Ham, W.T., Jr., ec al., Amer. J. Ophchal. 43, 711, 1957. 7. Ham, W.T., Jr., et al., Amer. J. Ophchal. 46, 700, 1958. 8. Ham, W.T., Jr., ec al., Acca

Magnetic resonance imaging findings of HTLV-I-associated myelopathy

Energy Technology Data Exchange (ETDEWEB)

Furukawa, Yoshitaka; Une, Humiho; Osame, Mitsuhiro

1989-02-01

Magnetic resonance imaging (MRI) of the brain was evaluated in 12 HAM (HTLV-I-associated myelopathy) patients (4 males and 8 females, mean age of 54 yrs) and compaired with 36 non-HAM controls (16 males and 20 females mean age of 52yrs). MRI of the brain was performed using a 0.5 Tesla superconducting unit. Imaging in all patients was done with the long spin echo (TR=2,000msec, TE=100msec) sequences, and 10mm contiguous axial slices of the entire brain were obtained in all cases. Except for two cases, MRI of the brain was abnormal in 10 (83%) HAM patients, while in controls, 18 (50%) cases were abnormal. The abnormalities were high intensity lesions through SE 2000/100 sequences (T/sub 2/ weighted image), and consisted of small isolated hemisphere lesions in 9 patients, periventricular changes in 9 patients, bilateral thalamic lesions in 2 patients and pontine lesions in 3 patients. We found that the factor of age was very important. In patients with ages below 59 yrs, 6 of 8 HAM patients (75%) had abnormalities, while in control cases, 6 of 23 (23%) had abnormalities in periventricular area. And in isolated hemisphere, 6 of 8 HAM patients (75%) had abnormalities, while in control cases, 3 of 23 (13%) had abnormalities. On the other hand, in patients with ages over 60 yrs, 3 of 4 (75%) HAM patients had abnormalities in periventricular area, while in controls, 10 of 13 cases (77%) had abnormalities, and in isolated hemisphere, 3 of 4 (75%) HAM patients had abnormalities, and in controls, 10 of 13 cases (77%) had abnormalities. Our data suggest that HAM patients with ages below 59 years will show a greater percentage of abnormalities than controls. (author).

A resistant-starch enriched yogurt: fermentability, sensory characteristics, and a pilot study in children [v1; ref status: indexed, http://f1000r.es/5cb

Directory of Open Access Journals (Sweden)

Kayanush Aryana

2015-06-01

Full Text Available The rising prevalence of obesity and the vulnerability of the pediatric age group have highlighted the critical need for a careful consideration of effective, safe, remedial and preventive dietary interventions.  Amylose starch (RS2 from high-amylose maize (HAM ferments in the gut and affects body weight.   One hundred and ten children, of 7-8 (n=91 or 13-14 (n=19 years of age scored the sensory qualities of a yogurt supplemented with either HAM-RS2 or an amylopectin starch.  The amylopectin starch yogurt was preferred to the HAM-RS2-enriched yogurt by 7-8 year old panelists (P<0.0001.  Appearance, taste, and sandiness scores given by 13- to 14-year-old panelists were more favorable for the amylopectin starch yogurt than for HAM-RS2-enriched yogurt (P<0.05.  HAM-RS2 supplementation resulted in acceptable (≥6 on a 1-9 scale sensory and hedonic ratings of the yogurt in 74% of subjects.  Four children consumed a HAM-RS2-enriched yogurt for four weeks to test its fermentability in a clinical trial.  Three adolescents, but not the single pre-pubertal child, had reduced stool pH (P=0.1 and increased stool short-chain fatty acids (SCFAs (P<0.05 including increased fecal acetate (P=0.02, and butyrate (P=0.089 from resistant starch (RS fermentation and isobutyrate (P=0.01 from protein fermentation post-treatment suggesting a favorable change to the gut microbiota.  HAM-RS2 was not modified by pasteurization of the yogurt, and may be a palatable way to increase fiber intake and stimulate colonic fermentation in adolescents.  Future studies are planned to determine the concentration of HAM-RS2 that offers the optimal safe and effective strategy to prevent excessive fat gain in children.

Magnetic resonance imaging findings of HTLV-I-associated myelopathy

International Nuclear Information System (INIS)

Furukawa, Yoshitaka; Une, Humiho; Osame, Mitsuhiro

1989-01-01

Magnetic resonance imaging (MRI) of the brain was evaluated in 12 HAM (HTLV-I-associated myelopathy) patients (4 males and 8 females, mean age of 54 yrs) and compaired with 36 non-HAM controls (16 males and 20 females mean age of 52yrs). MRI of the brain was performed using a 0.5 Tesla superconducting unit. Imaging in all patients was done with the long spin echo (TR=2,000msec, TE=100msec) sequences, and 10mm contiguous axial slices of the entire brain were obtained in all cases. Except for two cases, MRI of the brain was abnormal in 10 (83%) HAM patients, while in controls, 18 (50%) cases were abnormal. The abnormalities were high intensity lesions through SE 2000/100 sequences (T 2 weighted image), and consisted of small isolated hemisphere lesions in 9 patients, periventricular changes in 9 patients, bilateral thalamic lesions in 2 patients and pontine lesions in 3 patients. We found that the factor of age was very important. In patients with ages below 59 yrs, 6 of 8 HAM patients (75%) had abnormalities, while in control cases, 6 of 23 (23%) had abnormalities in periventricular area. And in isolated hemisphere, 6 of 8 HAM patients (75%) had abnormalities, while in control cases, 3 of 23 (13%) had abnormalities. On the other hand, in patients with ages over 60 yrs, 3 of 4 (75%) HAM patients had abnormalities in periventricular area, while in controls, 10 of 13 cases (77%) had abnormalities, and in isolated hemisphere, 3 of 4 (75%) HAM patients had abnormalities, and in controls, 10 of 13 cases (77%) had abnormalities. Our data suggest that HAM patients with ages below 59 years will show a greater percentage of abnormalities than controls. (author)

Tax secretion from peripheral blood mononuclear cells and Tax detection in plasma of patients with human T-lymphotropic virus-type 1-associated myelopathy/tropical spastic paraparesis and asymptomatic carriers.

Science.gov (United States)

Medina, Fernando; Quintremil, Sebastián; Alberti, Carolina; Godoy, Fabián; Pando, María E; Bustamante, Andrés; Barriga, Andrés; Cartier, Luis; Puente, Javier; Tanaka, Yuetsu; Valenzuela, María A; Ramírez, Eugenio

2016-03-01

Human T-lymphotropic virus-type 1 (HTLV-1) is the etiologic agent of the neurologic disease HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Tax viral protein plays a critical role in viral pathogenesis. Previous studies suggested that extracellular Tax might involve cytokine-like extracellular effects. We evaluated Tax secretion in 18 h-ex vivo peripheral blood mononuclear cells (PBMCs) cultures from 15 HAM/TSP patients and 15 asymptomatic carriers. Futhermore, Tax plasma level was evaluated from other 12 HAM/TSP patients and 10 asymptomatic carriers. Proviral load and mRNA encoding Tax were quantified by PCR and real-time RT-PCR, respectively. Intracellular Tax in CD4(+)CD25(+) cells occurred in 100% and 86.7% of HAM/TSP patients and asymptomatic carriers, respectively. Percentage of CD4(+)CD25(+) Tax+, proviral load and mRNA encoding Tax were significantly higher in HAM/TSP patients. Western blot analyses showed higher secretion levels of ubiquitinated Tax in HAM/TSP patients than in asymptomatic carriers. In HTLV-1-infected subjects, Western blot of plasma Tax showed higher levels in HAM/TSP patients than in asymptomatic carriers, whereas no Tax was found in non-infected subjects. Immunoprecipitated plasma Tax resolved on SDS-PAGE gave two major bands of 57 and 48 kDa allowing identification of Tax and Ubiquitin peptides by mass spectrometry. Relative percentage of either CD4(+)CD25(+) Tax+ cells, or Tax protein released from PBMCs, or plasma Tax, correlates neither with tax mRNA nor with proviral load. This fact could be explained by a complex regulation of Tax expression. Tax secreted from PBMCs or present in plasma could potentially become a biomarker to distinguish between HAM/TSP patients and asymptomatic carriers. © 2015 Wiley Periodicals, Inc.

Comparing the Efficacy of 8 Weeks Treatment of Cipram® and its Generic Citalopram in Patients With Mixed Anxiety-Depressive Disorder.

Science.gov (United States)

Khoonsari, Hasan; Oghazian, Mohammad Bagher; Kargar, Mona; Moin, Mahdiyeh; Khalili, Hossein; Alimadadi, Abbas; Torkamandi, Hassan; Ghaeli, Padideh

2015-06-01

Patients with mixed anxiety-depressive disorder (MADD) suffer both anxiety and depression. Antidepressants, especially, selective serotonin reuptake inhibitors are among agents of choice for treating this condition. This study compared the efficacy of Cipram® with its generic, citalopram. Forty adult outpatients (between 18 to 55 years of age) with a diagnosis of MADD who met the trial criteria, entered this double-blind, randomized study. Subjects were assigned to receive either generic citalopram or Cipram® for 8 weeks. Hamilton Rating Scale for Depression (HAM-D) and Hamilton Rating Scale for Anxiety (HAM-A) were utilized to assess depression and anxiety at baseline, weeks 4 and 8 of the study. Statistical analysis was performed using SPSS 14.0. Twenty patients received citalopram (mean dosages of 22 mg/day during the first 4 weeks and 33 mg/day during weeks 4 to 8) and 20 received Cipram® (mean dosages of 22 mg/day during the first 4 weeks and 29 mg/day during weeks 4 to 8). Both treatments were noted to be effective in improving the symptoms of MADD at weeks 4 and 8. The mean differences of HAM-D and HAM-A between Citalopram and Cipram® groups were significantly different at the end of week 4 (HAM-D: P = 0.038, HAM-A: P = 0.025), but not at the end of week 8 (HAM-D: P = 0.239, HAM-A: P = 0.204). Both medications were tolerated well by the patients. This study suggests that the efficacy of citalopram is similar to that of Cipram® in the treatment of MADD after 8 weeks. Meanwhile, Cipram® may reduce depression and anxiety quicker than its generic, citalopram.

Electron-electron Bremsstrahlung for bound target electrons

International Nuclear Information System (INIS)

Haug, E.

2008-01-01

For the process of electron-electron (e-e) Bremsstrahlung the momentum and energy distributions of the recoiling electrons are calculated in the laboratory frame. In order to get the differential cross section and the photon spectrum for target electrons which are bound to an atom, these formulae are multiplied by the incoherent scattering function and numerically integrated over the recoil energy. The effect of atomic binding is most pronounced at low energies of the incident electrons and for target atoms of high atomic numbers. The results are compared to those of previous calculations. (authors)

Avaliação de algumas propriedades funcionais das farinhas de tremoço doce (Lupinus albus e feijão guandu (Cajanus cajan (L Millsp e sua utilização na produção de fiambre Evaluation of some functional properties of lupin sweet flour (Lupinus albus and faba bean flour (Cajanus cajan (L Millsp and their utilization in cooked ham production

Directory of Open Access Journals (Sweden)

Fernando Castilho

2010-03-01

enabled to identify that sweet lupin flour is able to absorb 172 to 186% of its weight in water, and ~62% in oil, while faba bean flour absorbs ~100% of its weight in water, and ~50% in oil. The emulsions obtained with both flours showed good activity and stability, suggesting a good application potential in the production of sausages. In the present work, some functional properties of the sweet lupin and faba bean flours were analyzed, including use in the production of cooked ham. The cooked ham was elaborated in the Quality Control Laboratory of foods in the Pharmaceutical Sciences Faculty in the University of São Paulo State (UNESP in Araraquara (SP, Brazil, offering an enriched food nutritionally. When compared to cooked hams prepared with the addition of soy protein, the experimental hams presented no significant sensorial differences, such as appearance, color, flavor, texture and overall impression, however they had had little sensorial acceptability.

A Comparative Study of a Few Tests for Isomorphism in Planetary Gear Trains

Directory of Open Access Journals (Sweden)

Rajasri Reddy

2013-04-01

Full Text Available Graph theory and Matrix methods are widely used by various kinematicians for synthesis and analysis of PGTs. Characteristic polynomial coefficients are used to detect isomorphism in Planetary Gear Trains (PGT. With the Eigen values and Eigen vectors method multiple matrix calculations are required. In case of Hamming number method a single Hamming matrix is enough to detect isomorphism in two PGTs and also determine structural aspects like symmetry easily [1]. Further using the Hamming matrix for a PGT, the number of possible combinations of levels that can be assigned to a given PGT [2] is identified. A review and comparison of Characteristic polynomial, Eigen vectors and Eigen value and Hamming number methods is presented.

Hydraulically actuated artificial muscles

Science.gov (United States)

Meller, M. A.; Tiwari, R.; Wajcs, K. B.; Moses, C.; Reveles, I.; Garcia, E.

2012-04-01

Hydraulic Artificial Muscles (HAMs) consisting of a polymer tube constrained by a nylon mesh are presented in this paper. Despite the actuation mechanism being similar to its popular counterpart, which are pneumatically actuated (PAM), HAMs have not been studied in depth. HAMs offer the advantage of compliance, large force to weight ratio, low maintenance, and low cost over traditional hydraulic cylinders. Muscle characterization for isometric and isobaric tests are discussed and compared to PAMs. A model incorporating the effect of mesh angle and friction have also been developed. In addition, differential swelling of the muscle on actuation has also been included in the model. An application of lab fabricated HAMs for a meso-scale robotic system is also presented.

Clinical pathophysiology of human T-lymphotropic virus-type1-associated myelopathy/tropical spastic paraparesis

Directory of Open Access Journals (Sweden)

Yoshihisa eYamano

2012-11-01

Full Text Available Human T-lymphotropic virus type 1 (HTLV-1, a human retrovirus, is the causative agent of a progressive neurological disease termed HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP. HAM/TSP is a chronic inflammatory disease of the central nervous system and is characterized by unremitting myelopathic symptoms such as spastic paraparesis, lower limb sensory disturbance, and bladder/bowel dysfunction. Approximately 0.25%–3.8% of HTLV-1-infected individuals develop HAM/TSP, which is more common in women than in men. Since the discovery of HAM/TSP, significant advances have been made with respect to elucidating the virological, molecular, and immunopathological mechanisms underlying this disease. These findings suggest that spinal cord invasion by HTLV-1-infected T cells triggers a strong virus-specific immune response and increases proinflammatory cytokine and chemokine production, leading to chronic lymphocytic inflammation and tissue damage in spinal cord lesions. However, little progress has been made in the development of an optimal treatment for HAM/TSP, more specifically in the identification of biomarkers for predicting disease progression and of molecular targets for novel therapeutic strategies targeting the underlying pathological mechanisms. This review summarizes current clinical and pathophysiological knowledge on HAM/TSP and discusses future focus areas for research on this disease.

Akdeniz Midyesinin (Mytilus Galloprovincialis Lam. 1819 Et Verimi ve Besin Madde İçeriği Üzerine bir Araştırma

Directory of Open Access Journals (Sweden)

Murtaza Ölmez

2015-02-01

Full Text Available Bu araştırmada, Akdeniz midyesinin (Mytilus galloprovincialishaşlama öncesi ve haşlama sonrası et verimi ile etinin kuru madde, su, ham protein, ham yağ, ham kül ve azotsuz öz maddeler gibi besin maddelerinin belirlenmesi amaçlanmıştır. Akdeniz midyesinin haşlama işlemi uygulanmayan ve haşlama işlemi uygulanan gruplarında canlı ağırlık, kabuk ağırlığı, yenilebilir et ağırlığı ortalamaları sırasıyla 26.547 g - 27.591 g, 19.513 g -19.027 g ve 7.034 g - 3.692 g , kabuk ile yenilebilir et oranı sırasıyla %73.504 -%68.96 ve %26.496- %13.380 olarak hesaplanmıştır. Kimyasal analiz sonuçlarına göre; Akdeniz midyesinin etinde ortalama su oranı %83.72, kuru madde %16.28, ham protein %9.46, ham yağ %0.82, ham kül %1.38 ve azotsuz öz maddeler %4.61 olarak tespit edilmiştir.

Prediction of practical performance in preclinical laboratory courses – the return of wire bending for admission of dental students in Hamburg

Directory of Open Access Journals (Sweden)

Kothe, Christian

2014-05-01

Full Text Available [english] Although some recent studies concluded that dexterity is not a reliable predictor of performance in preclinical laboratory courses in dentistry, they could not disprove earlier findings which confirmed the worth of manual dexterity tests in dental admission. We developed a wire bending test (HAM-Man which was administered during dental freshmen’s first week in 2008, 2009, and 2010. The purpose of our study was to evaluate if the HAM-Man is a useful selection criterion additional to the high school grade point average (GPA in dental admission. Regression analysis revealed that GPA only accounted for a maximum of 9% of students’ performance in preclinical laboratory courses, in six out of eight models the explained variance was below 2%. The HAM-Man incrementally explained up to 20.5% of preclinical practical performance over GPA. In line with findings from earlier studies the HAM-Man test of manual dexterity showed satisfactory incremental validity. While GPA has a focus on cognitive abilities, the HAM-Man reflects learning of unfamiliar psychomotor skills, spatial relationships, and dental techniques needed in preclinical laboratory courses. The wire bending test HAM-Man is a valuable additional selection instrument for applicants of dental schools.

A Shared Decision-Making System for Diabetes Medication Choice Utilizing Electronic Health Record Data.

Science.gov (United States)

Wang, Yu; Li, Peng-Fei; Tian, Yu; Ren, Jing-Jing; Li, Jing-Song

2017-09-01

The use of a shared decision-making (SDM) process in antihyperglycemic medication strategy decisions is necessary due to the complexity of the conditions of diabetes patients. Knowledge of guidelines is used as decision aids in clinical situations, and during this process, no patient health conditions are considered. In this paper, we propose an SDM system framework for type-2 diabetes mellitus (T2DM) patients that not only contains knowledge abstracted from guidelines but also employs a multilabel classification model that uses class-imbalanced electronic health record (EHR) data and that aims to provide a recommended list of available antihyperglycemic medications to help physicians and patients have an SDM conversation. The use of EHR data to serve as a decision-support component in decision aids helps physicians and patients to reach a more intuitive understanding of current health conditions and allows the tailoring of the available knowledge to each patient, leading to a more effective SDM. Real-world data from 2542 T2DM inpatient EHRs were substituted by 77 features and eight output labels, i.e., eight antihyperglycemic medications, and these data were utilized to build and validate the recommendation model. The multilabel recommendation model exhibited stable performance in every single-label classification and showed the ability to predict minority positive cases in which the average recall value of the eight classes was 0.9898. As a whole multilabel classifier, the recommendation model demonstrated outstanding performance, with scores of 0.0941 for Hamming Loss, 0.7611 for Accuracy exam , 0.9664 for Recall exam , and 0.8269 for F exam .

Triple therapy in COPD: new evidence with the extrafine fixed combination of beclomethasone dipropionate, formoterol fumarate, and glycopyrronium bromide

Directory of Open Access Journals (Sweden)

Singh D

2017-10-01

Full Text Available Dave Singh,1 Massimo Corradi,2 Monica Spinola,3 Alberto Papi,4 Omar S Usmani,5 Mario Scuri,3 Stefano Petruzzelli,3 Jørgen Vestbo1 1Division of Infection, Immunity and Respiratory Medicine, University of Manchester, Manchester, UK; 2Department of Medicine and Surgery, University of Parma, Parma, Italy; 3Chiesi Farmaceutici SpA, Parma, Italy; 4Department of Medical Sciences, Research Centre on Asthma and COPD, University of Ferrara, Ferrara, Italy; 5National Heart and Lung Institute, Imperial College London, London, UK Abstract: The goals of COPD therapy are to prevent and control symptoms, reduce the frequency and severity of exacerbations, and improve exercise tolerance. The triple combination therapy of inhaled corticosteroids (ICSs, long-acting beta2 agonists (LABAs, and long-acting muscarinic antagonists (LAMAs has become an option for maintenance treatment of COPD and as a “step-up” therapy from single or double combination treatments. There is evidence that triple combination ICS/LABA/LAMA with different inhalers improves lung function, symptoms, and health status and reduces exacerbations. A new triple fixed-dose combination of extrafine beclomethasone dipropionate (100 µg/puff/formoterol fumarate (6 µg/puff/glycopyrronium bromide (12.5 µg/puff has been developed as a hydrofluoroalkane pressurized metered dose inhaler. Two large pivotal studies showed that this extrafine fixed ICS/LABA/LAMA triple combination is superior to fixed ICS/LABA combined therapy and also superior to the LAMA tiotropium in terms of lung function and exacerbation prevention in COPD patients at risk of exacerbation. This review considers the new information provided by these clinical trials of extrafine triple therapy and the implications for the clinical management of COPD patients. Keywords: COPD, inhaled triple therapy, beclomethasone dipropionate, formoterol fumarate and glycopyrronium bromide

LA SINDROME OSSESSIVA SPAZIO-TEMPORALE DEGLI ITALIANI

African Journals Online (AJOL)

User

“Spazio e tempo sono maledizioni che gravano sulla terra”. La citazione è tratta dall'opera Trunkene Flut del 1949, tradotta in italiano con il titolo Flutto ebbro (a cura di A.M. Carpi, Guanda, Parma, 1989). Il pessimismo è una delle caratteristiche principali di Gottfried Benn (1886-1956), medico di professione, autore anche ...

Comparative FISH mapping of BMPR1B, BMP15 and GDF9 ...

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 92; Issue 3. Comparative FISH mapping of BMPR1B, BMP15 and GDF9 fecundity genes on cattle, river buffalo, sheep and goat chromosomes. A. Farhadi V. Genualdo A. Perucatti S. H. Hafezian G. Rahimi-Mianji L. De Lorenzi P. Parma L. Iannuzzi A. Iannuzzi. Research Note ...

Morphological evolution of Bardigiano horse

Directory of Open Access Journals (Sweden)

A.L. Catalano

2010-01-01

Full Text Available The Bardigiano horse is a local breed of the province of Parma. Since the institution of the Stud Book in 1977, the breed has improved its diffusion and is currently present with 110 stallions and over 1700 mares in 43 provinces in Italy and beyond that in Germany, Switzerland and Hungary.

Efecto de la Adición de Hidrocoloides sobre las Características Reológicas de Salmueras para Elaboración de Jamón Cocido / Effect of Addition of Hydrocolloids on Rheological Properties of the Brines Used to Prepare Cooked Ham

Directory of Open Access Journals (Sweden)

Sepúlveda Cossio Cesar Augusto

2013-08-01

Full Text Available Resumen. Con el fin de determinar el efecto de la inclusión de goma de algarrobo (GA, carragenina kappa (CK y carragenina iota (CI en salmueras para inyección de jamones cocidos, sobre algunas propiedades reológicas tales como viscosidad, módulo elástico (G´ y tangente de pérdida (tangente δ, se planteó un experimento por diseño de mezclas en el que se empleó una formulación para jamón comercial (1% de hidrocoloides, en el cual se utilizaron hidrocoloides individuales o mezclas binarias y terciarias de GA, CK y CI, respectivamente. Adicionalmente, los resultados fueron analizados mediante la metodología de las superficies de respuesta. Los resultados indicaron que la salmuera que presentó la menor viscosidad fue la que contenía100% de CK, el gel de salmuera que presentó el mayor G´ fue la que contenía 3,8 (GA: 96,2 (CK, y el gel que presentó la menor tangente de pérdida y baja viscosidad fue el diseñado con la mezcla terciaria 10,56 (GA: 72,56 (CK: 16,88 (CI. / Abstract. In order to determine the effect on some rheological properties such as viscosity, elastic modulus (G’ and loss tangent (tan δ of the inclusion of locust bean gum (GA, kappa carrageenan (CK and iota carrageenan (CI in brines to inject in cooked ham, a statistical mixture design was established to commercial ham (1% hydrocolloids in which individual, binary and tertiary mixtures of GA, CK and CI were prepared. The results were analyzed using the response surfaces methodology. The results indicated that the brine with the lowest viscosity was to kappa carrageenan (CK=100%, the brine gel with the highest value of elastic modulus (G´ was to the binary mixture containing 3.8 (GA: 96.2 (CK, and the gel with the lowest loss tangent and viscosity was present in the tertiary mixture of 10.56(GA: 72.56 (CK: 16.88 (CI.

Cardiovascular risk profile in patients with myelopathy associated with HTLV-1.

Science.gov (United States)

Prado, Fabio Luís Silva do; Prado, Renata; Ladeia, Ana Marice Teixeira

HAM/TSP (HTLV-1-associated myelopathy/tropical spastic paraparesis) is a slowly progressive disease, characterized by a chronic spastic paraparesis. It is not known if the disease carries an independent risk for cardiovascular disease. The objective of this study was to evaluate the cardiovascular risk profile related to HAM/TSP and compare it with the general population. This was a cross-sectional study, with a control group. HAM/TSP patients were evaluated using cardiovascular risk scores (ASCVD RISK, SCORE and Framingham) and inflammatory markers (ultrasensitive CRP and IL-6), and compared with a control group of healthy individuals. We also evaluated the correlation between cardiovascular risk and the functional status of patients with HAM/TSP evaluated by the FIM scale. Eighty percent of patients in this study were females, mean age of 51 years (11.3). The control group showed an increased cardiovascular event risk in 10 years when ASCVD was analyzed (cardiovascular risk ≥7.5% in 10 years seen in 43% of patients in the control group vs. 23% of patients with HAM/TSP; p=0.037). There was no difference in ultrasensitive CRP or IL-6 values between the groups, even when groups were stratified into low and high risk. There was no correlation between the functional status of HAM/TSP patients and the cardiovascular risk. In this study, the cardiovascular risk profile of patients with HAM/TSP was better than the risk of the control group. Copyright © 2017 Sociedade Brasileira de Infectologia. Published by Elsevier Editora Ltda. All rights reserved.

The effect of fecal microbiota transplantation on psychiatric symptoms among patients with irritable bowel syndrome, functional diarrhea and functional constipation: An open-label observational study.

Science.gov (United States)

Kurokawa, Shunya; Kishimoto, Taishiro; Mizuno, Shinta; Masaoka, Tatsuhiro; Naganuma, Makoto; Liang, Kuo-Ching; Kitazawa, Momoko; Nakashima, Moeko; Shindo, Chie; Suda, Wataru; Hattori, Masahira; Kanai, Takanori; Mimura, Masaru

2018-08-01

The intestinal microbiota is considered as a potential common underpinning pathophysiology of Functional Gastrointestinal Disorders (FGIDs) and psychiatric disorders such as depression and anxiety. Fecal Microbiota Transplantation (FMT) has been reported to have therapeutic effects on diseases related to dysbiosis, but few studies have evaluated its effect on psychiatric symptoms. We followed 17 patients with either Irritable Bowel Syndrome (IBS), Functional Diarrhea (FDr) or Functional Constipation (FC) who underwent FMT for the treatment of gastrointestinal symptoms and observation of psychiatric symptoms. Changes in Hamilton Rating Scale for Depression (HAM-D) and subscale of sleep-related items, Hamilton Rating Scale for Anxiety (HAM-A) and Quick Inventory for Depressive Symptoms (QIDS) between baseline and 4 weeks after FMT, and relationship with the intestinal microbiota were measured. At baseline, 12 out of 17 patients were rated with HAM-D ≥ 8. Significant improvement in HAM-D total and sleep subscale score, HAM-A and QIDS were observed (p = 0.007, p = 0.007, p = 0.01, p = 0.007, respectively). Baseline Shannon index indicated that microbiota showed lower diversity in patients with HAM-D ≥ 8 compared to those of healthy donors and patients with HAM-D control group. Our results suggest that depression and anxiety symptoms may be improved by FMT regardless of gastrointestinal symptom change in patients with IBS, FDr and FC, and the increase of microbiota diversity may help to improve patient's mood. Copyright © 2018 Elsevier B.V. All rights reserved.

Interplay between electron-phonon and electron-electron interactions

International Nuclear Information System (INIS)

Roesch, O.; Gunnarsson, O.; Han, J.E.; Crespi, V.H.

2005-01-01

We discuss the interplay between electron-electron and electron-phonon interactions for alkali-doped fullerides and high temperature superconductors. Due to the similarity of the electron and phonon energy scales, retardation effects are small for fullerides. This raises questions about the origin of superconductivity, since retardation effects are believed to be crucial for reducing effects of the Coulomb repulsion in conventional superconductors. We demonstrate that by treating the electron-electron and electron-phonon interactions on an equal footing, superconductivity can be understood in terms of a local pairing. The Jahn-Teller character of the important phonons in fullerides plays a crucial role for this result. To describe effects of phonons in cuprates, we derive a t-J model with phonons from the three-band model. Using exact diagonalization for small clusters, we find that the anomalous softening of the half-breathing phonon as well as its doping dependence can be explained. By comparing the solution of the t-J model with the Hartree-Fock approximation for the three-band model, we address results obtained in the local-density approximation for cuprates. We find that genuine many-body results, due to the interplay between the electron-electron and electron-phonon interactions, play an important role for the the results in the t-J model. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Iga tund võib olla riigikaitsetund / Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2015-01-01

Riigikaitseõpetuse seostamisest teiste õppeainetega. Rocca al Mare koolis teevad riigikaitseõpetuse osas koostööd geograafiaõpetaja Marek Nisuma ning ajalooõpetajad Katrin Martsik ja Ronald Juurmaa

Põhjamaine kargus ja lõbus plastiliiniaed / Victoria Parmas

Index Scriptorium Estoniae

Parmas, Victoria

2009-01-01

Maailma nimekaimast aiandusfestivalist Chelsea Flower Show 2009 Londonis, uusi trende ja publiku lemmikuid - parim show-aed The Daily Telegraph garden Ulf Nordfjellilt ja Robert Myersi Vähiuuringute instituudi aed ning rõõmsat elevust tekitanud aed Plastiliini Paradiis, mille autoriks on humoorika motosarja Top Gear juht James May

Expansion in CD39⁺ CD4⁺ immunoregulatory t cells and rarity of Th17 cells in HTLV-1 infected patients is associated with neurological complications.

Directory of Open Access Journals (Sweden)

Fabio E Leal

Full Text Available HTLV-1 infection is associated with several inflammatory disorders, including the neurodegenerative condition HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP. It is unclear why a minority of infected subjects develops HAM/TSP. CD4⁺ T cells are the main target of infection and play a pivotal role in regulating immunity to HTLV and are hypothesized to participate in the pathogenesis of HAM/TSP. The CD39 ectonucleotidase receptor is expressed on CD4⁺ T cells and based on co-expression with CD25, marks T cells with distinct regulatory (CD39⁺CD25⁺ and effector (CD39⁺CD25⁻ function. Here, we investigated the expression of CD39 on CD4⁺ T cells from a cohort of HAM/TSP patients, HTLV-1 asymptomatic carriers (AC, and matched uninfected controls. The frequency of CD39⁺ CD4⁺ T cells was increased in HTLV-1 infected patients, regardless of clinical status. More importantly, the proportion of the immunostimulatory CD39⁺CD25⁻ CD4⁺ T-cell subset was significantly elevated in HAM/TSP patients as compared to AC and phenotypically had lower levels of the immunoinhibitory receptor, PD-1. We saw no difference in the frequency of CD39⁺CD25⁺ regulatory (Treg cells between AC and HAM/TSP patients. However, these cells transition from being anergic to displaying a polyfunctional cytokine response following HTLV-1 infection. CD39⁻CD25⁺ T cell subsets predominantly secreted the inflammatory cytokine IL-17. We found that HAM/TSP patients had significantly fewer numbers of IL-17 secreting CD4⁺ T cells compared to uninfected controls. Taken together, we show that the expression of CD39 is upregulated on CD4⁺ T cells HAM/TSP patients. This upregulation may play a role in the development of the proinflammatory milieu through pathways both distinct and separate among the different CD39 T cell subsets. CD39 upregulation may therefore serve as a surrogate diagnostic marker of progression and could potentially be a target for

Cytokine profile and proviral load among Japanese immigrants and non-Japanese infected with HTLV-1 in a non-endemic area of Brazil.

Directory of Open Access Journals (Sweden)

João Américo Domingos

Full Text Available The lifetime risk of HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP development differs among ethnic groups. To better understand these differences, this prospective cohort study was conducted to investigate the cytokine profile and the HTLV-1 proviral load (PVL in Japanese and non-Japanese populations with HAM/TSP and asymptomatic carriers (ACs. The serum IL-2, IL-4, IL-6, IL-10, IL-17, TNF-α, and IFN-γ levels were quantified using the Cytometric Bead Array in 40 HTLV-1-infected patients (11 HAM/TSP and 29 ACs and 18 healthy controls (HCs in Brazil. Among ACs, 15 were Japanese descendants and 14 were non-Japanese. Of 11 patients with HAM/TSP, only one was a Japanese descendant. The HTLV-1 PVL was quantified by real-time PCR. The HTLV-1 PVL was 2.7-fold higher in HAM/TSP patients than ACs. Regardless of the clinical outcome, the PVL was significantly higher in patients younger than 60 years than older patients. The HAM/TSP and ACs had higher IL-10 serum concentrations than that of HCs. The ACs also showed higher IL-6 serum levels than those of HCs. According to age, the IL-10 and IL-6 levels were higher in ACs non-Japanese patients older than 60 years. HAM/TSP patients showed a positive correlation between IL-6 and IL-17 and a negative correlation between the PVL and IL-17 and IFN-γ. In the all ACs, a significant positive correlation was observed between IL-2 and IL-17 and a negative correlation was detected between IL-10 and TNF-α. Only 6.25% of the Japanese patients were symptomatic carriers, compared with 41.67% of the non-Japanese patients. In conclusion, this study showed that high levels of HTLV-1 PVL was intrinsicaly associated with the development of HAM/TSP. A higher HTLV-1 PVL and IL10 levels found in non-Japanese ACs over 60 years old, which compared with the Japanese group depicts that the ethnic background may interfere in the host immune status. More researches also need to be undertaken regarding the host

Convolutional Codes with Maximum Column Sum Rank for Network Streaming

OpenAIRE

Mahmood, Rafid; Badr, Ahmed; Khisti, Ashish

2015-01-01

The column Hamming distance of a convolutional code determines the error correction capability when streaming over a class of packet erasure channels. We introduce a metric known as the column sum rank, that parallels column Hamming distance when streaming over a network with link failures. We prove rank analogues of several known column Hamming distance properties and introduce a new family of convolutional codes that maximize the column sum rank up to the code memory. Our construction invol...

Solving system of DAEs by homotopy analysis method

International Nuclear Information System (INIS)

Awawdeh, Fadi; Jaradat, H.M.; Alsayyed, O.

2009-01-01

Homotopy analysis method (HAM) is applied to systems of differential-algebraic equations (DAEs). The HAM is proved to be very effective, simple and convenient to give approximate analytical solutions to DAEs.

Internet seinakontaktist on tulevikumuusika / Kai Simson

Index Scriptorium Estoniae

Simson, Kai

2004-01-01

Näitusel Enerex 2004 tutvustas Schneider Electric Eesti AS esmakordselt Power Line Communicationi (PLC) ühendust, millega saab Internetti edastada ja jagada elektrivõrgu kaudu. Kommenteerivad Fortum Elekter AS-i Läänemaa regiooni võrgujuht Kaupo Kuurberg, Elion Ettevõtted AS-i meediasuhete juht Ain Parmas ja Eesti Energia Televõrgu AS-i juhataja Urmas Aiaste

Neurological manifestations in individuals with HTLV-1-associated myelopathy/tropical spastic paraparesis in the Amazon.

Science.gov (United States)

Dias, G A S; Yoshikawa, G T; Koyama, R V L; Fujihara, S; Martins, L C S; Medeiros, R; Quaresma, J A S; Fuzii, H T

2016-02-01

A cross-sectional observational study was conducted. The aim was to analyze the clinical-functional profile of patients diagnosed with HTLV-1 (human T-lymphotropic virus type 1)-associated myelopathy/tropical spastic paraparesis (HAM/TSP) in the Amazon region. Reference center for HTLV in the city of Belém, state of Pará, Brazil. Muscle strength, muscle tone, balance and the need for gait assistance among patients with HAM/TSP were evaluated. Among the 82 patients infected with HTLV-1, 27 (10 men and 17 women) were diagnosed with HAM/TSP. No statistically significant difference in muscle tone or strength was found between the lower limbs. Muscle weakness and spasticity were predominant in the proximal lower limbs. Patients with HAM/TSP are at a high risk of falls (P=0.03), and predominantly use either a cane or a crutch on one side as a gait-assistance device (P=0.02). Patients with HAM/TSP exhibit a similar clinical pattern of muscle weakness and spasticity, with a high risk of falls, requiring gait-assistance devices.

Depression and anxiety in hypothyroidism.

Science.gov (United States)

Demet, M M; Ozmen, B; Deveci, A; Boyvada, S; Adiguzel, H; Aydemir, O

2003-09-01

The aim of the study was to determine the prevalence and severity of depression and anxiety in patients with hypothyroidism and to compare this with euthyroid patients. Thirty patients with hypothyroidism and 30 euthyroid controls attending the Endocrinology outpatient department of Celal Bayar University, Medical Faculty were included in the study. The hormonal screening was done by immunoassay and haemagglutination methods. Then, for psychiatric assessment, Hospital Anxiety and Depression Scale (HAD), Hamilton Depression Rating Scale (HAM-D), and Hamilton Anxiety Rating Scale (HAM-A) were used. There was no difference between the two groups in terms of demographic features. Total scores obtained from the scales used in the study did not differ significantly (p > 0.05). The frequency of items of both HAM-D and HAM-A did not show any differences in the two groups. By Wilks' Lambda discriminant analysis, depressive mood (HAM-D#1) was found to be the discriminating feature between the hypothyroid group and the euthyroid group. Therefore, depression and anxiety were not outstanding features in hypothyrodism. However, depression was more significant in the hypothyroid than euthyroid group.

CT Chest and pulmonary functional changes in patients with HTLV-associated myelopathy in the Eastern Brazilian Amazon.

Directory of Open Access Journals (Sweden)

Luiz Fábio Magno Falcão

Full Text Available The aim of this study was to compare computed tomography (CT scans of chest and lung function among patients with Human T-Lymphotropic Virus Type 1 (HTLV with and without HTLV-1 associated myelopathy/tropical spastic paraparesis (HAM/TSP. In this cross-sectional study performed between January 2013 and June 2016, we included 48 patients with HAM/TSP (19 women and 11 men and without HAM/TSP (12 women and 6 men. We compared CT findings and lung functions of these groups. Patients who had HAM/TSP had abnormal CT findings (P = 0.000, including more frequent bronchiectasis (P = 0.049, parenchymal bands (P = 0.007, interlobular septal thickening (P = 0.035, and pleural thickening (P = 0.009. In addition, neither patients with HAM/TSP (9/30; 30% nor the controls (0/18; 0% had obstructive or restrictive lung disease (P = 0.009. HTLV diagnosis should be considered in all patients with abnormal CT findings in whom no other cause is apparent. It is important to remember that lung disease increases the rates of morbidity and mortality in developing countries.

Psychological Status of Adolescents with Respiratory Allergic Diseases and Their Caregivers

Directory of Open Access Journals (Sweden)

Duygu Erge

2016-12-01

Full Text Available Objective: The aim of the study was to evaluate the psychological status of adolescents with respiratory allergies and their caregivers. Materials and Methods: Child and adolescent psychiatrists evaluated the adolescents’ psychological status using the Children’s Depression Inventory (CDI and Screen for Child Anxiety-Related Emotional Disorders (SCARED. Psychiatrist evaluated the psychological status of their caregivers using the Hamilton Depression Scale (HAM-D and the Hamilton Anxiety Scale (HAM-A. Results: Anxiety symptoms were found in 21 of 63 patients. CDI scores were higher in controls than in patients (p=0.03. HAM-D scores were higher in the caregivers of adolescents with allergic rhinitis and comorbid asthma than in those of controls (p=0.025. None of the scores were affected by the severity of asthma and allergic rhinitis, asthma control levels, presence of an asthma attack in the preceding year as well as by pulmonary function tests (p>0.05. Moderate and strong positive correlations were found between SCARED and CDI (r=0.644, p<0.001 and HAM-A and HAM-D scores (r=0.860, p<0.001. Conclusion: Anxiety symptoms were found in one-third of the patients. HAM-D scores were higher in the caregivers of adolescents with allergic rhinitis and comorbid asthma than in those of controls.

Highly abundant and stage-specific mRNAs in the obligate pathogen Bremia lactucae.

Science.gov (United States)

Judelson, H S; Michelmore, R W

1990-01-01

Germinating spores of the obligate pathogen Bremia lactucae (lettuce downy mildew) contain several unusually abundant species of mRNA. Thirty-nine cDNA clones corresponding to prevalent transcripts were isolated from a library synthesized using poly(A)+ RNA from germinating spores; these clones represented only five distinct classes. Each corresponding mRNA accounted for from 0.4 to 9 percent by mass of poly(A)+ RNA from germinating spores and together represented greater than 20 percent of the mRNA. The expression of the corresponding genes, and a gene encoding Hsp70, was analyzed in spores during germination and during growth in planta. The Hsp70 mRNA and mRNA from one abundant cDNA clone (ham34) were expressed constitutively. Two clones (ham9 and ham12) hybridized only to mRNA from spores and germinating spores. Two clones (ham37 and ham27) showed hybridization specific to germinating spores. Quantification of the number of genes homologous to each cDNA clone indicated that four clones corresponded to one or two copies per haploid genome, and one hybridized to an approximately 11-member family of genes. A sequence of the gene corresponding to ham34 was obtained to investigate its function and to identify sequences conferring high levels of gene expression for use in constructing vectors for the transformation of B. lactucae.

Electronic emission and electron guns

International Nuclear Information System (INIS)

Roy, Amitava

2010-01-01

This paper reviews the process of electron emission from metal surface. Although electrons move freely in conductors like metals, they normally do not leave the metal without some manipulation. In fact, heating and bombardment are the two primary ways in which electrons are emitted through the use of a heating element behind the cathode (termed thermionic emission) or as a result of bombardment with a beam of electrons, ions, or metastable atoms (termed secondary emission). Another important emission mechanism called Explosive Electron Emission (EEE) is also often used in various High Voltage Pulse Power Systems to generate very high current (few hundreds of kA) pulsed electron beams. The electron gun is the device in that it shoots off a continuous (or pulsed) stream of electrons. A brief idea about the evolution of the electron gun components and their basis of functioning are also discussed. (author)

Balance, functional mobility, and fall occurrence in patients with human T-cell lymphotropic virus type-1-associated myelopathy/tropical spastic paraparesis: a cross-sectional study

Directory of Open Access Journals (Sweden)

Erika Pedreira da Fonseca

Full Text Available Abstract INTRODUCTION: Human T-cell lymphotropic virus type-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP may lead to reduced functional mobility and balance. It is important to establish specific parameters that identify these changes and predict the risk of falls in these patients. The aim was to compare balance, functional mobility, and occurrence of falls among patients with and without HAM/TSP and to suggest values to predict the risk of falls in these patients. METHODS: A cross-sectional study in patients with and without HAM/TSP involved balance assessments based on the berg balance scale (BBS and functional mobility evaluation based on the timed up and go (TUG test. From reports of falls, the sensitivity, specificity, and best cutoff points for the risk of falls assessed by these instruments were established using the receiver-operating characteristic (ROC curve; 5% alpha was considered. RESULTS: We selected 42 participants: 29 with HAM/TSP and 13 without HAM/TSP. There was a statistically significant difference in the occurrence of falls, balance, and functional mobility between the groups (p<0.05. Good accuracy was determined for the BBS (77% and TUG test (70% and the cutoff points for the risk of falls were defined as 50 points for the BBS and 12.28 seconds for the TUG test. CONCLUSIONS: Patients with HAM/TSP present reduced functional mobility and balance in relation to those without HAM/TSP. The risk of falls increased for these patients can be evaluated by the values of 50 points using the BBS and 12.28 seconds using the TUG test.

Sensory characteristics of high-amylose maize-resistant starch in three food products

OpenAIRE

Maziarz, Mindy; Sherrard, Melanie; Juma, Shanil; Prasad, Chandan; Imrhan, Victorine; Vijayagopal, Parakat

2012-01-01

Type 2 resistant starch from high-amylose maize (HAM-RS2) is considered a functional ingredient due to its positive organoleptic and physiochemical modifications associated with food and physiological benefits related to human health. The sensory characteristics of three types of food products (muffins, focaccia bread, and chicken curry) with and without HAM-RS2 were evaluated using a 9-point hedonic scale. The HAM-RS2-enriched muffins, focaccia bread, and chicken curry contained 5.50 g/100 g...

Effects of transcranial direct current stimulation on pain, mood and serum endorphin level in the treatment of fibromyalgia: A double blinded, randomized clinical trial.

Science.gov (United States)

Khedr, Eman M; Omran, Eman A H; Ismail, Nadia M; El-Hammady, Dina H; Goma, Samar H; Kotb, Hassan; Galal, Hannan; Osman, Ayman M; Farghaly, Hannan S M; Karim, Ahmed A; Ahmed, Gehad A

Recent studies have shown that novel neuro-modulating techniques can have pain-relieving effects in the treatment of chronic pain. The aim of this work is to evaluate the effects of transcranial direct current stimulation (tDCS) in relieving fibromyalgia pain and its relation with beta-endorphin changes. Forty eligible patients with primary fibromyalgia were randomized to receive real anodal tDCS or sham tDCS of the left motor cortex (M1) daily for 10 days. Each patient was evaluated using widespread pain index (WPI), symptom severity of fibromyalgia (SS), visual analogue scale (VAS), and determination of pain threshold as a primary outcome. Hamilton depression and anxiety scales (HAM-D and HAM-A) and estimation of serum beta-endorphin level pre and post-sessions were used as secondary outcome. All rating scales were conducted at the baseline, after the 5th, 10th session, 15 days and 1 month after the end of the sessions. Eighteen patients from each group completed the follow-up schedule with no significant difference between them regarding the duration of illness or the baseline scales. A significant TIME × GROUP interaction for each rating scale (WPI, SS, VAS, pain threshold, HAM-A, HAM-D) indicated that the effect of treatment differed in the two groups with higher improvement in the experimental scores of the patients in the real tDCS group (P = 0.001 for WPI, SS, VAS, pain threshold, and 0.002, 0.03 for HAM-A, HAM-D respectively). Negative correlations between changes in serum beta-endorphin level and the changes in different rating scales were found (P = 0.003, 0.003, 0.05, 0.002, 0002 for WPI, SS, VAS, HAM-A, and HAM-D respectively). Ten sessions of real tDCS over M1 can induce pain relief and mood improvement in patients with fibromyalgia, which were found to be related to changes in serum endorphin levels. ClinicalTrials.gov Identifier: NCT02704611. Copyright © 2017 Elsevier Inc. All rights reserved.

Comprehensive Antiretroviral Restriction Factor Profiling Reveals the Evolutionary Imprint of the ex Vivo and in Vivo IFN-β Response in HTLV-1-Associated Neuroinflammation.

Science.gov (United States)

Leal, Fabio E; Menezes, Soraya Maria; Costa, Emanuela A S; Brailey, Phillip M; Gama, Lucio; Segurado, Aluisio C; Kallas, Esper G; Nixon, Douglas F; Dierckx, Tim; Khouri, Ricardo; Vercauteren, Jurgen; Galvão-Castro, Bernardo; Saraiva Raposo, Rui Andre; Van Weyenbergh, Johan

2018-01-01

HTLV-1-Associated Myelopathy (HAM/TSP) is a progressive neuroinflammatory disorder for which no disease-modifying treatment exists. Modest clinical benefit from type I interferons (IFN-α/β) in HAM/TSP contrasts with its recently identified IFN-inducible gene signature. In addition, IFN-α treatment in vivo decreases proviral load and immune activation in HAM/TSP, whereas IFN-β therapy decreases tax mRNA and lymphoproliferation. We hypothesize this "IFN paradox" in HAM/TSP might be explained by both cell type- and gene-specific effects of type I IFN in HTLV-1-associated pathogenesis. Therefore, we analyzed ex vivo transcriptomes of CD4 + T cells, PBMCs and whole blood in healthy controls, HTLV-1-infected individuals, and HAM/TSP patients. First, we used a targeted approach, simultaneously quantifying HTLV-1 mRNA (HBZ, Tax), proviral load and 42 host genes with known antiretroviral (anti-HIV) activity in purified CD4 + T cells. This revealed two major clusters ("antiviral/protective" vs. "proviral/deleterious"), as evidenced by significant negative (TRIM5/TRIM22/BST2) vs. positive correlation (ISG15/PAF1/CDKN1A) with HTLV-1 viral markers and clinical status. Surprisingly, we found a significant inversion of antiretroviral activity of host restriction factors, as evidenced by opposite correlation to in vivo HIV-1 vs. HTLV-1 RNA levels. The anti-HTLV-1 effect of antiviral cluster genes was significantly correlated to their adaptive chimp/human evolution score, for both Tax mRNA and PVL. Six genes of the proposed antiviral cluster underwent lentivirus-driven purifying selection during primate evolution (TRIM5/TRIM22/BST2/APOBEC3F-G-H), underscoring the cross-retroviral evolutionary imprint. Secondly, we examined the genome-wide type I IFN response in HAM/TSP patients, following short-term ex vivo culture of PBMCs with either IFN-α or IFN-β. Microarray analysis evidenced 12 antiretroviral genes (including TRIM5α/TRIM22/BST2) were significantly up-regulated by IFN

Born-Oppenheimer Dynamics, Electronic Friction, and the Inclusion of Electron-Electron Interactions

Science.gov (United States)

Dou, Wenjie; Miao, Gaohan; Subotnik, Joseph E.

2017-07-01

We present a universal expression for the electronic friction as felt by a set of classical nuclear degrees of freedom (DOFs) coupled to a manifold of quantum electronic DOFs; no assumptions are made regarding the nature of the electronic Hamiltonian and electron-electron repulsions are allowed. Our derivation is based on a quantum-classical Liouville equation for the coupled electronic-nuclear motion, followed by an adiabatic approximation whereby electronic transitions are assumed to equilibrate faster than nuclear movement. The resulting form of friction is completely general, but does reduce to previously published expressions for the quadratic Hamiltonian (i.e., Hamiltonians without electronic correlation). At equilibrium, the second fluctuation-dissipation theorem is satisfied and the frictional matrix is symmetric. To demonstrate the importance of electron-electron correlation, we study electronic friction within the Anderson-Holstein model, where a proper treatment of electron-electron interactions shows signatures of a Kondo resonance and a mean-field treatment is completely inadequate.

Solutions of Heat-Like and Wave-Like Equations with Variable Coefficients by Means of the Homotopy Analysis Method

International Nuclear Information System (INIS)

Alomari, A. K.; Noorani, M. S. M.; Nazar, R.

2008-01-01

We employ the homotopy analysis method (HAM) to obtain approximate analytical solutions to the heat-like and wave-like equations. The HAM contains the auxiliary parameter ħ, which provides a convenient way of controlling the convergence region of series solutions. The analysis is accompanied by several linear and nonlinear heat-like and wave-like equations with initial boundary value problems. The results obtained prove that HAM is very effective and simple with less error than the Adomian decomposition method and the variational iteration method

AMATEUR "HAM" RADIO

Science.gov (United States)

these cooler months. Did you know your body can cool 25 times faster in water than in air? That water code at 13 or 20 words-per-minute will no longer be required to obtain amateur radio operating be found by contacting the ARRL or using an Internet search engine to search on such topics as "

Severity of anxiety- but not depression- is associated with oxidative stress in Major Depressive Disorder.

Science.gov (United States)

Steenkamp, Lisa R; Hough, Christina M; Reus, Victor I; Jain, Felipe A; Epel, Elissa S; James, S Jill; Morford, Alexandra E; Mellon, Synthia H; Wolkowitz, Owen M; Lindqvist, Daniel

2017-09-01

Oxidative stress is implicated in both depression and anxiety, but it is currently unclear whether this relates to syndromal diagnoses or trans-diagnostic dimensional symptoms. We examined the relationship between oxidative stress and severity of depression and anxiety symptoms in individuals with Major Depressive Disorder (MDD). Plasma oxidative stress markers F2-isoprostanes and oxidized glutathione (GSSG), and the antioxidant reduced glutathione (GSH), were assessed in 69 physically healthy, medication-free MDD subjects. Symptoms of anxiety and depression were assessed using the Hamilton Anxiety (HAM-A) and Hamilton Depression (HAM-D) Rating Scales. Total HAM-A and HAM-D scores, along with "core" anxiety and depression subscales, and individual HAM-D items "psychic anxiety" and "depressed mood," were related to oxidative stress markers. Analyses controlled for age, sex, BMI, and smoking. Total HAM-A ratings were positively associated with F2-isoprostanes (β=.26, p=.042) and GSSG (β=.25, p=.049), but not GSH (β=.05, p=.711). Core anxiety severity was positively associated with F2-isoprostanes (β=.34, p=.012) and GSSG, although this did not reach significance (β=.24, p=.074). None of the biological markers were significantly associated with total HAM-D or core depression ratings (all p>.13). Subjects scoring high on "psychic anxiety" had elevated F2-isoprostanes (p=.030) and GSSG (p=.020). This was not seen with "depressed mood" scores (all p>.12). We assessed peripheral oxidative markers, but their relationship to the brain is unclear. Oxidative stress is more closely related to anxiety than depression symptoms in MDD. This highlights the importance of relating oxidative stress to specific symptoms and could provide new insights into the biological correlates of affective disorders. Copyright © 2017 Elsevier B.V. All rights reserved.

Lower numbers of circulating natural killer T (NK T) cells in individuals with human T lymphotropic virus type 1 (HTLV-1) associated neurological disease

Science.gov (United States)

Ndhlovu, L C; Snyder-Cappione, J E; Carvalho, K I; Leal, F E; Loo, C P; bruno, F R; Jha, A R; Devita, D; Hasenkrug, A M; Barbosa, H M R; Segurado, A C; Nixon, D F; Murphy, E L; Kallas, E G

2009-01-01

Human T lymphotropic virus type 1 (HTLV-1) infects 10–20 million people worldwide. The majority of infected individuals are asymptomatic; however, approximately 3% develop the debilitating neurological disease HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). There is also currently no cure, vaccine or effective therapy for HTLV-1 infection, and the mechanisms for progression to HAM/TSP remain unclear. NK T cells are an immunoregulatory T cell subset whose frequencies and effector functions are associated critically with immunity against infectious diseases. We hypothesized that NK T cells are associated with HAM/TSP progression. We measured NK T cell frequencies and absolute numbers in individuals with HAM/TSP infection from two cohorts on two continents: São Paulo, Brazil and San Francisco, CA, USA, and found significantly lower levels when compared with healthy subjects and/or asymptomatic carriers. Also, the circulating NK T cell compartment in HAM/TSP subjects is comprised of significantly more CD4+ and fewer CD8+ cells than healthy controls. These findings suggest that lower numbers of circulating NK T cells and enrichment of the CD4+ NK T subset are associated with HTLV-1 disease progression. PMID:19778295

Proteome Profiles of Digested Products of Commercial Meat Sources

Science.gov (United States)

Li, Li; Liu, Yuan; Zhou, Guanghong; Xu, Xinglian; Li, Chunbao

2017-01-01

This study was designed to characterize in vitro-digested products of proteins from four commercial meat products, including dry-cured ham, cooked ham, emulsion-type sausage, and dry-cured sausage. The samples were homogenized and incubated with pepsin and trypsin. The digestibility and particle sizes of digested products were measured. Nano-LC–MS/MS was applied to characterize peptides. The results showed the highest digestibility and the lowest particle size in dry-cured ham (P meat products. Our findings give an insight into nutritional values of different meat products. PMID:28396857

On the Analytical Solution of Non-Orthogonal Stagnation Point Flow towards a Stretching Sheet

DEFF Research Database (Denmark)

Kimiaeifar, Amin; Bagheri, G. H.; Barari, Amin

2011-01-01

An analytical solution for non-orthogonal stagnation point for the steady flow of a viscous and incompressible fluid is presented. The governing nonlinear partial differential equations for the flow field are reduced to ordinary differential equations by using similarity transformations existed...... in the literature and are solved analytically by means of the Homotopy Analysis Method (HAM). The comparison of results from this paper and those published in the literature confirms the precise accuracy of the HAM. The resulting analytical equation from HAM is valid for entire physical domain and effective...

AcEST: DK952239 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 30 7.0 sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila me... 30...FSIVMPFVAPLRILSNKGYIYASLKTHPLK 221 >sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogast

Comprehensive Antiretroviral Restriction Factor Profiling Reveals the Evolutionary Imprint of the ex Vivo and in Vivo IFN-β Response in HTLV-1-Associated Neuroinflammation

Directory of Open Access Journals (Sweden)

Fabio E. Leal

2018-05-01

Full Text Available HTLV-1-Associated Myelopathy (HAM/TSP is a progressive neuroinflammatory disorder for which no disease-modifying treatment exists. Modest clinical benefit from type I interferons (IFN-α/β in HAM/TSP contrasts with its recently identified IFN-inducible gene signature. In addition, IFN-α treatment in vivo decreases proviral load and immune activation in HAM/TSP, whereas IFN-β therapy decreases tax mRNA and lymphoproliferation. We hypothesize this “IFN paradox” in HAM/TSP might be explained by both cell type- and gene-specific effects of type I IFN in HTLV-1-associated pathogenesis. Therefore, we analyzed ex vivo transcriptomes of CD4+ T cells, PBMCs and whole blood in healthy controls, HTLV-1-infected individuals, and HAM/TSP patients. First, we used a targeted approach, simultaneously quantifying HTLV-1 mRNA (HBZ, Tax, proviral load and 42 host genes with known antiretroviral (anti-HIV activity in purified CD4+ T cells. This revealed two major clusters (“antiviral/protective” vs. “proviral/deleterious”, as evidenced by significant negative (TRIM5/TRIM22/BST2 vs. positive correlation (ISG15/PAF1/CDKN1A with HTLV-1 viral markers and clinical status. Surprisingly, we found a significant inversion of antiretroviral activity of host restriction factors, as evidenced by opposite correlation to in vivo HIV-1 vs. HTLV-1 RNA levels. The anti-HTLV-1 effect of antiviral cluster genes was significantly correlated to their adaptive chimp/human evolution score, for both Tax mRNA and PVL. Six genes of the proposed antiviral cluster underwent lentivirus-driven purifying selection during primate evolution (TRIM5/TRIM22/BST2/APOBEC3F-G-H, underscoring the cross-retroviral evolutionary imprint. Secondly, we examined the genome-wide type I IFN response in HAM/TSP patients, following short-term ex vivo culture of PBMCs with either IFN-α or IFN-β. Microarray analysis evidenced 12 antiretroviral genes (including TRIM5α/TRIM22/BST2 were significantly

Effective electron-electron and electron-phonon interactions in the Hubbard-Holstein model

International Nuclear Information System (INIS)

Aprea, G.; Di Castro, C.; Grilli, M. . E-mail marco.grilli@roma1.infn.it; Lorenzana, J.

2006-01-01

We investigate the interplay between the electron-electron and the electron-phonon interaction in the Hubbard-Holstein model. We implement the flow-equation method to investigate within this model the effect of correlation on the electron-phonon effective coupling and, conversely, the effect of phonons in the effective electron-electron interaction. Using this technique we obtain analytical momentum-dependent expressions for the effective couplings and we study their behavior for different physical regimes. In agreement with other works on this subject, we find that the electron-electron attraction mediated by phonons in the presence of Hubbard repulsion is peaked at low transferred momenta. The role of the characteristic energies involved is also analyzed

Pharmacological management of panic disorder

Directory of Open Access Journals (Sweden)

Carlo Marchesi

2008-03-01

Full Text Available Carlo MarchesiPsychiatric Section, Department of Neuroscience, University of Parma, Parma, ItalyAbstract: Panic disorder (PD is a disabling condition which appears in late adolescence or early adulthood and affects more frequently women than men. PD is frequently characterized by recurrences and sometimes by a chronic course and, therefore, most patients require longterm treatments to achieve remission, to prevent relapse and to reduce the risks associated with comorbidity. Pharmacotherapy is one of the most effective treatments of PD. In this paper, the pharmacological management of PD is reviewed. Many questions about this effective treatment need to be answered by the clinician and discussed with the patients to improve her/his collaboration to the treatment plan: which is the drug of choice; when does the drug become active; which is the effective dose; how to manage the side effects; how to manage nonresponse; and how long does the treatment last. Moreover, the clinical use of medication in women during pregnancy and breastfeeding or in children and adolescents was reviewed and its risk-benefit balance discussed.Keywords: panic disorder, pharmacological treatment, treatment guidelines

Tocopherol content, weight loss and instrumental color analysis of Iberian dry-cured ham as affected by rearing and feeding systems

Directory of Open Access Journals (Sweden)

Daza, Argimiro

2009-07-01

Full Text Available The effects of rearing (outdoor vs indoor and feeding systems (acorn and grass vs mixed diets on ham quality from Duroc x Iberian pigs were studied. Seven groups of 5 females each were used. One group was reared under freerange conditions and fed with acorns and grass (outdoor pigs. Six group were fed mixed diets in confinement (indoor pigs under a factorial design 3 x 2 with three types of dietary fat: monounsaturated, polyunsaturated and medium (monounsaturated and polyunsaturated and two levels of α-tocopheryl-acetate. The α-and γ-tocopherol contents were higher (P Se ha estudiado el efecto del régimen de producción (en libertad vs estabulados y el sistema de alimentación (bellota y pasto vs piensos formulados en la calidad del jamón de cerdos Ibéricos cruzados con Duroc. Siete grupos de 5 hembras cada uno fueron usadas. Un grupo fue criado en condiciones de libertad y alimentado con bellotas y pasto (Cerdos en libertad. Seis grupos fueron alimentados con dietas formuladas en confinamiento (Cerdos estabulados usando un diseño factorial de 3 x 2 con tres tipos de grasa en la dieta: monoinsaturada, poliinsaturada y media (monoinsaturada y polinsaturada y dos niveles de acetato de α-tocoferol. Los contenidos de α- y γ-tocoferol fueron más altos (p < 0.05 en jamones de cerdos criados en libertad que en jamones de cerdos estabulados. Los jamones de cerdos estabulados pesaron menos que los jamones de cerdos en libertad y los valores de color rojo fueron mayores en jamones de cerdos en libertad que en cerdos estabulados. Después de 4 días de almacenamiento, la muestra de jamón de cerdos en libertad mostraron una menor tendencia (p < 0.10 a perder peso que aquellos de cerdos alimentados con un nivel basal de vitamina E. Estos resultados indican que cerdos Ibérico criados en libertad y alimentados con bellota y pasto incrementan su contenido en tocoferoles y mejoran el color y las pérdidas de peso de los jamones curados.

Electron-electron coincidence spectroscopies at surfaces

International Nuclear Information System (INIS)

Stefani, G.; Iacobucci, S.; Ruocco, A.; Gotter, R.

2002-01-01

In the past 20 years, a steadily increasing number of electron-electron coincidence experiments on atoms and molecules have contributed to a deeper understanding of electron-electron correlation effects. In more recent years this technique has been extended to the study of solid surfaces. This class of one photon IN two electrons OUT experiments will be discussed with an emphasis on grazing incidence geometry, that is expected to be particularly suited for studying surfaces. The crucial question of which is the dominant mechanism that leads to ejection of pairs of electron from the surface will be addressed. It will be shown that, depending on the kinematics chosen, the correlated behaviour of the pairs of electrons detected might be singled out from independent particle one

Factor structure and dimensionality of the two depression scales in STAR*D using level 1 datasets

DEFF Research Database (Denmark)

Bech, P; Fava, M; Trivedi, M H

2011-01-01

the HAM-D(6) and IDS-C(6) were found to be unidimensional scales, i.e., their total scores are each a sufficient statistic for the measurement of depressive states. LIMITATIONS: STAR*D used only one medication in Level 1. CONCLUSIONS: The unidimensional HAM-D(6) and IDS-C(6) should be used when evaluating......BACKGROUND: The factor structure and dimensionality of the HAM-D(17) and the IDS-C(30) are as yet uncertain, because psychometric analyses of these scales have been performed without a clear separation between factor structure profile and dimensionality (total scores being a sufficient statistic......). METHODS: The first treatment step (Level 1) in the STAR*D study provided a dataset of 4041 outpatients with DSM-IV nonpsychotic major depression. The HAM-D(17) and IDS-C(30) were evaluated by principal component analysis (PCA) without rotation. Mokken analysis tested the unidimensionality of the IDS-C(6...

Identification of the significant factors in food safety using global sensitivity analysis and the accept-and-reject algorithm: application to the cold chain of ham.

Science.gov (United States)

Duret, Steven; Guillier, Laurent; Hoang, Hong-Minh; Flick, Denis; Laguerre, Onrawee

2014-06-16

Deterministic models describing heat transfer and microbial growth in the cold chain are widely studied. However, it is difficult to apply them in practice because of several variable parameters in the logistic supply chain (e.g., ambient temperature varying due to season and product residence time in refrigeration equipment), the product's characteristics (e.g., pH and water activity) and the microbial characteristics (e.g., initial microbial load and lag time). This variability can lead to different bacterial growth rates in food products and has to be considered to properly predict the consumer's exposure and identify the key parameters of the cold chain. This study proposes a new approach that combines deterministic (heat transfer) and stochastic (Monte Carlo) modeling to account for the variability in the logistic supply chain and the product's characteristics. The model generates a realistic time-temperature product history , contrary to existing modeling whose describe time-temperature profile Contrary to existing approaches that use directly a time-temperature profile, the proposed model predicts product temperature evolution from the thermostat setting and the ambient temperature. The developed methodology was applied to the cold chain of cooked ham including, the display cabinet, transport by the consumer and the domestic refrigerator, to predict the evolution of state variables, such as the temperature and the growth of Listeria monocytogenes. The impacts of the input factors were calculated and ranked. It was found that the product's time-temperature history and the initial contamination level are the main causes of consumers' exposure. Then, a refined analysis was applied, revealing the importance of consumer behaviors on Listeria monocytogenes exposure. Copyright © 2014. Published by Elsevier B.V.

Electron distribution function in electron-beam-excited plasmas

International Nuclear Information System (INIS)

Brau, C.A.

1976-01-01

In monatomic plasmas excited by high-intensity relativistic electron beams, the electron secondary distribution function is dominated by elastic electron-electron collisions at low electron energies and by inelastic electron-atom collisions at high electron energies (above the excitation threshold). Under these conditions, the total rate of excitation by inelastic collisions is limited by the rate at which electron-electron collisions relax the distribution function in the neighborhood of the excitation threshold. To describe this effect quantitatively, an approximate analytic solution of the electron Boltzmann equation is obtained, including both electron-electron and inelastic collisions. The result provides a simple formula for the total rate of excitation

The pathogenesis of tropical spastic paraparesis/human T-cell leukemia type I-associated myelopathy

Directory of Open Access Journals (Sweden)

Casseb J.

2000-01-01

Full Text Available Tropical spastic paraparesis/human T-cell leukemia type I-associated myelopathy (TSP/HAM is caused by a human T-cell leukemia virus type I (HTLV-I after a long incubation period. TSP/HAM is characterized by a chronic progressive paraparesis with sphincter disturbances, no/mild sensory loss, the absence of spinal cord compression and seropositivity for HTLV-I antibodies. The pathogenesis of this entity is not completely known and involves a multivariable phenomenon of immune system activation against the presence of HTLV-I antigens, leading to an inflammatory process and demyelination, mainly in the thoracic spinal cord. The current hypothesis about the pathogenesis of TSP/HAM is: 1 presence of HTLV-I antigens in the lumbar spinal cord, noted by an increased DNA HTLV-I load; 2 CTL either with their lytic functions or release/production of soluble factors, such as CC-chemokines, cytokines, and adhesion molecules; 3 the presence of Tax gene expression that activates T-cell proliferation or induces an inflammatory process in the spinal cord; 4 the presence of B cells with neutralizing antibody production, or complement activation by an immune complex phenomenon, and 5 lower IL-2 and IFN-gamma production and increased IL-10, indicating drive to a cytokine type 2 pattern in the TSP/HAM subjects and the existence of a genetic background such as some HLA haplotypes. All of these factors should be implicated in TSP/HAM and further studies are necessary to investigate their role in the development of TSP/HAM.

Preparation and in vitro and in vivo evaluation of HupA PLGA microsphere.

Science.gov (United States)

Ye, Liang; Fu, Fenghua; Liu, Wanhui; Sun, Kaoxiang; Li, Youxin; He, Jie; Yu, Xin; Yu, Pengfei; Tian, Jingwei

2013-03-01

Acetylcholinesterase inhibitors (AChEIs), including Huperzine A (HupA), have been the mainstay of treatment for Alzheimer's disease (AD). However, AChEIs can cause gastrointestinal side effects, which has been related to the high Cmax and short tmax after oral administration. Clinical trials have verified that extended-release formulation with lower Cmax and prolonged tmax, such as rivastigmine patch, could perform a similar efficacy with significantly improved tolerability compared with the oral formulations. In this study, we developed an extended-release microspheres formulation of HupA (called as HAM) with poly(lactide-co-glycolide) (PLGA) as drug carrier. HAM has showed the loading rate as 1.35% (w/w) and yielded 42% with mean particle size at 72.6 μm. In vitro and in vivo pharmacokinetics studies have showed that HAM produced a relatively smooth and continuous drug concentration in 14 days. Furthermore, in vivo pharmacokinetics data have demonstrated that the Cmax was lower and the tmax was considerably later in single intramuscular administration of HAM (1,000 μg/kg) than the counterparts in single intragastric administration of HAT (75 μg/kg/d). Meanwhile, HAM has performed a continuous inhibition to brain AChE activity in normal rats and improvement of memory deficit in Aβ1-40 i.c.v. infused AD rat model for 14 days. The results have suggested that HAM has performed good extended-release properties and good prolonged pharmacological efficacy in vivo in the 2-week period, and could exert a similar efficacy with significantly lowered gastrointestinal side effects as compared with oral formulation.

Hard electronics; Hard electronics

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

Hard material technologies were surveyed to establish the hard electronic technology which offers superior characteristics under hard operational or environmental conditions as compared with conventional Si devices. The following technologies were separately surveyed: (1) The device and integration technologies of wide gap hard semiconductors such as SiC, diamond and nitride, (2) The technology of hard semiconductor devices for vacuum micro- electronics technology, and (3) The technology of hard new material devices for oxides. The formation technology of oxide thin films made remarkable progress after discovery of oxide superconductor materials, resulting in development of an atomic layer growth method and mist deposition method. This leading research is expected to solve such issues difficult to be easily realized by current Si technology as high-power, high-frequency and low-loss devices in power electronics, high temperature-proof and radiation-proof devices in ultimate electronics, and high-speed and dense- integrated devices in information electronics. 432 refs., 136 figs., 15 tabs.

Two Parameter Fracture Mechanics: Fatigue Crack Behavior under Mixed Mode Conditions

Czech Academy of Sciences Publication Activity Database

Seitl, Stanislav; Knésl, Zdeněk

2008-01-01

Roč. 75, č. 3-4 (2008), s. 857-865 ISSN 0013-7944. [Crack Paths 2006. Parma, 14.09.2006-16.09.2006] R&D Projects: GA ČR GP101/04/P001 Institutional research plan: CEZ:AV0Z20410507 Keywords : Constraint * Mixed-mode loading * Fatigue crack * Crack growth * Crack path Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.713, year: 2008

Hydroxylamine electrochemistry at low-index single-crystal platinum electrodes in acidic media

NARCIS (Netherlands)

Rosca, V.; Beltramo, G.L.; Koper, M.T.M.

2004-01-01

The electrochemistry of hydroxylamine at low-index single-crystal platinum electrodes in acidic media has been studied by voltammetry and in-situ FTIRRAS. Hydroxylamine (HAM) reactivity at platinum is largely controlled by interaction of the other components of the solution or products of the HAM

AcEST: DK954331 [AcEST

Lifescience Database Archive (English)

Full Text Available 8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila me... 37 0.12 sp|Q16538...ery: 199 PLQLSASGSP 228 P+ SA +P Sbjct: 975 PVDSSAHSTP 984 >sp|Q8I7Z8|HAM_DROME Transcription factor hamlet

Older Adults and Food Safety

Science.gov (United States)

... cook meat and poultry to higher temperatures. Ham, cook before eating* 145 °F Ham, fully cooked, to reheat 140 °F Poultry, whole, parts or ground 165 °F Fish 145 °F Egg dishes, casseroles 160 °F Leftovers, to reheat 165 ° ...

Climatic factors and bipolar affective disorder

DEFF Research Database (Denmark)

Christensen, Ellen Margrethe; Larsen, Jens Knud; Gjerris, Annette

2008-01-01

significant correlation between mean HAM-D(17) scores and change in mean and maximum temperature, and non-statistical significant correlations between mean MAS scores and rainfall plus atmospheric pressure, and non-statistical significant correlations between mean HAM-D(17) scores and hours of sunshine...

Fifty years with the Hamilton scales for anxiety and depression. A tribute to Max Hamilton

DEFF Research Database (Denmark)

Bech, P; Bech, P

2009-01-01

as the method for the evaluation of the clinical effects of psychotropic drugs. Inspired by Eysenck, Hamilton took the long route around factor analysis in order to qualify his scales for anxiety (HAM-A) and depression (HAM-D) as scientific tools. From the moment when, 50 years ago, Hamilton published his first...... placebo-controlled trial with an experimental anti-anxiety drug, he realized the dialectic problem in using the total score on HAM-A as a sufficient statistic for the measurement of outcome. This dialectic problem has been investigated for more than 50 years with different types of factor analyses without...

Immunologic relationships of human serum albumin, macroaggregated albumin, and albumin microspheres

International Nuclear Information System (INIS)

Stang, P.C.; Roelands, J.F.; Cohen, P.

1975-01-01

Antigenic relationships of NSA (normal serum albumin), MAA (macroaggregated albumin), and HAM (human albumin microspheres) were determined in vivo in guinea pigs and in vitro in gel diffusion plates. Results showed that HAM could sensitize but seldom elicit anaphylaxis when used to challenge guinea pigs. In contrast, NSA and MAA were strong sensitizing antigens and inducers of anaphylaxis. The relative inability of HAM to induce anaphylaxis suggests that during production of the microspheres from soluble albumin, antigenic determinants of albumin may be altered or masked. Consequently, these determinants may be less available to react with antibody at the tissue sites

Prevalence of Listeria monocytogenes in pork-meat and other processed products from the Colombian swine industry

Directory of Open Access Journals (Sweden)

Andrea Gamboa Marín

2012-04-01

Full Text Available Objective. To determine the prevalence of L. monocytogenes in pork carcasses, meat cuts, and meat products (“chorizo”, sausage and ham. Materials and methods. Stratified sampling was implemented in meat-processed products. We analyzed 566 (37% carcasses, 472 (31% meat cuts, and 481, (32% meat-processed products, distributed as follows: 169 (11% sausage, 163 (11% ham, and 149 (10% “chorizo”, for a total of 1519 (100% samples in a period of 18 months. The samples were processed using the ISO-17604, ISO-11290-1 and the USDA/FSIS (MLG-8.03 methods. Genus and species were confirmed by multiplex-PCR. Results. We obtained isolates of L. monocytogenes from 21 carcasses (10%, 160 (76% from meat deboning, 10 (5% from ham, 6 (3% from “chorizo”, and 13 (6% from sausage. The prevalence found was 3.7% and 33.9% in carcasses and meat deboning respectively. The prevalence in the meat-processed products was 4.03% in “chorizo”, 6.13% in ham and 7.69% in sausage. The overall prevalence of L. monocytogenes in the study was 13.82%. Conclusions. We found L. monocytogenes in different products analyzed, with particular interest in ham and sausage since both are consumed without previous heat treatment.

Electron radiography

Science.gov (United States)

Merrill, Frank E.; Morris, Christopher

2005-05-17

A system capable of performing radiography using a beam of electrons. Diffuser means receive a beam of electrons and diffuse the electrons before they enter first matching quadrupoles where the diffused electrons are focused prior to the diffused electrons entering an object. First imaging quadrupoles receive the focused diffused electrons after the focused diffused electrons have been scattered by the object for focusing the scattered electrons. Collimator means receive the scattered electrons and remove scattered electrons that have scattered to large angles. Second imaging quadrupoles receive the collimated scattered electrons and refocus the collimated scattered electrons and map the focused collimated scattered electrons to transverse locations on an image plane representative of the electrons' positions in the object.

Cannabis and intractable chronic pain: an explorative retrospective analysis of Italian cohort of 614 patients

Directory of Open Access Journals (Sweden)

Fanelli G

2017-05-01

Full Text Available Guido Fanelli,1,2 Giuliano De Carolis,3 Claudio Leonardi,4 Adele Longobardi,5,6 Ennio Sarli,7,8 Massimo Allegri,1,2 Michael E Schatman9 1Anesthesia, Critical Care and Pain Medicine Unit, Division of Surgical Sciences, Department of Medicine and Surgery, University of Parma, 2Anesthesia, Intensive Care and Pain Therapy Service, Azienda Ospedaliero Universitaria Parma, Parma, 3Pain Therapy Service, Azienda Ospedaliero Universitaria Pisana, Pisa, 4Department of Drug Addiction Diseases, Local Public Health of Rome, Rome, 5Department of Neurosciences, Reproductive and Odontostomatological Sciences, University of Naples “Federico II”, Naples, 6Young Against the Pain (YAP Group, Parma, 7Progetti Live Surgery, 8PinHub Group, Florence, Italy; 9Department of Public Health and Community Medicine, Tufts University School of Medicine, Boston, MA, USA Background: Despite growing interest in the therapeutic use of cannabis to manage chronic pain, only limited data that address these issues are available. In recent years, a number of nations have introduced specific laws to allow patients to use cannabis preparations to treat a variety of medical conditions. In 2015, the Italian government authorized the use of cannabis to treat several diseases, including chronic pain generally, spasticity in multiple sclerosis, cachexia and anorexia among AIDS and cancer patients, glaucoma, Tourette syndrome, and certain types of epilepsy. We present the first snapshot of the Italian experience with cannabis use for chronic pain over the initial year of its use.Methods: This is a retrospective case series analysis of all chronic pain patients treated with oral or vaporized cannabis in six hubs during the initial year following the approval of the new Italian law (December 2015 to November 2016. We evaluated routes of administration, types of cannabis products utilized, dosing, and effectiveness and safety of the treatment.Results: As only one of the six centers has

Electron transfer from electronic excited states to sub-vacuum electron traps in amorphous ice

International Nuclear Information System (INIS)

Vichnevetski, E.; Bass, A.D.; Sanche, L.

2000-01-01

We investigate the electron stimulated yield of electronically excited argon atoms (Ar * ) from monolayer quantities of Ar deposited onto thin films of amorphous ice. Two peaks of narrow width ( - electron-exciton complex into exciton states, by the transfer of an electron into a sub-vacuum electron state within the ice film. However, the 10.7 eV feature is shifted to lower energy since electron attachment to Ar occurs within small pores of amorphous ice. In this case, the excess electron is transferred into an electron trap below the conduction band of the ice layer

Rapid Hamstrings/Quadriceps strength in ACL-reconstructed elite alpine ski racers

DEFF Research Database (Denmark)

Jordan, Matthew J; Aagaard, Per; Herzog, Walter

2015-01-01

PURPOSE: Due to the importance of hamstrings (HAM) and quadriceps (QUAD) strength for anterior cruciate ligament (ACL) injury prevention, and the high incidence of ACL injury in ski racing, HAM and QUAD maximal and explosive strength was assessed in ski racers with and without ACL reconstruction...... (ACL-R). METHODS: Uninjured (n=13 males; n=8 females) and ACL-R (n=3 males; n=5 females; 25.0±11.3 months post-op) elite ski racers performed maximal voluntary isometric HAM and QUAD contractions to obtain maximal torque (MVC) and rate of torque development (RTD) at 0-50, 0-100, 0-150 and 0-200 ms. MVC...... and RTD (per kg body mass) were calculated for the uninjured group to compare between sexes, and to compare the control group with the ACL-R limb and unaffected limb of the ACL-R skiers. H/Q MVC and RTD strength ratios were also compared RESULTS: The ACL-R limb demonstrated significant HAM and QUAD...

The validity of dysthymia to predict clinical depressive symptoms as measured by the Hamilton Depression Scale at the 5-year follow-up of patients with first episode depression

DEFF Research Database (Denmark)

Bech, Per; Kessing, Lars Vedel; Bukh, Jens Drachmann

2016-01-01

BACKGROUND: In long-term follow-up studies on depression, the Eysenck Neuroticism Scale (ENS) at the score level of dysthymia has been found to be valid at predicting poor outcome. AIMS: The ENS dysthymia level was compared with the Beck Depression Inventory (BDI) level to predict the prevalence...... of depressive symptoms at the 5-year follow-up of patients initially diagnosed with first episode depression using the Hamilton Depression Scale (HAM-D) to express depressive symptoms. METHODS: A total of 301 in- or outpatients aged 18-70 years with a recent single depressive episode were assessed by ENS, BDI......, and HAM-D from 2005-2007. At 5-year follow-up from 2011-2013, the participants were re-assessed by HAM-D. The HAM-D was used to measure depressive symptoms at the 5-year follow-up. The Mokken analysis was used to indicate scalability of the BDI and ENS. RESULTS: A total of 185 participants were available...

On numerical solution of Burgers' equation by homotopy analysis method

International Nuclear Information System (INIS)

Inc, Mustafa

2008-01-01

In this Letter, we present the Homotopy Analysis Method (shortly HAM) for obtaining the numerical solution of the one-dimensional nonlinear Burgers' equation. The initial approximation can be freely chosen with possible unknown constants which can be determined by imposing the boundary and initial conditions. Convergence of the solution and effects for the method is discussed. The comparison of the HAM results with the Homotopy Perturbation Method (HPM) and the results of [E.N. Aksan, Appl. Math. Comput. 174 (2006) 884; S. Kutluay, A. Esen, Int. J. Comput. Math. 81 (2004) 1433; S. Abbasbandy, M.T. Darvishi, Appl. Math. Comput. 163 (2005) 1265] are made. The results reveal that HAM is very simple and effective. The HAM contains the auxiliary parameter h, which provides us with a simple way to adjust and control the convergence region of solution series. The numerical solutions are compared with the known analytical and some numerical solutions

Construction of self-dual codes in the Rosenbloom-Tsfasman metric

Science.gov (United States)

Krisnawati, Vira Hari; Nisa, Anzi Lina Ukhtin

2017-12-01

Linear code is a very basic code and very useful in coding theory. Generally, linear code is a code over finite field in Hamming metric. Among the most interesting families of codes, the family of self-dual code is a very important one, because it is the best known error-correcting code. The concept of Hamming metric is develop into Rosenbloom-Tsfasman metric (RT-metric). The inner product in RT-metric is different from Euclid inner product that is used to define duality in Hamming metric. Most of the codes which are self-dual in Hamming metric are not so in RT-metric. And, generator matrix is very important to construct a code because it contains basis of the code. Therefore in this paper, we give some theorems and methods to construct self-dual codes in RT-metric by considering properties of the inner product and generator matrix. Also, we illustrate some examples for every kind of the construction.

A gallery approach for off-angle iris recognition

Science.gov (United States)

Karakaya, Mahmut; Yoldash, Rashiduddin; Boehnen, Christopher

2015-05-01

It has been proven that hamming distance score between frontal and off-angle iris images of same eye differs in iris recognition system. The distinction of hamming distance score is caused by many factors such as image acquisition angle, occlusion, pupil dilation, and limbus effect. In this paper, we first study the effect of the angle variations between iris plane and the image acquisition systems. We present how hamming distance changes for different off-angle iris images even if they are coming from the same iris. We observe that increment in acquisition angle of compared iris images causes the increment in hamming distance. Second, we propose a new technique in off-angle iris recognition system that includes creating a gallery of different off-angle iris images (such as, 0, 10, 20, 30, 40, and 50 degrees) and comparing each probe image with these gallery images. We will show the accuracy of the gallery approach for off-angle iris recognition.

Increased expression of OX40 is associated with progressive disease in patients with HTLV-1-associated myelopathy/tropical spastic paraparesis.

Science.gov (United States)

Saito, Mineki; Tanaka, Reiko; Arishima, Shiho; Matsuzaki, Toshio; Ishihara, Satoshi; Tokashiki, Takashi; Ohya, Yusuke; Takashima, Hiroshi; Umehara, Fujio; Izumo, Shuji; Tanaka, Yuetsu

2013-05-07

OX40 is a member of the tumor necrosis factor receptor family that is expressed primarily on activated CD4+ T cells and promotes the development of effector and memory T cells. Although OX40 has been reported to be a target gene of human T-cell leukemia virus type-1 (HTLV-1) viral transactivator Tax and is overexpressed in vivo in adult T-cell leukemia (ATL) cells, an association between OX40 and HTLV-1-associated inflammatory disorders, such as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP), has not yet been established. Moreover, because abrogation of OX40 signals ameliorates chronic inflammation in animal models of autoimmune disease, novel monoclonal antibodies against OX40 may offer a potential treatment for HTLV-1-associated diseases such as ATL and HAM/TSP. In this study, we showed that OX40 was specifically expressed in CD4+ T cells naturally infected with HTLV-1 that have the potential to produce pro-inflammatory cytokines along with Tax expression. We also showed that OX40 was overexpressed in spinal cord infiltrating mononuclear cells in a clinically progressive HAM/TSP patient with a short duration of illness. The levels of the soluble form of OX40 (sOX40) in the cerebrospinal fluid (CSF) from chronic progressive HAM/TSP patients or from patients with other inflammatory neurological diseases (OINDs) were not different. In contrast, sOX40 levels in the CSF of rapidly progressing HAM/TSP patients were higher than those in the CSF from patients with OINDs, and these patients showed higher sOX40 levels in the CSF than in the plasma. When our newly produced monoclonal antibody against OX40 was added to peripheral blood mononuclear cells in culture, HTLV-1-infected T cells were specifically removed by a mechanism that depends on antibody-dependent cellular cytotoxicity. Our study identified OX40 as a key molecule and biomarker for rapid progression of HAM/TSP. Furthermore, blocking OX40 may have potential in therapeutic intervention for

A comparative study of human T-cell lymphotropic virus-associated myelopathy in HIV-positive and HIV-negative patients in KwaZulu-Natal

Directory of Open Access Journals (Sweden)

Hoosain F. Paruk

2017-12-01

Full Text Available Background: KwaZulu-Natal is an endemic area for HIV and human T-cell lymphotropic virus (HTLV infection. The main neurological manifestation of HTLV is HTLV-associated myelopathy/tropical spastic paraparesis (HAM/TSP. The effect of HIV co-infection in patients with HAM/TSP is not well documented. Aims: To determine the prevalence of HIV seropositivity in patients with HAM/TSP and compare the clinical, laboratory and radiological features of patients mono-infected with HTLV and those dually infected with HTLV and HIV. Methods: Adult patients referred to the Neurology Department at Inkosi Albert Luthuli Central Hospital in KwaZulu-Natal, South Africa, for the period 01 January 2004 to 31 December 2015 with a positive HTLV serology were identified from the National Health Laboratory Service database. A retrospective chart review was conducted to identify all patients who had a diagnosis of HAM/TSP and to record their HIV status. Clinical, laboratory and radiological data were compared for HIV-positive and HIV-negative patients. Results: A total of 52 patients with HAM/TSP were identified. HIV results were available in 44 patients of whom 23 (52% patients were HIV co-infected. Patients who were HIV-positive had a younger age of presentation compared to HIV-negative patients (median: 31 vs 50 years, p = 0.002. HIV-positive patients had a median duration of symptoms at presentation of 12 months compared to 16 months for HIV-negative patients, but the difference did not reach statistical significance (p = 0.082. The CD4 cell counts of HIV-positive patients were well preserved with a median count of 781 cells/µL. Conclusions: HIV co-infection is commonly seen in the setting of HAM/TSP in KwaZulu-Natal. An interaction between the viruses may accelerate the development of HAM/TSP, leading to a younger age of presentation. Co-infection may have treatment implications because of CD4 counts being preserved in these patients.

Monte Carlo study of electron relaxation in graphene with spin polarized, degenerate electron gas in presence of electron-electron scattering

Science.gov (United States)

Borowik, Piotr; Thobel, Jean-Luc; Adamowicz, Leszek

2017-12-01

The Monte Carlo simulation method is applied to study the relaxation of excited electrons in monolayer graphene. The presence of spin polarized background electrons population, with density corresponding to highly degenerate conditions is assumed. Formulas of electron-electron scattering rates, which properly account for electrons presence in two energetically degenerate, inequivalent valleys in this material are presented. The electron relaxation process can be divided into two phases: thermalization and cooling, which can be clearly distinguished when examining the standard deviation of electron energy distribution. The influence of the exchange effect in interactions between electrons with parallel spins is shown to be important only in transient conditions, especially during the thermalization phase.

Integrated Heat, Air and Moisture Modeling and Simulation in Hamlab, Reference: A41-T3-NL-05-2

NARCIS (Netherlands)

Schijndel, van A.W.M.

2005-01-01

This paper gives an overview of recent developments and results of a new integrated heat, air and moisture (HAM) modeling toolkit in Matlab named HAMLab. The recent developments include integration of a whole building model with building systems and controllers, 2D/3D HAM transport in constructions

Control of cellulose biosynthesis by overexpression of a transcription factor

Energy Technology Data Exchange (ETDEWEB)

Han, Kyung-Hwan; Ko, Jae-Heung; Kim, Won-Chan; Kim; , Joo-Yeol

2017-05-16

The invention relates to the over-expression of a transcription factor selected from the group consisting of MYB46, HAM1, HAM2, MYB112, WRKY11, ERF6, and any combination thereof in a plant, which can modulate and thereby modulating the cellulose content of the plant.

Analytical Evalution of Heat Transfer Conductivity with Variable Properties

DEFF Research Database (Denmark)

Rahimi, Masoume; Hosseini, Mohammad Javad; Barari, Amin

2011-01-01

The homotopy analysis method (HAM) as a new technique which is powerful and easy-to-use, is applied to solve heat transfer problems. In this paper, we use HAM for heat transfer conductivity equation with variable properties which may contain highly nonlinear terms. The obtained results are also...

Short communication an interferon-γ ELISPOT assay with two cytotoxic T cell epitopes derived from HTLV-1 tax region 161-233 discriminates HTLV-1-associated myelopathy/tropical spastic paraparesis patients from asymptomatic HTLV-1 carriers in a Peruvian population.

Science.gov (United States)

Best, Ivan; López, Giovanni; Talledo, Michael; MacNamara, Aidan; Verdonck, Kristien; González, Elsa; Tipismana, Martín; Asquith, Becca; Gotuzzo, Eduardo; Vanham, Guido; Clark, Daniel

2011-11-01

HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP) is a chronic and progressive disorder caused by the human T-lymphotropic virus type 1 (HTLV-1). In HTLV-1 infection, a strong cytotoxic T cell (CTL) response is mounted against the immunodominant protein Tax. Previous studies carried out by our group reported that increased IFN-γ enzyme-linked immunospot (ELISPOT) responses against the region spanning amino acids 161 to 233 of the Tax protein were associated with HAM/TSP and increased HTLV-1 proviral load (PVL). An exploratory study was conducted on 16 subjects with HAM/TSP, 13 asymptomatic carriers (AC), and 10 HTLV-1-seronegative controls (SC) to map the HAM/TSP-associated CTL epitopes within Tax region 161-233. The PVL of the infected subjects was determined and the specific CTL response was evaluated with a 6-h incubation IFN-γ ELISPOT assay using peripheral blood mononuclear cells (PBMCs) stimulated with 16 individual overlapping peptides covering the Tax region 161-233. Other proinflammatory and Th1/Th2 cytokines were also quantified in the supernatants by a flow cytometry multiplex assay. In addition, a set of human leukocyte antigen (HLA) class I alleles that bind with high affinity to the CTL epitopes of interest was determined using computational tools. Univariate analyses identified an association between ELISPOT responses to two new CTL epitopes, Tax 173-185 and Tax 181-193, and the presence of HAM/TSP as well as an increased PVL. The HLA-A*6801 allele, which is predicted to bind to the Tax 181-193 peptide, was overpresented in the HAM/TSP patients tested.

A comparison of low-dose risperidone to paroxetine in the treatment of panic attacks: a randomized, single-blind study

Directory of Open Access Journals (Sweden)

Galynker Igor I

2009-05-01

Full Text Available Abstract Background Because a large proportion of patients with panic attacks receiving approved pharmacotherapy do not respond or respond poorly to medication, it is important to identify additional therapeutic strategies for the management of panic symptoms. This article describes a randomized, rater-blind study comparing low-dose risperidone to standard-of-care paroxetine for the treatment of panic attacks. Methods Fifty six subjects with a history of panic attacks were randomized to receive either risperidone or paroxetine. The subjects were then followed for eight weeks. Outcome measures included the Panic Disorder Severity Scale (PDSS, the Hamilton Anxiety Scale (Ham-A, the Hamilton Depression Rating Scale (Ham-D, the Sheehan Panic Anxiety Scale-Patient (SPAS-P, and the Clinical Global Impression scale (CGI. Results All subjects demonstrated a reduction in both the frequency and severity of panic attacks regardless of treatment received. Statistically significant improvements in rating scale scores for both groups were identified for the PDSS, the Ham-A, the Ham-D, and the CGI. There was no difference between treatment groups in the improvement in scores on the measures PDSS, Ham-A, Ham-D, and CGI. Post hoc tests suggest that subjects receiving risperidone may have a quicker clinical response than subjects receiving paroxetine. Conclusion We can identify no difference in the efficacy of paroxetine and low-dose risperidone in the treatment of panic attacks. Low-dose risperidone appears to be tolerated equally well as paroxetine. Low-dose risperidone may be an effective treatment for anxiety disorders in which panic attacks are a significant component. Trial Registration ClinicalTrials.gov Identifier: NCT100457106

[Autoimmune syndrome in the tropical spastic paraparesis/myelopathy associated with human T-lymphotropic virus infections].

Science.gov (United States)

Domínguez, Martha C; Torres, Miyerlandi; Tamayo, Oscar; Criollo, William; Quintana, Milton; Sánchez, Adalberto; García, Felipe

2008-12-01

Previous reports have given evidence that in tropical spastic paraparesis (TSP)/human T-lymphotrophic virus (HTLV-I)-associated myelopathy (HAM), an autoimmune process occurs as part of its pathogenesis. The roles of autoimmunity and the molecular mimicry was evaluated in TSP/HAM patients. Plasma samples were characterized from patients in the Pacific coastal region of Colombia. Thirty-seven were identified as TSP/HAM, 10 were diagnosed with adult T-cell leukemia virus, 22 were asymptomatic carriers but seropositive for HTLV-I and 20 were seronegative and served as negative controls. Plasmatic levels of the following were determined: antinuclear antibody (ANA) levels, anticardiolipine-2 (ACL-2), interferon- (IFN-gamma) and interleukin-4 (IL-4). Using Western blot, the crossreactivity of the seropositive and seronegative samples was evaluated against proteins extracted from several central nervous system components of non infected Wistar rats. The HTLV-I seropositive plasmas were crossreacted with a monoclonal tax (LT4 anti-taxp40) from spinal cord neurons of non infected Wistar rats. Of the TSP/HAM patients, 70.2% were reactive against ANA and 83.8% against ACL-2, in contrast with those ATL and asymptomatic seropositives subjects that were not reactive (P<0.001). Moreover, 70.3% had detectable levels of IFN and 43.2% had detectable IL-4. LT4 anti-taxp40 and plasma of TSP/HAM exhibited cross reactivity with a MW 33-35 kDa protein from the rat spinal cord nuclei. Support was provided for the existence of an autoimmune syndrome mediated by molecular mimicry; the syndrome was responsible for some of the axonal degeneration observed in TSP/HAM patients.

The Efficacy of Neurofeedback in Patients with Major Depressive Disorder: An Open Labeled Prospective Study.

Science.gov (United States)

Cheon, Eun-Jin; Koo, Bon-Hoon; Choi, Joong-Hyun

2016-03-01

The purpose of this study was to evaluate the effect of neurofeedback on depressive symptoms and electrophysiological disturbances in patients with major depressive disorder. We recruited participants suffering from depression to evaluate efficacy of left prefrontal beta with alpha/theta training. An 8-week, prospective, open-label study was undertaken. Twenty participants were recruited. The treatment protocol was twice or three times a week training of beta at F3 with alpha/theta at Pz for 8 weeks. When every visit, patients were received beta training for 30 min, and then alpha/theta training for 30 min. Baseline, 4 and 8 week scores of; the Hamilton rating scale for Depression (HAM-D), the Hamilton rating scale for Anxiety (HAM-A), the Beck Depression Inventory (BDI)-II, the Beck Anxiety Inventory (BAI), Clinical global impression-severity (CGI-S), and pre- and post-treatment resting state EEGs were compared. Interhemispheric alpha power asymmetry (A score) was computed for homologous sites F3-F4. Pre- and post-training clinical assessments revealed significant improvements in HAM-D, HAM-A, BDI, and CGI-S scores. Cumulative response rates by HAM-D were 35.0 and 75.0 % at 4 and 8 weeks, respectively, corresponding cumulative remission rates by HAM-D were 15.0 and 55.0 %, respectively. No significant differences were found between pre- and post-treatment A score. Neurofeedback treatment could improve depressive symptoms significantly. In addition, anxiety symptoms and clinical illness severity decreased significantly after neurofeedback treatment. Despite its several limitations, such as, small sample size and lack of a control group, this study suggested neurofeedback has significant effects in patients with major depressive disorder.

Homotopy Analysis Method for Nonlinear Dynamical System of an Electrostatically Actuated Microcantilever

Directory of Open Access Journals (Sweden)

Y. M. Chen

2011-01-01

Full Text Available The homotopy analysis method (HAM is employed to propose an approach for solving the nonlinear dynamical system of an electrostatically actuated micro-cantilever in MEMS. There are two relative merits of the presented HAM compared with some usual procedures of the HAM. First, a new auxiliary linear operator is constructed. This operator makes it unnecessary to eliminate any secular terms. Furthermore, all the deformation equations are purely linear. Numerical examples show the excellent agreement of the attained solutions with numerical ones. The respective effects of applied voltage, cubic nonlinear stiffness, gap distance, and squeeze film damping on vibration responses are analyzed detailedly.

Cytokines and depression in cancer patients and caregivers

Directory of Open Access Journals (Sweden)

Li M

2017-11-01

Full Text Available Madeline Li,1,2 Ekaterina Kouzmina,3 Megan McCusker,1 Danielle Rodin,4 Paul C Boutros,3,5,6 Christopher J Paige,6–8 Gary Rodin1,2 1Princess Margaret Cancer Centre, Department of Supportive Care, University Health Network, Toronto, Ontario, Canada; 2Department of Psychiatry, University of Toronto, Toronto, Ontario, Canada; 3Informatics & Biocomputing Program, Ontario Institute for Cancer Research, Toronto, Ontario, Canada; 4Department of Radiation Oncology, University of Toronto, Toronto, Ontario, Canada; 5Department of Pharmacology & Toxicology, Toronto, Ontario, Canada; 6Department of Medical Biophysics, University of Toronto, Toronto, Ontario, Canada; 7Department of Immunology, University of Toronto, Toronto, Ontario, Canada; 8Princess Margaret Cancer Centre, University Health Network, Toronto, Ontario, Canada Objective: A better understanding of the biobehavioral mechanisms underlying depression in cancer is required to translate biomarker findings into clinical interventions. We tested for associations between cytokines and the somatic and psychological symptoms of depression in cancer patients and their healthy caregivers.Patients and methods: The GRID Hamilton Rating Scale for Depression (Ham-D was administered to 61 cancer patients of mixed type and stage, 26 primary caregivers and 38 healthy controls. Concurrently, blood was drawn for multiplexed plasma assays of 15 cytokines. Multiple linear regression, adjusted for biobehavioral variables, identified cytokine associations with the psychological (Ham-Dep and somatic (Ham-Som subfactors of the Ham-D.Results: The Ham-Dep scores of cancer patients were similar to their caregivers, but their Ham-Som scores were significantly higher (twofold, p=0.016. Ham-Som was positively associated with IL-1ra (coefficient: 1.27, p≤0.001 in cancer patients, and negatively associated with IL-2 (coefficient: -0.68, p=0.018 in caregivers. Ham-Dep was negatively associated with IL-4 (coefficient: -0.67, p

Imaging Brunelleschi's cupola wall using muon scattering radiography

Energy Technology Data Exchange (ETDEWEB)

Guardincerri, Elena [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2015-09-16

This PowerPoint presentation describes the cupola's structure and current reinforcements, reasoning behind why muon radiography would be helpful. A demonstration project is described where a similar wall was constructed to illustrate the potential benefits to Italian authorities; Requirements and a potential plan were created and collaboration to make it happen was deemed to be possible among LANL, Toshiba, the Parma and Florence Universities and the Opera del Duomo,

Sul on miljoni dollari idee? Nemad aitavad sul selle rahaks teha / Tanel Veenre

Index Scriptorium Estoniae

Veenre, Tanel, 1977-

2010-01-01

Eesti kultuurivahendajatest, nende nappusest. Kultuurikorraldusest, loomest ja ettevõtlusest, kultuuriturundusest, loomemajandusest, mänedžeri ja looja koostööst, kultuuri ekspordist. Kultuurikorraldajate koolitusest Tartu Ülikoolis ning Eesti Muusika- ja Teatriakadeemias. Arvamust avaldavad galerist Olga Temnikova, Eesti Disainerite Liidu esimees Ilona Gurjanova, kontserdikorraldaja Helen Sildna, Ville Jehe disainibüroost Keha3, Von Krahli Teatri projektijuht Elo-Liis Parmas, moekorraldaja Merilyn Kesküla jt.

AcEST: DK961346 [AcEST

Lifescience Database Archive (English)

Full Text Available 0.21 sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila me... 36 0.21 sp|P03189|V120_EBV Capsid ...QLTPTGSPRRSAAGS 572 + + T + SAA S Sbjct: 184 AKSSSAAPSSTEAKITSAAPS 204 >sp|Q8I7Z8|HAM_DROME Transcription factor hamlet

Electron attachment cross sections obtained from electron attachment spectroscopy

International Nuclear Information System (INIS)

Popp, P.; Baumbach, J.I.; Leonhardt, J.W.; Mothes, S.

1988-01-01

Electron capture detectors have a high sensitivity for substances with high thermal electron attachment cross sections. The electron attachment spectroscopy makes it possible to change the mean electron energy in such a way that the maximum for dissociative electron attachment is reached. Thus, best operation modes of the detection system as well as significant dependencies of electron attachment coefficients are available. Cross sections for electron attachment as a function of the electron energy are obtained with the knowledge of electron energy distribution functions from Boltzmann equation analysis by a special computer code. A disadvantage of this electron attachment spectroscopy is the superposition of space charge effects due to the decrease of the electron drift velocity with increasing mean electron energy. These influences are discussed. (author)