Acquisition of the ability for Rhodopseudomonas palustris to degrade chlorinated benzoic acids as the sole carbon source

NARCIS (Netherlands)

Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC

2001-01-01

Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in

Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae

Directory of Open Access Journals (Sweden)

Martin, Dieter

2013-11-01

Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.

The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris

Energy Technology Data Exchange (ETDEWEB)

Kamal, V S

1992-10-09

The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.

Metabolic rates and thermoregulatory characteristics of Akodon azarae (Rodentia: Sigmodontinae Tasas metabólicas y características termorregulatorias de Akodon azarae (Rodentia: Sigmodontinae

Directory of Open Access Journals (Sweden)

C. DANIEL ANTINUCHI

2000-03-01

Full Text Available In this work, we evaluated the energetic status, activity daily metabolic rate, thermoregulatory capacity and the existence of torpor in Akodon azarae (Fisher 1829. Basal metabolic rate (BMR was similar to the expected value from Kleiber´s, and also according to the BMR of phylogenetically related species. No statistical difference in BMR between sexes was detected. For both males and females, activity daily metabolic rate was 235 % of BMR. Body temperature was not statistically different, neither at different ambient temperatures nor between sexes. In the thermoneutral zone, body temperature was 36.1 ± 1.5 °C. Thermal conductance was lower than the expected for mammals whereas thermoregulatory capacity was 136 % of the expected. Akodon azarae did not show evidence of torporEn este trabajo fueron evaluadas, para Akodon azarae (Fisher 1829, la tasa metabólica basal (BMR y de actividad diaria así como la capacidad termorregulatoria y la posible existencia de torpor. La BMR no presentó diferencias estadísticas con la esperada por la ecuación de Kleiber así como con la esperada para especies filogenéticamente relacionadas. Tampoco fueron detectadas diferencias significativas en la BMR entre sexos. La tasa metabólica de actividad diaria para ambos sexos fue el 235 % de la BMR. La temperatura corporal no presentó variaciones entre individuos mantenidos a diferentes temperaturas ambiente ni tampoco entre sexos y en termoneutralidad fue de 36,1 ± 1,5 °C. Por otra parte, la conductancia térmica fue menor a la esperada mientras que la capacidad termorregulatoria fue el 136% de la esperada. Akodon azarae no presenta sopor

Robertsonian chromosome polymorphism of Akodon molinae (Rodentia: Sigmodontinae: analysis of trivalents in meiotic prophase Polimorfismo cromosómico Robertsoniano de Akodon molinae (Rodentia: Sigmodontinae

Directory of Open Access Journals (Sweden)

RAÚL FERNÁNDEZ-DONOSO

2001-03-01

Full Text Available Akodon molinae (with 2n = 42-43-44 and an FN = 44 shows a remarkable polymorphism of chromosome 1 in natural and laboratory populations. Specimens 2n = 42, named single homozygotes (SH, have a chromosome pair 1 formed by two large metacentric chromosomes. Specimens 2n = 3, heterozygotes (Ht, have one chromosome 1 and two medium-sized subtelocentric chromosomes, 1a and 1b, which are homologous with the long and short arms of chromosome 1 respectively. Specimens 2n = 44 are double homozygotes (DH, with just two pairs of medium-sized subtelocentric chromosomes, 1a and 1b. Analysis of meiotic metaphases I and II showed that anomalous segregation occurs more frequently in spermatocytes carrying the 1a and 1b chromosomes. This would disturb gametogenesis and other reproductive and developmental processes, producing a marked decrease in viability of DH individuals. There is, as yet, no satisfactory explanation for these phenomena. To investigate structural elements which might explain such segregational anomalies, we have studied bivalent and trivalent synapsis in pachytene spermatocytes from SH, Ht and DH specimens. Of a total of 80 spermatocyte nuclei microspreads, the following results were obtained: of 16 microspreads from two SH individuals, 20 autosomic bivalents plus the XY bivalent were observed; of 48 microspreads from three Ht individuals, 19 autosomic bivalents, 1 trivalent and an XY bivalent were seen; and of the 16 microspreads from two DH individuals, 21 autosomic bivalents plus the XY bivalent were found. Trivalents analysed showed complete pairing between the short arms of 1a and 1b, and having an apparently normal synaptonemal complex (SC with lengths of 1 and 2.8 µm. The trivalent SC showed three telomeric ends, corresponding to arms: q1 and q1a; p1 and q1b; and p1a and p1b, with attachment plates to the nuclear envelope of normal organisation. None of the trivalents showed asynapsis or desynapsis between p1a and p1b, nor an association with the XY bivalent. In 70 % of spermatocytes studied, the XY bivalent showed complete pairing between X and Y, with SC formation along the whole length of the Y chromosome. The remaining 30 % showed partial pairing, with an SC length which varied from the common end. Based on these findings and those of previous studies, we discuss: 1.- that the obliged configuration of the trivalent, with SC formation between the short arms of 1a and 1b, helps to assure a quasi normal segregation between 1, 1a and 1b in anaphase I of Ht meiosis; and 2.- that co-existence in trivalents of chromosomes 1, 1a and 1b in Ht individuals, breaks down the structural and functional integrity of the short arms of 1a and 1b, producing an accumulative damage which would also explain the decreased viability of individuals bearing these chromosomesAkodon molinae con 2n = 42-43-44 y FN = 44 presenta un notable polimorfismo en el cromosoma 1 en poblaciones naturales y de laboratorio, los individuos 2n = 42 tienen un par 1 formado por dos cromosomas metacéntricos grandes y son denominados homocigotos simples (SH; los individuos 2n = 43, heterocigotos (Ht, presentan un cromosoma 1 y dos cromosomas subtelocéntricos de tamaño medio 1a and 1b, que son homólogos con los brazos largo y corto del 1, respectivamente; y los individuos 2n = 44 que son los doble homocigotos (DH y presentan dos pares de cromosomas subtelocéntricos 1a y 1b. Análisis de la metafases I y II meióticas han demostrado que se producen segregaciones anómalas con una alta frecuencia en los espermatocitos portadores de los cromosomas 1a and 1b. Ello alteraría a otros procesos, como la gametogénesis, la reproducción y el desarrollo, disminuyendo la viabilidad individual y poblacional de los DH. No ha habido una explicación satisfactoria para estos fenómenos. Para investigar elementos estructurales que pudiesen explicar tales alteraciones segregacionales, se estudió la sinapsis de bivalentes y trivalentes en espermatocitos en paquiteno de ejemplares SH, Ht y DH. De un total de 80 microesparcidos de núcleos de espermatocitos: en 16 núcleos de ejemplares SH se observaron 20 bivalentes autosómicos más el bivalente XY; en 48 núcleos de Ht se observaron 19 bivalentes autosómicos, 1 trivalente y un bivalente XY; y en 16 núcleos de DH se observaron 21 bivalentes autosómicos más el bivalente XY. Los trivalentes analizados mostraron apareamiento completo entre los brazos cortos de 1a y 1b conformándose un complejo sinaptonémico (CS aparentemente normal con una longitud entre 1 µm y 2,8 µm. El CS de los trivalentes presentó tres extremos teloméricos correspondientes a los brazos: q1 y q1a, p1 y q1b y p1a y p1b, con placas de inserción a la envoltura nuclear de organización normal. En ninguno de los trivalentes se observó asinapsis o desinapsis entre p1a y p1b, ni asociaciones con el bivalente XY. En el 70 % de los espermatocitos estudiados el bivalente XY mostró apareamiento completo entre X e Y, con formación de CS en toda la longitud del cromosoma Y. El 30 % restante presentó apareamiento parcial con un CS de longitud variable a partir del extremo común. Sobre la base de los resultados de este trabajo y los antecedentes existentes, se discute: 1.- que la configuración obligada del trivalente con formación de CS entre los brazos cortos de 1a y 1b, contribuye a asegurar la segregación cuasi normal entre 1, 1a y 1b en la I anafase de la meiosis de los Ht; y 2.- que la coexistencia en los trivalentes de los cromosomas 1, 1a y 1b en los Ht, erosiona la integridad estructural y funcional de los brazos cortos de 1a y 1b, daño que sería acumulativo y que explicaría la viabilidad disminuída de los individuos portadores de estos cromosomas

Patrones de distribución geográfica de la riqueza de especies de roedores de la tribu Oryzomyini (Rodentia: Sigmodontinae en Sudamérica: Evaluando la importancia de los procesos de colonización y extinción Geographic patterns of richness distribution of rodents species from the Oryzomyini tribe (Rodentia: Sigmodontinae in South America: Evaluating the importance of colonization and extinction processes

Directory of Open Access Journals (Sweden)

EVELYN VALENCIA-PACHECO

2011-09-01

Full Text Available La tribu de roedores Oryzomyini es la más diversa dentro de la subfamilia Sigmodontinae. Está constituida por 120 especies y 31 géneros, de las cuales 83 son endémicas del continente sudamericano. Este grupo exhibe una extensa distribución que abarca toda la región Neotropical, caracterizada por la presencia de una mayor riqueza en la Amazonia con una disminución monotónica hacia el sur y norte de Sudamérica. Este es un patrón bastante conocido en la mayoría de los taxones, por lo que se han propuesto varios mecanismos causales. Sin embargo, se desconocen los mecanismos que dan cuenta de este gradiente latitudinal en la riqueza de especies de Oryzomyini. Debido a que estas especies son originarias de la Amazonia, y que a través de su historia colonizaron ambientes nuevos y más variables (sur y norte, se evaluó la hipótesis fuente-sumidero, mediada por procesos de colonización y extinción, como potencial explicación al patrón de riqueza observado. Para evaluar esta hipótesis se reunió una base de datos de distribución y riqueza de especies por grado de latitud para todo el continente sudamericano. Posteriormente se evaluó el grado de anidamiento mediante los índices de T (temperatura, BR (discrepancia y NODF. Nuestros resultados evidenciaron un grado de anidamiento significativo en la distribución de Oryzomyini, y un anidamiento significativo separadamente en filas y columnas de la matriz. Por lo tanto, se concluye que la dinámica fuente-sumidero afecta el patrón de distribución de la riqueza de roedores Oryzominos, a través de un proceso de colonización durante su expansión en Sudamérica que fue mediado por los rangos de tolerancia de las especies. Finalmente, las especies menos tolerantes se habrían extinguido, lo que determinaría un menor número de especies hacia el sur y norte de la Amazonia.The Oryzomyini rodent tribe is the most diverse taxon within the Sigmodontinae subfamily. This tribe includes 120

Revealing the functions of the transketolase enzyme isoforms in Rhodopseudomonas palustris using a systems biology approach.

Directory of Open Access Journals (Sweden)

Chia-Wei Hu

Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth

Karyotype restructuring in Rodentia: from evolution to cancer

OpenAIRE

Pereira, Sandra Louzada Gomes

2015-01-01

Tese de Doutoramento em Genética Molecular Comparativa e Tecnológica A ordem Rodentia representa a mais abundante e diversificada ordem de mamíferos. A análise dos cariótipos/genomas de roedores da superfamília Muroidea tem revelado a ocorrência de elevadas taxas de evolução para estas espécies, o que as torna bons modelos para o estudo da evolução de cromossomas, dos rearranjos cromossómicos e das consequências dos mesmos durante o processo tumoral. O principal objectivo desta...

Effects of metal ions on biomass and 5-aminolevulinic acid production in Rhodopseudomonas palustris wastewater treatment.

Science.gov (United States)

Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie

2016-01-01

This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.

?-Oryzanols of North American Wild Rice (Zizania palustris)

OpenAIRE

Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota

2013-01-01

?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...

Mortalidade em florestas de Pinus palustris causada por tempestade de raios

Science.gov (United States)

Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho

2002-01-01

The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...

Phytodesalinization potential of Typha angustifolia, Juncus maritimus, and Eleocharis palustris for removal of de-icing salts from runoff water.

Science.gov (United States)

Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa

2016-10-01

Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.

Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems

Science.gov (United States)

J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell

2007-01-01

Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1–10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...

Aptitude of Lymnaea palustris and L. stagnalis to Fasciola hepatica larval development through the infection of several successive generations of 4-mm-high snails.

Science.gov (United States)

Vignoles, P; Rondelaud, D; Dreyfuss, G

2016-06-01

Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.

Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11

Science.gov (United States)

Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer

1994-01-01

Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307

Molecular diversification of Trichuris spp. from Sigmodontinae (Cricetidae) rodents from Argentina based on mitochondrial DNA sequences.

Science.gov (United States)

Callejón, Rocío; Robles, María Del Rosario; Panei, Carlos Javier; Cutillas, Cristina

2016-08-01

A molecular phylogenetic hypothesis is presented for the genus Trichuris based on sequence data from mitochondrial cytochrome c oxidase 1 (cox1) and cytochrome b (cob). The taxa consisted of nine populations of whipworm from five species of Sigmodontinae rodents from Argentina. Bayesian Inference, Maximum Parsimony, and Maximum Likelihood methods were used to infer phylogenies for each gene separately but also for the combined mitochondrial data and the combined mitochondrial and nuclear dataset. Phylogenetic results based on cox1 and cob mitochondrial DNA (mtDNA) revealed three clades strongly resolved corresponding to three different species (Trichuris navonae, Trichuris bainae, and Trichuris pardinasi) showing phylogeographic variation, but relationships among Trichuris species were poorly resolved. Phylogenetic reconstruction based on concatenated sequences had greater phylogenetic resolution for delimiting species and populations intra-specific of Trichuris than those based on partitioned genes. Thus, populations of T. bainae and T. pardinasi could be affected by geographical factors and co-divergence parasite-host.

Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China.

Science.gov (United States)

Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan

2018-04-26

Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

Arsenic-Redox Transformation and Plant Growth Promotion by Purple Nonsulfur Bacteria Rhodopseudomonas palustris CS2 and Rhodopseudomonas faecalis SS5.

Science.gov (United States)

Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir

2017-01-01

Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8  μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.

The potential of Thelypteris palustris and Asparagus sprengeri in phytoremediation of arsenic contamination.

Science.gov (United States)

Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory

2011-02-01

The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.

A two-step fermentation of distillers' grains using Trichoderma viride and Rhodopseudomonas palustris for fish feed.

Science.gov (United States)

Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin

2013-10-01

It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.

Phenomenon in the Evolution of Voles (Mammalia, Rodentia, Arvicolidae

Directory of Open Access Journals (Sweden)

Rekovets L. I.

2017-04-01

Full Text Available This paper presents analytical results of the study of adaptatiogenesis within the family Arvicolidae (Mammalia, Rodentia based of morphological changes of the most functional characters of their masticatory apparatus — dental system — through time. The main directions of the morphological differentiation in parallel evolution of the arvicolid tooth type within the Cricetidae and Arvicolidae during late Miocene and Pliocene were identified and substantiated. It is shown that such unique morphological structure as the arvicolid tooth type has provided a relatively high rate of evolution of voles and a wide range of their adaptive radiation, as well as has determined their taxonomic and ecological diversity. The optimality of the current state of this group and evaluation of evolutionary prospects of Arvicolidae were presented and substantiated here as a phenomenon in their evolution.

Phenotype fingerprinting suggests the involvement of single-genotype consortia in degradation of aromatic compounds by Rhodopseudomonas palustris.

Directory of Open Access Journals (Sweden)

Tatiana V Karpinets

Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the

Population Genetic Structure of Cochliobolus miyabeanus on Cultivated Wild Rice (Zizania palustris L.) in Minnesota

Science.gov (United States)

Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...

Muscle Senescence in Short-Lived Wild Mammals, the Soricine Shrews Blarina brevicauda and Sorex palustris

Science.gov (United States)

HINDLE, ALLYSON G.; LAWLER, JOHN M.; CAMPBELL, KEVIN L.; HORNING, MARKUS

2015-01-01

Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507

Cholinesterase inhibitory activity and chemical constituents of Stenochlaena palustris fronds at two different stages of maturity

Directory of Open Access Journals (Sweden)

Nelson Jeng-Yeou Chear

2016-04-01

Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.

Muscle senescence in short-lived wild mammals, the soricine shrews Blarina brevicauda and Sorex palustris.

Science.gov (United States)

Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus

2009-06-01

Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.

Ethylene regulates fast apoplastic acidification and expansin A transcription during submergence-induced petiole elongation in Rumex palustris

NARCIS (Netherlands)

Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ

The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We

The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris

Science.gov (United States)

R.A. Arango; C.A. Clausen; Frederick Green

2006-01-01

Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to N’N-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...

Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance

Science.gov (United States)

D. Paul Jackson; R. Kasten Dumroese; James P. Barnett

2012-01-01

Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

New occurrences and biological aspects to four species of rodents (Mammalia: Cricetidae from Brazil

Directory of Open Access Journals (Sweden)

Felipe Santana Machado

2015-07-01

Full Text Available The most representative group among mammals are rodents for presenting high ratio to the total of species. However, rodents are considered a "taxonomic chaos" and some species such as Blarinomys breviceps, Bibimys labiosus, Akodon lindberghi and Pseudoryzomys simplex are little known. That can be explained because of low occurrence of small terrestrial mammals in wildlife inventories and/or reduced abundance. The objective is to describe the occurrence of these species and analyze these locations presenting descriptive comments about their biological aspects. Therefore, in addition to specimens collected in the field, some scientific collections were visited and reviews in relevant literature were conducted in order to obtain information about the locations and biological aspects. Akodon lindberghi was found in five sites, Bibimys labiosus was found in 15, Blarinomys breviceps in 39 and Pseudoryzomys simplex  in 13. Each species has specific information and they are included in two threatened areas, Atlantic Forest and Cerrado. The occurrences are disconnected and related to taxonomic and methodological problems. Keywords: New records. Rodentia. Sigmodontinae. Occurence area.

Assessing longleaf pine (Pinus palustris) restoration after southern pine beetle kill using a compact experimental design

Science.gov (United States)

J.-P. Berrill; C.M. Dagley

2010-01-01

A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...

Concerted evolution of body mass and cell size: similar patterns among species of birds (Galliformes) and mammals (Rodentia)

Science.gov (United States)

Dragosz-Kluska, Dominika; Pis, Tomasz; Pawlik, Katarzyna; Kapustka, Filip; Kilarski, Wincenty M.; Kozłowski, Jan

2018-01-01

ABSTRACT Cell size plays a role in body size evolution and environmental adaptations. Addressing these roles, we studied body mass and cell size in Galliformes birds and Rodentia mammals, and collected published data on their genome sizes. In birds, we measured erythrocyte nuclei and basal metabolic rates (BMRs). In birds and mammals, larger species consistently evolved larger cells for five cell types (erythrocytes, enterocytes, chondrocytes, skin epithelial cells, and kidney proximal tubule cells) and evolved smaller hepatocytes. We found no evidence that cell size differences originated through genome size changes. We conclude that the organism-wide coordination of cell size changes might be an evolutionarily conservative characteristic, and the convergent evolutionary body size and cell size changes in Galliformes and Rodentia suggest the adaptive significance of cell size. Recent theory predicts that species evolving larger cells waste less energy on tissue maintenance but have reduced capacities to deliver oxygen to mitochondria and metabolize resources. Indeed, birds with larger size of the abovementioned cell types and smaller hepatocytes have evolved lower mass-specific BMRs. We propose that the inconsistent pattern in hepatocytes derives from the efficient delivery system to hepatocytes, combined with their intense involvement in supracellular function and anabolic activity. PMID:29540429

Concerted evolution of body mass and cell size: similar patterns among species of birds (Galliformes and mammals (Rodentia

Directory of Open Access Journals (Sweden)

Marcin Czarnoleski

2018-04-01

Full Text Available Cell size plays a role in body size evolution and environmental adaptations. Addressing these roles, we studied body mass and cell size in Galliformes birds and Rodentia mammals, and collected published data on their genome sizes. In birds, we measured erythrocyte nuclei and basal metabolic rates (BMRs. In birds and mammals, larger species consistently evolved larger cells for five cell types (erythrocytes, enterocytes, chondrocytes, skin epithelial cells, and kidney proximal tubule cells and evolved smaller hepatocytes. We found no evidence that cell size differences originated through genome size changes. We conclude that the organism-wide coordination of cell size changes might be an evolutionarily conservative characteristic, and the convergent evolutionary body size and cell size changes in Galliformes and Rodentia suggest the adaptive significance of cell size. Recent theory predicts that species evolving larger cells waste less energy on tissue maintenance but have reduced capacities to deliver oxygen to mitochondria and metabolize resources. Indeed, birds with larger size of the abovementioned cell types and smaller hepatocytes have evolved lower mass-specific BMRs. We propose that the inconsistent pattern in hepatocytes derives from the efficient delivery system to hepatocytes, combined with their intense involvement in supracellular function and anabolic activity.

Ontogenetic allometry in the foot size of Oligoryzomys flavescens (Waterhouse, 1837 (Rodentia, Sigmodontinae

Directory of Open Access Journals (Sweden)

R. Maestri

Full Text Available Ontogenetic allometry is the study of how the size or shape of certain structures changes over the course of an animal’s development. In this study, using Huxley's formula of allometric growth (1932, we assessed the changes in the rate of growth of the feet size of the sigmodontine rodent Oligoryzomys flavescens during its ontogeny and compared differences between males and females. We find evidence of a change of polarity during the ontogenetic development of the species, with the presence of positive allometry during pregnancy and negative allometry in adulthood. Moreover, we note the presence of sexual dimorphism in the size of the feet, in which males of the species have a higher rate of growth than females. This growth pattern is positively related to escape from predators in childhood in both sexes and, in adulthood, provides a higher encounter rate of females by males, due to the larger displacement of the latter. We suggest that both the forces of natural selection and sexual selection have acted to shape the evolution of foot size in this species.

Ontogenetic allometry in the foot size of Oligoryzomys flavescens (Waterhouse, 1837) (Rodentia, Sigmodontinae).

Science.gov (United States)

Maestri, R; Fornel, R; Freitas, T R O; Marinho, J R

2015-05-01

Ontogenetic allometry is the study of how the size or shape of certain structures changes over the course of an animal's development. In this study, using Huxley's formula of allometric growth (1932), we assessed the changes in the rate of growth of the feet size of the sigmodontine rodent Oligoryzomys flavescens during its ontogeny and compared differences between males and females. We find evidence of a change of polarity during the ontogenetic development of the species, with the presence of positive allometry during pregnancy and negative allometry in adulthood. Moreover, we note the presence of sexual dimorphism in the size of the feet, in which males of the species have a higher rate of growth than females. This growth pattern is positively related to escape from predators in childhood in both sexes and, in adulthood, provides a higher encounter rate of females by males, due to the larger displacement of the latter. We suggest that both the forces of natural selection and sexual selection have acted to shape the evolution of foot size in this species.

An unusual feature of yolk sac placentation in Necromys lasiurus (Rodentia, Cricetidae, Sigmodontinae)

DEFF Research Database (Denmark)

Favaron, P O; Carter, Anthony Michael; Mess, A M

2012-01-01

. Elsewhere it was non-villous and closely attached to the uterus. The uterine glands were shallow and wide mouthed. They were associated with vessels and filled with secretion, suggesting the release of histotroph. This feature was absent at later stages. The intimate association of the yolk sac......We studied the development of the inverted yolk sac in a New World rodent, Necromys lasiurus during early placentation. Ten implantation sites were investigated by means of histology, immunohistochemistry and electron microscopy. The yolk sac was villous near its attachment to the placenta...

Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

Science.gov (United States)

Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

2018-02-01

The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

Energy Technology Data Exchange (ETDEWEB)

Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)

2010-01-15

The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain.

Science.gov (United States)

Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto

2016-03-01

Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.

Modeling silviculture after natural disturbance to sustain biodiversity in the longleaf pine (Pinus palustris) ecosystem : balancing complexity and implementation

Science.gov (United States)

Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers

2002-01-01

Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...

Experiments on accumulation of phosphorus in the plants Myosotis palustris, Glyceria maxima and Nasturtium officinale

Directory of Open Access Journals (Sweden)

O. Prokopchuk

2016-10-01

Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established

Reproductive system abnormalities in Schistosoma mansoni adult worms isolated from Nectomys squamipes (Muridae: Sigmodontinae: brightfield and confocal laser scanning microscopy analysis

Directory of Open Access Journals (Sweden)

Neves Renata Heisler

2003-01-01

Full Text Available Schistosoma mansoni adult worms with genital anomalies isolated from Nectomys squamipes (Muridae: Sigmodontinae were studied by confocal laser scanning microscopy under the reflected mode. One male without testicular lobes (testicular agenesia/anorchism and two females, one with an atrophied ovary and another with 17 uterine eggs, were identified. The absence of testicular lobes occurred in a worm presenting otherwise normal male adult characteristics: tegument, tubercles and a gynaecophoric canal with spines. In both female specimens the digestive tube showed a vacuolated appearance, and the specimen with supernumerary uterine eggs exhibited a developing miracidium and an egg with a formed shell. The area of the ventral sucker was similar in both specimens however the tegument thickness, ovary and vitelline glands of the specimen with the atrophied ovary were smaller than those of the one with supernumerary eggs. These reported anomalies in the reproductive system call attention to the need to improve our understanding of genetic regulation and the possible role of environmental influences upon trematode development.

Preservation of H₂ production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

Energy Technology Data Exchange (ETDEWEB)

Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2013-01-21

To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O₂ on preservation of H₂ production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H₂ production activity, whereas considerable H₂ production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H₂ production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H₂ (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H₂ production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H₂ production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

Correlation between oxalic acid production and tolerance of Tyromyces palustris strain TYP-6137 to N',N-naphthaloylhydroxamine

Science.gov (United States)

Rachel A. Arango; Patricia K. Lebow; Frederick III Green

2009-01-01

Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% N’,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...

Genetic diversity and relatedness within and between species of the genus Oligoryzomys (Rodentia; Sigmodontinae

Directory of Open Access Journals (Sweden)

A. Trott

Full Text Available A RAPD analysis on six species of the rodent genus Oligoryzomys trapped in a wide area (ranging from 01° N to 32° S of Brazilian territory was performed in order to determine the levels of genetic variability within and between its populations and species. One-hundred and ninety-three animals were collected in 13 different sites (corresponding to 17 samples located at Pampas, Atlantic Rain Forest, Cerrado, and Amazon domains. Oligoryzomys sp., O. nigripes (8 populations, O. flavescens (4 populations, O. moojeni, O. stramineus, and O. fornesi were the taxa analyzed. Of the 20 primers tested, 4 generated a total of 75 polymorphic products simultaneously amplified in 151 specimens. Various diversity estimators analyzed showed considerable differences between species and populations, indicating a great genetic variation occurring in the Oligoryzomys taxa investigated. A cluster analysis was made using Nei's standard genetic distances, however, it did not correlate the genetic heterogeneity of the species and populations with the geographical areas.

Genetic diversity and relatedness within and between species of the genus Oligoryzomys (Rodentia; Sigmodontinae).

Science.gov (United States)

Trott, A; Callegari-Jacques, S M; Oliveira, L F B; Langguth, A; Mattevi, M S

2007-02-01

A RAPD analysis on six species of the rodent genus Oligoryzomys trapped in a wide area (ranging from 01 degrees N to 32 degrees S) of Brazilian territory was performed in order to determine the levels of genetic variability within and between its populations and species. One-hundred and ninety-three animals were collected in 13 different sites (corresponding to 17 samples) located at Pampas, Atlantic Rain Forest, Cerrado, and Amazon domains. Oligoryzomys sp., O. nigripes (8 populations), O. flavescens (4 populations), O. moojeni, O. stramineus, and O. fornesi were the taxa analyzed. Of the 20 primers tested, 4 generated a total of 75 polymorphic products simultaneously amplified in 151 specimens. Various diversity estimators analyzed showed considerable differences between species and populations, indicating a great genetic variation occurring in the Oligoryzomys taxa investigated. A cluster analysis was made using Nei's standard genetic distances, however, it did not correlate the genetic heterogeneity of the species and populations with the geographical areas.

Two Distinct Aerobic Methionine Salvage Pathways Generate Volatile Methanethiol in Rhodopseudomonas palustris

Science.gov (United States)

Miller, Anthony R.; North, Justin A.; Wildenthal, John A.

2018-01-01

ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438

Long-term effects of fire and fire-return interval on population structure and growth of longleaf pine (Pinus palustris)

Science.gov (United States)

Chelcy R. Ford; Emily S. Minor; Gordon A. Fox

2010-01-01

We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...

Influence of residual basal area on longleaf pine (Pinus palustris Mill.) first year germination and establishment under selection silviculture

Science.gov (United States)

Ferhat Kara; Edward F. Loewenstein

2015-01-01

Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...

Genome assembly of the fungus Cochliobolus miyabeanus, and transcriptome analysis during early stages of infection on American wild rice (Zizania palustris L.)

Science.gov (United States)

Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...

Comparison of red-cockaded woodpecker (Picoides borealis) nestling diet in old-growth and old-field longleaf pine (Pinus palustris) habitats

Science.gov (United States)

James L. Hanula; R. Todd Engstrom

2000-01-01

Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....

Effects of site preparation treatments on early growth and survival of planted longleaf pine (Pinus palustris Mill.) seedlings in North Carolina

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen

2006-01-01

We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...

Differential responses of the freshwater wetland species Juncus effusus L. and Caltha palustris L. to iron supply in sulfidic environments

International Nuclear Information System (INIS)

Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.

2007-01-01

Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition

Transfer of the high-GC cyclohexane carboxylate degradation pathway from Rhodopseudomonas palustris to Escherichia coli for production of biotin.

Science.gov (United States)

Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C

2008-01-01

This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.

Toxicity of sulfide to early life stages of wild rice (Zizania palustris).

Science.gov (United States)

Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt

2017-08-01

The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.

High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae)

DEFF Research Database (Denmark)

Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof

2015-01-01

, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...

Characteristics of the larval Echinococcus vogeli Rausch and Bernstein, 1972 in the natural intermediate host, the paca, Cuniculus paca L. (Rodentia: Dasyproctidae).

Science.gov (United States)

Rausch, R L; D'Alessandro, A; Rausch, V R

1981-09-01

In Colombia, the natural intermediate host of Echinococcus vogeli Rausch and Bernstein, 1972 is the paca, Cuniculus paca L. (Rodentia: Dasyproctidae). The larval cestode develops in the liver of the host, where it usually is situated superficially, partly exposed beneath Glisson's capsule. The infective larva consists of a subspherical to asymmetrical, fluid-filled vesicle, up to 30 mm in diameter, enclosed by a thick laminated membrane. It typically contains numerous chambers, often interconnected, produced by endogenous proliferation of germinal and laminated tissue, within which brood capsules arise in an irregular pattern from the germinal layer. Invasive growth by means of exogenous proliferation, typical of infections in man, was not observed in the natural intermediate host. The development of the larval cestode is described on the basis of material from pacas, supplemented by observations on early-stage lesions in experimentally infected nutrias, Myocastor coypus (Molina) (Rodentia: Capromyidae). The tissue response is characterized for early-stage, mature (infective), and degenerating larvae in the comparatively long-lived intermediate host. In addition to previously reported differences in size and form of rostellar hooks, other morphologic characteristics are defined by which the larval stage of E. vogeli is distinguished from that of E. oligarthrus (Diesing, 1863). Pathogenesis by the larval E. vogeli in man, like that by the larval E. multilocularis Leuckart, 1863, is the consequence of atypical proliferation of vesicles attributable to parasite-host incompatibility.

Least speciose among the most speciose: Natural history correlates of monospecific and bispecific genera of Rodentia and Soricomorpha.

Science.gov (United States)

Amori, Giovanni; Bissattini, Alessandra Maria; Gippoliti, Spartaco; Vignoli, Leonardo; Maiorano, Luigi; Luiselli, Luca

2017-11-01

Monospecific and bispecific genera are of special concern as they represent unique phylogenetic/evolutionary trajectories within larger clades. In addition, as phylogenetically older taxa are supposed to be exposed to higher rarity and extinction risk, monospecific and bispecific genera may be intrinsically more prone to extinction risks than multispecies genera, although extinction risks also depend on the ecological and biological strategy of the species. Here, the distribution across biogeographical zones and the levels of threat to 2 speciose orders of mammals (monospecific and bispecific genera of Rodentia and Soricomorpha) are investigated in order to highlight major patterns at the worldwide scale. In Rodentia, 39.7% of the genera (n = 490) were monospecific and 17.9% were bispecific. In Soricomorpha, 44.4% of the total genera (n = 45) were monospecific and 15% were bispecific. There was a positive correlation between the number of monospecific genera and the total number of genera per family. Peaks of monospecific and bispecific genera richness were observed in Neotropical, Oriental and Afrotropical regions in rodents and in the Palearctic region in soricomorphs. Range size was significantly uneven across biogeographic region in rodents (with larger ranges in Nearctic and Oriental regions and smaller ranges in the Australian region), but there was no difference across biogeographic regions in terms of range size in soricomorphs. Most of the monospecific and bispecific genera occurred in forest habitat in both taxa. The frequency distribution of the monospecific and bispecific genera across IUCN categories did not differ significantly from the expected pattern using the total rodent genera and the multispecies genera. © 2017 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.

Detection and enumeration of methanotrophs in acidic Sphagnum peat by 16S rRNA fluorescence in situ hybridization, including the use of newly developed oligonucleotide probes for Methylocella palustris.

Science.gov (United States)

Dedysh, S N; Derakshani, M; Liesack, W

2001-10-01

Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.

Promoting effects of a single Rhodopseudomonas palustris inoculant on plant growth by Brassica rapa chinensis under low fertilizer input.

Science.gov (United States)

Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te

2014-09-17

Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.

Descripción del nido de Scolomys melanops (Rodentia, Cricetidae y su relación con Lepidocaryum tenue (Arecales, Arecaceae

Directory of Open Access Journals (Sweden)

Edgardo M. Rengifo

2012-11-01

Full Text Available Se describe el nido de Scolomys melanops (Rodentia: Cricetidae, encontrado en el Nororiente de Perú en un hábitat de Colinas bajas. Se identificó tres estructuras en el nido: a Orificio de acceso y salida; b Túnel y c Dormidero, en este último se encontraron restos de frutos, fibras del pedúnculo y tallos de Lepidocaryum tenue (Arecales: Arecaceae “Irapay”. Se sugiere en base al material vegetal encontrado en el nido, la existencia de una relación de depredación entre el roedor Scolomys melanops y la palmera Lepidocaryum tenue.

How Posttranslational Modification of Nitrogenase Is Circumvented in Rhodopseudomonas palustris Strains That Produce Hydrogen Gas Constitutively

Science.gov (United States)

Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.

2012-01-01

Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236

Endemic Marsh Mongoose Herpestes palustris (Carnivora: Herpestidae of East Kolkata Wetlands, India: a status report

Directory of Open Access Journals (Sweden)

J.K. Mallick

2009-04-01

Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.

A Transitional Gundi (Rodentia: Ctenodactylidae from the Miocene of Israel.

Directory of Open Access Journals (Sweden)

Raquel López-Antoñanzas

Full Text Available We describe a new species of gundi (Rodentia: Ctenodactylidae: Ctenodactylinae, Sayimys negevensis, on the basis of cheek teeth from the Early Miocene of the Rotem Basin, southern Israel. The Rotem ctenodactylid differs from all known ctenodactylid species, including Sayimys intermedius, which was first described from the Middle Miocene of Saudi Arabia. Instead, it most resembles Sayimys baskini from the Early Miocene of Pakistan in characters of the m1-2 (e.g., the mesoflexid shorter than the metaflexid, the obliquely orientated hypolophid, and the presence of a strong posterolabial ledge and the upper molars (e.g., the paraflexus that is longer than the metaflexus. However, morphological (e.g., presence of a well-developed paraflexus on unworn upper molars and dimensional (regarding, in particular, the DP4 and M1 or M2 differences between the Rotem gundi and Sayimys baskini distinguish them and testify to the novelty and endemicity of the former. In its dental morphology, Sayimys negevensis sp. nov. shows a combination of both the ultimate apparition of key-characters and incipient features that would be maintained and strengthened in latter ctenodactylines. Thus, it is a pivotal species that bridges the gap between an array of primitive ctenodactylines and the most derived, Early Miocene and later, gundis.

The role of growth stop as a morphogenetic factor in Mastomys natalensis (Rodentia: Muridae)

DEFF Research Database (Denmark)

Fadda, Carlo; Leirs, Herwig

2009-01-01

The present study investigated growth patterns under three different environmental conditions in a single population of the rodent Mastomys natalensis (Rodentia, Muridae) in Morogoro, Tanzania. The study aimed to test whether and how post-weaning ontogenetic processes are affected by different...... environmental conditions. Morogoro is characterized by a bimodal rainfall pattern, with unreliable peaks occurring in November/December of some years and reliable ones in February to May. We recognized three different generation types. In the first one, the alpha generation, growth occurred during the dry...... there was a continuity between both rainfall peaks. Analyses of size and shape following both Huxley-Jolicoeur and Gould-Mosimann approaches revealed that the three groups differ significantly both in size and shape. In both cases, the importance of the environment in assessing growth trajectories during post...

Food supply (Orthoptera, Mantodea, Rodentia and Eulipotyphla and food preferences of the red-footed falcon (Falco vespertinus in Slovakia

Directory of Open Access Journals (Sweden)

Krištín Anton

2017-12-01

Full Text Available Food supply in the nesting territories of species has a key role to the species diet composition and their breeding success. Red-footed falcon (Falco vespertinus preys predominantly on larger insect species with a supplementary portion of smaller vertebrates. In the breeding periods 2014 and 2016 their food supply, focusing on Orthoptera, Mantodea, Rodentia and Eulipotyphla, was analysed at five historical nesting sites of the species in Slovakia. Preference for these prey groups in the diet was also studied at the last active nesting site in this country. Overall we recorded 45 Orthoptera species (of which 23 species are known as the food of the red-footed falcon, one species of Mantodea, 10 species of Rodentia (of which 2 species are known as the food of the red-footed falcon and 5 species of the Eulipotyphla order in the food supply. With regard to the availability of the falcons' preferred food, in both years the most suitable was the Tvrdošovce site, which continuously showed the greatest range and abundance of particular species. In the interannual comparison the insects showed lower variability in abundance than the small mammals. In 2014 the growth of the common vole (Microtus arvalis population culminated and with the exception of a single site (Bodza a slump in abundance was recorded in 2016. In comparing the diet composition with the food supply at the last Slovak breeding site Rusovce (Special Protection Area Sysľovské polia, we recorded significant preference for grasshopper Caliptamus italicus (in 2014, common vole (in 2016 and cricket Tettigonia viridissima (in both years in the falcons' diet. They did not prey on the Apodemus sylvaticus species belonging among the abundant small mammal species in that locality. Conservation measures in the agricultural landscape are discussed in relation to homogeneous red-footed falcon breeding territories.

Purification, molecular cloning, and enzymatic properties of a family 12 endoglucanase (EG-II) from fomitopsis palustris: role of EG-II in larch holocellulose hydrolysis.

Science.gov (United States)

Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro

2008-09-01

A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.

Nitric oxide production by Peromyscus yucatanicus (Rodentia infected with Leishmania (Leishmania mexicana

Directory of Open Access Journals (Sweden)

Elsy Nalleli Loría-Cervera

2013-04-01

Full Text Available Peromyscus yucatanicus (Rodentia: Cricetidae is a primary reservoir of Leishmania (Leishmania mexicana (Kinetoplastida: Trypanosomatidae. Nitric oxide (NO generally plays a crucial role in the containment and elimination of Leishmania. The aim of this study was to determine the amount of NO produced by P. yucatanicus infected with L. (L. mexicana. Subclinical and clinical infections were established in P. yucatanicus through inoculation with 1 x 10 2 and 2.5 x 10 6 promastigotes, respectively. Peritoneal macrophages were cultured alone or co-cultured with lymphocytes with or without soluble Leishmania antigen. The level of NO production was determined using the Griess reaction. The amount of NO produced was significantly higher (p ≤ 0.0001 in co-cultured macrophages and lymphocytes than in macrophages cultured alone. No differences in NO production were found between P. yucatanicus with subclinical L. (L. mexicana infections and animals with clinical infections. These results support the hypothesis that the immunological mechanisms of NO production in P. yucatanicus are similar to those described in mouse models of leishmaniasis and, despite NO production, P. yucatanicus is unable to clear the parasite infection.

Karyotypes of Akodon orophilus Osgood 1913 and Thomasomys sp. (Rodentia: Sigmodontinae from Huánuco, Peru

Directory of Open Access Journals (Sweden)

Víctor Pacheco

2012-10-01

Full Text Available Conventional chromosomal preparations were made of three native mice from Huánuco, Peru: a male and a female of Thomasomys sp., and a male of Akodon orophilus. Thomasomys sp. had a karyotype of 2n = 42, XY (n = 21, meanwhile A. orophilus presented 2n = 22, XY (n = 11. Comparisons between chromosomal pairs from the existent literature indicate that both are new karyotypes. Thomasomys sp. has a distinct sexual Y chromosome, the only metacentric (m reported for the genus. The chromosomes X and Y of A. orophilus are acrocentrics (a; and the length of chromosome Y (2/3 of the length of X distinguishes A. orophilus from other congeneric. Because the structural differences between the sexual chromosomes usually generates mechanism of reproductive isolation at intraspecific level and are bigger still in interspecific crosses, we concluded that the karyotypes reported here support the validity of the species A. orophilus and suggest that Thomasomys sp. represents a new species to science.

Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica.

Science.gov (United States)

Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

2016-07-01

In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

Hydrogen production using Rhodopseudomonas palustris WP 3-5 with hydrogen fermentation reactor effluent

International Nuclear Information System (INIS)

Chi-Mei Lee; Kuo-Tsang Hung

2006-01-01

The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)

Uranium interaction with two multi-resistant environmental bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris.

Science.gov (United States)

Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

2012-01-01

Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.

Uranium Interaction with Two Multi-Resistant Environmental Bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris

Science.gov (United States)

Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

2012-01-01

Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623

Guerrerostrongylus marginalis n. sp. (Trichostrongyloidea: Heligmonellidae from the Guianan arboreal mouse (Oecomys auyantepui from French Guiana

Directory of Open Access Journals (Sweden)

Weirich Jessica M.

2016-01-01

Full Text Available Based on the number and arrangement of cuticular ridges and configuration of the dorsal ray, nematode specimens collected from the small intestine of eight Guianan arboreal mice, Oecomys auyantepui (Rodentia: Sigmodontinae, in French Guiana are herein described and characterized. Guerrerostrongylus marginalis n. sp. (Heligmosomoidea: Heligmonellidae shows a synlophe consisting of more than 40 ridges and a unique bursal arrangement with ray 8 (externo-dorsal extending to the edge of the bursal margin, and appearing more prominent than the dorsal ray. This bursal arrangement is common in members of Hassalstrongylus Durette-Desset, 1971, but uncommon in the other four species in Guerrerostrongylus Sutton & Durette-Desset, 1991. The placement of the new species in Guerrerostrongylus is based on the number and nature of cuticular ridges and the ray arrangement and symmetry of the caudal bursa. Diagnostic characteristics of Guerrerostrongylus marginalis n. sp. include the length of ray 8 relative to bursal margin, the relative size of the spicules and vestibule, and the number of eggs in the uterus. We propose an amendment to the generic diagnosis of Guerrerostrongylus to modify the characters of the long rays 6 (postero-lateral, rays 8 (externo-dorsal, and dorsal ray as diagnostic, since at least ray 6 appears to be short in two different species in the genus, namely G. ulysi Digiani, Notarnicola & Navone, 2012 and G. marginalis n. sp.

Similarity of satellite DNA properties in the order Rodentia

Energy Technology Data Exchange (ETDEWEB)

Mazrimas, J A; Hatch, F T

1977-09-01

We have characterized satellite DNAs from 9 species of kangaroo rat (Dipodomys) and have shown that the HS-..cap alpha.. and HS-..beta.. satellites, where present, are nearly identical in all species as to melting transition midpoint (Tm), and density in neutral CsCl, alkaline CsCl, and Cs/sub 2/SO/sub 4/-Ag/sup +/ gradients. However, the MS satellites exist in two internally similar classes. The satellite DNAs from three other rodents were characterized (densities listed are in neutral CsCl). The pocket gopher, Thomomys bottae, contains Th-..cap alpha.. (1.713 g/ml) and Th-..beta.. (1.703 g/ml). The guinea pig (Cavia porcellus) contains Ca-..cap alpha.., Ca-..beta.., and Ca-..gamma.. at densities of 1.706 g/ml, 1.704 g/ml, and 1.704 g/ml, respectively. The antelope ground squirrel (Ammospermophilus harrisi) contains Am-..cap alpha.., 1.708 g/ml, Am-..beta.., 1.717 g/ml, and Am-..gamma.., 1.707 g/ml. The physical and chemical properties of the alpha-satellites from the above four rodents representing four different families in two suborders of Rodentia were compared. They show nearly identical Tm, nucleoside composition of single strands, and single strand densities in alkaline CsCl. Similar comparisons on the second or third satellite DNAs from these rodents also indicate a close relationship to each other. Thus the high degree of similarity of satellite sequences found in such a diverse group of rodents suggests a cellular function that is subject to natural selection, and implies that these sequences have been conserved over a considerable span of evolutionary time since the divergence of these rodents about 50 million years ago.

Similarity of satellite DNA properties in the order Rodentia

Energy Technology Data Exchange (ETDEWEB)

Mazrimas, J A; Hatch, F T

1977-09-01

Satellite DNAs from 9 species of kangaroo rat (Dipodomys) have been characterized and have shown that the HS-..cap alpha.. and HS-..beta.. satellites, where present, are nearly identical in all species as to melting transition midpoint (Tm), and density in neutral CsCl, alkaline CsCl, and Cs/sub 2/SO/sub 4/-Ag/sup +/ gradients. However, the MS satellites exist in two internally similar classes. The satellite DNAs from three other rodents were characterized (densities listed are in neutral CsCl). The pocket gopher, Thomomys bottae, contains Th-..cap alpha.. (1.713 g/ml) and Th..beta.. (1.703 g/ml). The guinea pig (Cavia porcellus) contains Ca-..cap alpha.., Ca-..beta.. and Ca-..gamma.. at densities of 1.706 g/ml, 1.704 g/ml and 1.704 g/ml, respectively. The antelope ground squirrel (Ammospermophilus harrisi) contains Am-..cap alpha.., 1.708 g/ml, Am-..beta.., 1.717 g/ml, and Am-..gamma.., 1.707 g/ml. The physical and chemical properties of the alpha-satellites from the above four rodents representing four different families in two suborders of Rodentia were compared. They show nearly identical Tm, nucleoside composition of single strands, and single strand densities in alkaline CsCl. Similar comparisons on the second or third satellite DNAs from these rodents also indicate a close relationship to each other. Thus the high degree of similarity of satellite sequences found in such a diverse group of rodents suggests a cellular function that is subject to natural selection, and implies that these sequences have been conserved over a considerable span of evolutionary time since the divergence of these rodents about 50 million years ago.

Allodaposuchus palustris sp. nov. from the upper cretaceous of Fumanya (South-Eastern Pyrenees, Iberian Peninsula: systematics, palaeoecology and palaeobiogeography of the enigmatic allodaposuchian crocodylians.

Directory of Open Access Journals (Sweden)

Alejandro Blanco

Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.

Morphological diagnosis and geographic distribution of Atlantic Forest red-rumped mice of the genus Juliomys (Rodentia: Sigmodontinae)

OpenAIRE

Pavan,Silvia E; Leite,Yuri L. R

2011-01-01

Recognition and identification of red-rumped mice of the genus Juliomys González, 2000 has been a problem among many mammalogists, and specimens of this genus are commonly confused with other Atlantic Forest sigmodontine rodents. Herein we provide an expanded diagnosis for the genus based on the analyses of the three living species of Juliomys, and provide morphological comparisons to the small bodied and bright colored rodents Rhagomys rufescens (Thomas, 1886) and Oligoryzomys flavescens (Wa...

Leishmaniose cutânea na Amazônia: isolamento de Leishmania (Viannia lainsoni do roedor Agouti paca (Rodentia: Dasyproctidae, no estado do Pará, Brasil Cutaneous leishmaniasis in the Amazon Region: isolation of Leishmania (Viannia lainsoni from the rodent Agouti paca (Rodentia: Dasyproctidae in Pará State, Brazil

Directory of Open Access Journals (Sweden)

Fernando T. Silveira

1991-02-01

Full Text Available Fez-se o registro, pela primeira vez, do isolamento de Leishmania (V. lainsoni de um mamífero silvestre, o roedor Agouti paca (Rodentia: Dasyproctidae, no Estado do Pará, Brasil. As amostras do parasita foram isoladas da pele, aparentemente íntegra, de 3 espécimes desse roedor, capturados no município de Tucuruí (ilha de Tocantins, em área que seria inundada pela formação do lago da hidrelétrica construída naquele município. Nenhum isolamento foi obtido de vísceras de qualquer dos animais. A identificação das amostras de L. (V. lainsoni baseou-se na morfologia de amastigotas e promastigotas, no comportamento da infecção em "hamsters", na análise bioquímica de isoenzimas e, ainda, através de testes com anticorpos monoclonais. A natureza inaparente da infecção nos animais faz supor que o mamífero em questão possa representar um hospedeiro definitivo do parasita na região Amazônica.The isolation of Leishmania (V. lainsoni is recorded for the first time from a wild animal, the rodent Agouti paca (Rodentia: Dasyproctidae, from Pará State, north Brazil. Isolates of the parasite were made from apparently normal skin of 3 specimens of this rodent captured on the Island of Tocantins, in the municipality of Tucuruí, an area subsequently flooded in the formation of the lake associated with the Tucuruí hydroeletric dam. No isolations were made from the viscera. Identification of the parasite was in each case based on morphology of the amastigotes and promastigotes, behavior of the organism in hamsters, isoenzymes profiles and the use of monoclonal antibodies. The inapparent nature of the infection leads us to suggest that the "paca", Agouti paca, represents a primitive host of L. (V. lainsoni in the Amazon Region.

On the occurrence of Holochilus chacarius (Cricetidae: Sigmodontinae in Brazil, with taxonomic notes on Holochilus species

Directory of Open Access Journals (Sweden)

Marcus Vinícius Brandão

2015-03-01

Full Text Available Currently four species of Holochilus (Cricetidae: Sigmodontinae are recognized. According to the literature, three species are recorded for Brazil: H. sciureus, H. brasiliensis and H. chacarius. Samples from western Brazil (Mato Grosso and Mato Grosso do Sul states are usually reported as H. sciureus and, when referring to specimens from the Pantanal, as H. chacarius. However, the taxonomic status of specimens from this region has not been properly evaluated through detailed morphological analyses or voucher specimens. About 110 specimens of Holochilus deposited in Brazilian collections were qualitatively and quantitatively analyzed (univariate and multivariate tests. Our results suggested the existence of three species (H. sciureus, H. brasiliensis and H. chacarius in Brazil, which present significant morphological and morphometric differences, thus confirming that the Mato Grosso and Mato Grosso do Sul samples, formerly misidentified as H. sciureus, belong to H. chacarius. This species differs from H. sciureus and H. brasiliensis by a series of pelage and skull characters, such as: the coloration of pelage, light orange-brown in the dorsum, light orangish in the flanks and white in the venter; ridges of the masseteric crest confluent at the level (or slightly above of the mental foramen and at the anterior part of m1, alternated main molar cusps, lophids compressed and with acute outer margins (rarely prismatic, anteromedian fossetid labially displaced and subcircular (small to medium, metaflexid less developed (frequently not reaching the midline of the tooth, proto and hipoconid subrectangular in outline and transversely orientated, mesoflexid transversely orientated and mesoloph absent. The updated geographic distribution of Holochilus in Brazil shows that H. sciureus is present in the northern portion of the country, being the only species present at the Amazon and at the Caatinga and with limit in the Cerrado biome at the center of Goi

Current status of Marsh Crocodiles Crocodylus palustris (Reptilia: Crocodylidae in Vishwamitri River, Vadodara City, Gujarat, India

Directory of Open Access Journals (Sweden)

R. Vyas

2012-11-01

Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.

Optimization of phototrophic hydrogen production by Rhodopseudomonas palustris PBUM001 via statistical experimental design

Energy Technology Data Exchange (ETDEWEB)

Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)

2009-09-15

Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)

Una nueva especie del género Hoplopleura Enderlein, 1904 (Anoplura, Hoplopleuridae parásita de Andinomys edax (Rodentia, Cricetidae

Directory of Open Access Journals (Sweden)

González, A.

1996-12-01

Full Text Available The authors described a new species Hoplopleura zentaensi sp. n. based on specimens collected on Andinomys edax Thomas, l902, from Sierra de Zenta, Jujuy province, Argentina. Descriptions involve the holotype female; three nymphal instar, external architecture of eggs and sites of oviposition, providing differences with its close relative Hoplopleura hirsuta Ferris, l916 and Hoplopleura oxymycteri Ferris, l921. Comments on distribution of these species on their hosts are presented and they are included in the “erratica” group.Describimos en esta contribución a Hoplopleura zentaensi sp. n., a partir de la hembra, sus tres estadios ninfales y las características coriónicas externas del huevo de la referida especie parásita de Andinomys edax Thomas, 1902 (Rodentia, Cricetidae, capturado en Sierra de Zenta, Jujuy, Argentina. Hoplopleura zentaensi sp. n. es afín a Hoplopleura hirsuta Ferris, 1916 y de Hoplopleura oxymycteri Ferris, 1921, integrando junto a estas especies el grupo “erratica”.

Size-dependent distribution and feeding habits of Terebralia palustris in mangrove habitats of Gazi Bay, Kenya

Science.gov (United States)

Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann

2008-03-01

The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat

Karyotype evolution and phylogenetic relationships of hamsters (Cricetidae, Muroidea, Rodentia) inferred from chromosomal painting and banding comparison.

Science.gov (United States)

Romanenko, Svetlana A; Volobouev, Vitaly T; Perelman, Polina L; Lebedev, Vladimir S; Serdukova, Natalya A; Trifonov, Vladimir A; Biltueva, Larisa S; Nie, Wenhui; O'Brien, Patricia C M; Bulatova, Nina Sh; Ferguson-Smith, Malcolm A; Yang, Fengtang; Graphodatsky, Alexander S

2007-01-01

The evolutionary success of rodents of the superfamily Muroidea makes this taxon the most interesting for evolution studies, including study at the chromosomal level. Chromosome-specific painting probes from the Chinese hamster and the Syrian (golden) hamster were used to delimit homologous chromosomal segments among 15 hamster species from eight genera: Allocricetulus, Calomyscus, Cricetulus, Cricetus, Mesocricetus, Peromyscus, Phodopus and Tscherskia (Cricetidae, Muroidea, Rodentia). Based on results of chromosome painting and G-banding, comparative maps between 20 rodent species have been established. The integrated maps demonstrate a high level of karyotype conservation among species in the Cricetus group (Cricetus, Cricetulus, Allocricetulus) with Tscherskia as its sister group. Species within the genera Mesocricetus and Phodopus also show a high degree of chromosomal conservation. Our results substantiate many of the conclusions suggested by other data and strengthen the topology of the Muroidea phylogenetic tree through the inclusion of genome-wide chromosome rearrangements. The derivation of the muroids karyotypes from the putative ancestral state involved centric fusions, fissions, addition of heterochromatic arms and a great number of inversions. Our results provide further insights into the karyotype relationships of all species investigated.

A new species of Cystoisospora Frenkel, 1977 (Apicomplexa: Sarcocystidae) from Oecomys mamorae Thomas (Rodentia: Cricetidae) in the Brazilian Pantanal.

Science.gov (United States)

Barreto, Wanessa Teixeira Gomes; de Andrade, Gisele Braziliano; Viana, Lúcio André; de Oliveira Porfírio, Grasiela Edith; Santos, Filipe Martins; Perdomo, Alessandra Cabral; do Carmo, Jéssica Soares; da Silva, Alanderson Rodrigues; Maltezo, Taynara Rocha; Herrera, Heitor Miraglia

2018-05-01

Despite the great diversity of coccidians, to our knowledge, no coccidian infections have been described in Oecomys spp. In this context, we examined Oecomys mamorae Thomas (Rodentia: Cricetidae) from the Brazilian Pantanal for infections with enteric coccidia. Nine individuals were sampled, and one was found to be infected. The oöcysts were recovered through centrifugal flotation in sugar solution. Using morphological and morphometric features, we described a new species of Cystoisospora Frenkel, 1977. Sporulated oöcysts were ovoidal 20.0-29.1 × 16.4-23.2 (26.7 × 21.2) µm and contained two sporocysts, 12.9-19.1 × 9.4-13.9 (16.4 × 12.4) µm, each with four banana-shaped sporozoites. Polar granule and oöcyst residuum were both absent. We documented the developmental forms in the small intestine and described the histopathological lesions in the enteric tract. Our results indicate that the prevalence of Cystoisospora mamorae n. sp. in O. mamorae is low, and tissue damage in the enteric tract is mild, even in the presence of coccidian developmental stages.

A Tribal Story Written in Silica: Using Phytoliths to Research the Effects of Mining on Past Wild Rice (Zizania palustris) Abundance in Sandy Lake, Minnesota

Science.gov (United States)

Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

2014-12-01

Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.

Population structure and genetic variability of mainland and insular populations of the Neotropical water rat, Nectomys squamipes (Rodentia, Sigmodontinae

Directory of Open Access Journals (Sweden)

Francisca C. Almeida

2005-12-01

Full Text Available Seven microsatellite loci were used to investigate the genetic variability and structure of six mainland and two island populations of the Neotropical water rat Nectomys squamipes, a South American semi-aquatic rodent species with a wide distribution. High levels of variability were found within mainland populations while island populations were less variable but the more differentiated in respect to allele number and frequency. The time of biological divergence between mainland and island populations coincided with geological data. A significant geographic structure was found in mainland populations (theta = 0.099; rho = 0.086 although the degree of differentiation was relatively low in respect to the distance between surveyed localities (24 to 740 km. Genetic and geographic distances were not positively correlated as previously found with random amplified polymorphic DNA (RAPD markers. Significant but low genetic differentiation in the mainland and lack of isolation by distance can be explained by large population size and/or recent population expansion. Additionally, the agreement between the age of geologic events (sea level fluctuations and divergence times for insular populations points to a good reference for molecular clock calibration to associate recent environmental changes and the distribution pattern of small mammals in the Brazilian Atlantic Forest.

Genetic differentiation in geographically close populations of the water rat Nectomys squamipes (Rodentia, Sigmodontinae from the Brazilian Atlantic Forest

Directory of Open Access Journals (Sweden)

Maroja L.S.

2003-01-01

Full Text Available We examined the genetic structure and the effects of a bottleneck in populations of the water rat Nectomys squamipes, a primary host of Schistosoma mansoni. Eight microsatellite loci were studied in 7 populations from the Sumidouro region of the Brazilian state of Rio de Janeiro. Our data, covering a four-year period during which a bottleneck occurred, revealed substantial variation (6-31 alleles per locus and high levels of both observed (0.718-0.789 and expected (0.748-0.832 heterozygosity. Most populations were in Hardy-Weinberg equilibrium without linkage disequilibrium between loci. Overall average genetic differentiation between populations (estimated with the F ST (q and R ST (r analogues was 0.037 for q and 0.060 for r. There was significant allelic and genotypic differentiation between populations, especially in pairwise comparisons that included the most geographically isolated population. Direct migration estimates showed a low rate of migration, indicating that infected N. squamipes populations had a limited ability to spread S. mansoni. When the pre- and post-bottleneck populations were compared there was no detectable reduction in heterozygosity or allele number, although a significant excess of heterozygosity was detected in the post-bottleneck population.

The micromammals (Lagomorpha, Eulipotyphla and Rodentia) from the Middle Pleistocene site of Cuesta de la Bajada (Teruel, Spain): Systematic study and paleoenvironmental considerations

Energy Technology Data Exchange (ETDEWEB)

Sese, C.; Soto, E.; Santonja, M.; Perez-Gonzalez, A.; Dominguez-Rodrigo, M.

2016-07-01

The micromammal association established in this work is the following: Lagomorpha: Oryctolagus cuniculus; Eulipotyphla: Crocidura cf. russula, cf. Sorex sp., Neomys sp., Soricidae indet. and Talpa sp.; and Rodentia: Eliomys quercinus, Apodemus cf. sylvaticus, Cricetulus (Allocricetus) bursae, Arvicola aff. sapidus, Microtus (Iberomys) brecciensis and Microtus (Terricola duodecimcostatus. This association is characteristic of the Middle Pleistocene. The morphological state of Cricetulus (A.) bursae, Arvicola aff. sapidus and Microtus (I.) brecciensis allows to place it in the advanced, but not final, Middle Pleistocene, which agrees with the numerical data of the site (243–337 ka) that places it in the MIS 8 or 9. The micromammals indicate the predominance of the open spaces with abundant vegetation mainly of herbaceous and bushes but also with some areas with trees. The climate would be of Mediterranean type, similar to the actual or perhaps a little milder and more humid. (Author)

Virtual endocasts of Eocene Paramys (Paramyinae): oldest endocranial record for Rodentia and early brain evolution in Euarchontoglires.

Science.gov (United States)

Bertrand, Ornella C; Amador-Mughal, Farrah; Silcox, Mary T

2016-01-27

Understanding the pattern of brain evolution in early rodents is central to reconstructing the ancestral condition for Glires, and for other members of Euarchontoglires including Primates. We describe the oldest virtual endocasts known for fossil rodents, which pertain to Paramys copei (Early Eocene) and Paramys delicatus (Middle Eocene). Both specimens of Paramys have larger olfactory bulbs and smaller paraflocculi relative to total endocranial volume than later occurring rodents, which may be primitive traits for Rodentia. The encephalization quotients (EQs) of Pa. copei and Pa. delicatus are higher than that of later occurring (Oligocene) Ischyromys typus, which contradicts the hypothesis that EQ increases through time in all mammalian orders. However, both species of Paramys have a lower relative neocortical surface area than later rodents, suggesting neocorticalization occurred through time in this Order, although to a lesser degree than in Primates. Paramys has a higher EQ but a lower neocortical ratio than any stem primate. This result contrasts with the idea that primates were always exceptional in their degree of overall encephalization and shows that relative brain size and neocortical surface area do not necessarily covary through time. As such, these data contradict assumptions made about the pattern of brain evolution in Euarchontoglires. © 2016 The Author(s).

A phylogeographic study of the endemic rodent Eliurus carletoni (Rodentia: Nesomyinae) in an ecological transition zone of Northern Madagascar.

Science.gov (United States)

Rakotoarisoa, Jean-Eric; Raheriarisena, Martin; Goodman, Steven M

2013-01-01

We conducted a mitochondrial phylogeographic study of the endemic dry forest rodent Eliurus carletoni (Rodentia: Nesomyinae) in an ecological transition zone of northern Madagascar (Loky-Manambato) and 2 surrounding regions (Ankarana and Analamerana). The main goal was to assess the evolutionary consequences on this taxon of the complex landscape features and Quaternary ecological vicissitudes. Three haplogroups were identified from the 215 specimens obtained from 15 populations. High levels of genetic diversity and significant genetic differentiation among populations were observed. The different geographical subdivisions of the study area by regions, by river catchment zones, and the physical distance between populations are not correlated with genetic patterns. In contrast, population structure is mostly explained by the geographic distribution of the samples among existing forest blocks. E. carletoni experienced a genetic bottleneck between 18 750 and 7500 years BP, which correlates with periods when moister climates existed on the island. Overall, our data suggest that the complex genetic patterns of E. carletoni can be explained by Quaternary climatic vicissitudes that resulted in habitat fluctuations between dry and humid forests, as well as subsequent human-induced fragmentation of forest habitat.

Extended longevity of reproductives appears to be common in Fukomys mole-rats (Rodentia, Bathyergidae.

Directory of Open Access Journals (Sweden)

Philip Dammann

Full Text Available African mole-rats (Bathyergidae, Rodentia contain several social, cooperatively breeding species with low extrinsic mortality and unusually high longevity. All social bathyergids live in multigenerational families where reproduction is skewed towards a few breeding individuals. Most of their offspring remain as reproductively inactive "helpers" in their natal families, often for several years. This "reproductive subdivision" of mole-rat societies might be of interest for ageing research, as in at least one social bathyergid (Ansell's mole-rats Fukomys anselli, breeders have been shown to age significantly slower than non-breeders. These animals thus provide excellent conditions for studying the epigenetics of senescence by comparing divergent longevities within the same genotypes without the inescapable short-comings of inter-species comparisons. It has been claimed that many if not all social mole-rat species may have evolved similar ageing patterns, too. However, this remains unclear on account of the scarcity of reliable datasets on the subject. We therefore analyzed a 20-year breeding record of Giant mole-rats Fukomys mechowii, another social bathyergid species. We found that breeders indeed lived significantly longer than helpers (ca. 1.5-2.2fold depending on the sex, irrespective of social rank or other potentially confounding factors. Considering the phylogenetic positions of F. mechowii and F. anselli and unpublished data on a third Fukomys-species (F. damarensis showing essentially the same pattern, it seems probable that the reversal of the classic trade-off between somatic maintenance and sexual reproduction is characteristic of the whole genus and hence of the vast majority of social mole-rats.

Methylocella palustris gen. nov., sp. nov., a new methane-oxidizing acidophilic bacterium from peat bogs, representing a novel subtype of serine-pathway methanotrophs.

Science.gov (United States)

Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M

2000-05-01

A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.

Action of sulfurous acid on pollen. [Hepatica triloba; Helleborus orientalis; Vinca minor; Viola tricolor; Primula officinalis; Lilium candidum; Petunia; Pisum; Helleborus viridus; Galanthus nivealis; Vinca major; Convallaria maialis; Narcissus poeticus; Caltha palustris; Cystisus laburnum; Orchis maculata; Bilbergia; Eranthus; Crocus

Energy Technology Data Exchange (ETDEWEB)

Sabachnikoff, V

1912-01-23

The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.

The jaw is a second-class lever in Pedetes capensis (Rodentia: Pedetidae

Directory of Open Access Journals (Sweden)

Philip G. Cox

2017-08-01

hystricomorphous morphology has evolved multiple times independently within Rodentia.

Different Metabolomic Responses to Carbon Starvation between Light and Dark Conditions in the Purple Photosynthetic Bacterium, Rhodopseudomonas palustris.

Science.gov (United States)

Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin

2018-03-29

Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.

Cloning and characterization of a pyrethroid pesticide decomposing esterase gene, Est3385, from Rhodopseudomonas palustris PSB-S.

Science.gov (United States)

Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong

2018-05-09

Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.

Endogenous Life Cycle of Eimeria melanomytis (Apicomplexa: Eimeriidae) from the Dusky Rice Rat, Melanomys caliginosus (Rodentia: Cricetidae: Sigmodontinae) in Costa Rica.

Science.gov (United States)

Chinchilla, Misael; Valerio, Idalia; Sánchez, Ronald; Duszynski, Donald W

2017-02-01

Endogenous stages of the life cycle of Eimeria melanomytis, infecting the peripheral epithelial cells of villi of the small intestine of experimentally infected young dusky rice rats, Melanomys caliginosus , were studied. Giemsa-stained mucosal scrapings and histological sections were examined for all the stages. Eimeria melanomytis has 3 generations of meronts (M), different in size, shape, and number of merozoites (m); and in size, shape, and location of the nuclei within the cytoplasm of the meronts. The 3 meront types, M 1 -M 3 , respectively, had 11-14 (m 1 ), 7-10 (m 2 ), and 20-30 (m 3 ) merozoites. Macrogametocytes and microgametocytes, as well as macrogametes and microgametes, complete the sexual cycle forming the unsporulated oocysts. This parasite's endogenous development produced severe intestinal lesions in experimentally infected dusky rice rats.

Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.

Science.gov (United States)

Gonzalez-Benecke, C A; Martin, T A; Peter, G F

2010-03-01

Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

Muridae, Sigmodontinae

Indian Academy of Sciences (India)

patterns; eight of them (Aaz1, Aaz2, Aaz3, Aaz4, Aaz5,. Aaz6, Aaz8 and Aaz11) were ... Kalendar R. 2004 Fast PCR: PCR primer design, DNA and protein tools, repeat and own ... Published on the Web: 19 May 2011. Journal of Genetics, Vol.

Habitat use by Oryzomys subflavus (Rodentia) in an open shrubland formation in Restinga de Jurubatiba National Park, RJ, Brazil.

Science.gov (United States)

Bergallo, H G; Luz, J L; Raíces, D S; Hatano, F H; Martins-Hatano, F

2005-11-01

The Restinga de Jurubatiba has at least 10 plant formations, including open Clusia shrubland. This formation is composed of dense shrubs of many shapes and sizes, where Clusia hilariana is one of the most important plant species. Shrublands with Clusia (CC) are poorer in plant species and less dense than shrublands without Clusia (SC). Oryzomys subflavus (Rodentia) is the most abundant small mammal species in the open Clusia shrubland. We tested the hypothesis that the abundance of rodents would increase with the size of the patch and would be higher in SC shrublands. Rodents were captured, marked and released in three 780-m-long transects. At each capture site, we evaluated the shape of the shrubland patch, calculated the area and noted the category of the shrubland. Using ANCOVA, we ascertained whether the abundance of Oryzomys subflavus increased with the sampled area and used CC and SC shrublands differently. We also verified if the size of patches used by rodents varies in the same frequency as the size of available shrublands. Rodent abundance was found to increase significantly with the area. There were no differences in the size of the patches used by rodents and the frequency of the size of available patches. This finding indicates that O. subflavus, in the study area, is a generalist species that uses its habitat according to availability.

Habitat use by Oryzomys subflavus (Rodentia in an open shrubland formation in Restinga de Jurubatiba National Park, RJ, Brazil

Directory of Open Access Journals (Sweden)

H. G. Bergallo

Full Text Available The Restinga de Jurubatiba has at least 10 plant formations, including open Clusia shrubland. This formation is composed of dense shrubs of many shapes and sizes, where Clusia hilariana is one of the most important plant species. Shrublands with Clusia (CC are poorer in plant species and less dense than shrublands without Clusia (SC. Oryzomys subflavus (Rodentia is the most abundant small mammal species in the open Clusia shrubland. We tested the hypothesis that the abundance of rodents would increase with the size of the patch and would be higher in SC shrublands. Rodents were captured, marked and released in three 780-m-long transects. At each capture site, we evaluated the shape of the shrubland patch, calculated the area and noted the category of the shrubland. Using ANCOVA, we ascertained whether the abundance of Oryzomys subflavus increased with the sampled area and used CC and SC shrublands differently. We also verified if the size of patches used by rodents varies in the same frequency as the size of available shrublands. Rodent abundance was found to increase significantly with the area. There were no differences in the size of the patches used by rodents and the frequency of the size of available patches. This finding indicates that O. subflavus, in the study area, is a generalist species that uses its habitat according to availability.

Dos nuevas especies de Stilestrongylus (Nematoda: Heligmonellidae parásitos de peromyscus (Rodentia: Cricetidae de México

Directory of Open Access Journals (Sweden)

Jorge Falcón Ordaz

1999-12-01

Full Text Available Se describen dos especies nuevas del género Stilestrongylus Freitas, Lent & Almeida, 1937, parásitas de Peromyscus spp. (Rodentia: Cricetidae provenientes del Estado de Hidalgo, Mexico. Stilestrongylus peromysci n. sp. infecta a Peromyscus difficilis y se caracteriza por la presencia de 30 espínas en el synlophe para ambos sexos, así como por el nacimiento simétrico de los rayos 8 a partir de la raíz del rayo nueve. S. hidalguensis n. sp. parásita a Peromyscus sp., diferenciándose del resto de las especies congenéricas porque el macho presenta 24 espinas en el synlophe a nivel de la parte media del cuerpo y porque el arreglo de los rayos bursales es diferente en ambos lóbulos (2-2-1 derecho y 2-3 izquierdo. Se presenta una clave para la identificación de 18 de las 19 especies del género.Stilestrongylus peromysci n. sp. collected from Peromyscus difficilis (Hidalgo state, México, differs from other species in the genus in number of the spines (30 in the synlophe (both sexes and because the eigth ray arises from the root of the ninth ray; S. hidalguensis n. sp. parasited Peromyscus sp. and differs from all other congeneric species in the presence of 24 spines in the male synlophe and in the arrangement of the bursal rays (2-2-1 in the right lobe and 2-3 in the left lobe. A key to the species of Stilestrongylus is provided.

An evaluation of memory accuracy in food hoarding marsh tits Poecile palustris--how accurate are they compared to humans?

Science.gov (United States)

Brodin, Anders; Urhan, A Utku

2013-07-01

Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.

Postnatal ontogeny of limb proportions and functional indices in the subterranean rodent Ctenomys talarum (Rodentia: Ctenomyidae).

Science.gov (United States)

Echeverría, Alejandra Isabel; Becerra, Federico; Vassallo, Aldo Iván

2014-08-01

Burrow construction in the subterranean Ctenomys talarum (Rodentia: Ctenomyidae) primarily occurs by scratch-digging. In this study, we compared the limbs of an ontogenetic series of C. talarum to identify variation in bony elements related to fossorial habits using a morphometrical and biomechanical approach. Diameters and functional lengths of long bones were measured and 10 functional indices were constructed. We found that limb proportions of C. talarum undergo significant changes throughout postnatal ontogeny, and no significant differences between sexes were observed. Five of six forelimb indices and two of four hindlimb indices showed differences between ages. According to discriminant analysis, the indices that contributed most to discrimination among age groups were robustness of the humerus and ulna, relative epicondylar width, crural and brachial indices, and index of fossorial ability (IFA). Particularly, pups could be differentiated from juveniles and adults by more robust humeri and ulnae, wider epicondyles, longer middle limb elements, and a proportionally shorter olecranon. Greater robustness indicated a possible compensation for lower bone stiffness while wider epicondyles may be associated to improved effective forces in those muscles that originate onto them, compensating the lower muscular development. The gradual increase in the IFA suggested a gradual enhancement in the scratch-digging performance due to an improvement in the mechanical advantage of forearm extensors. Middle limb indices were higher in pups than in juveniles-adults, reflecting relatively more gracile limbs in their middle segments, which is in accordance with their incipient fossorial ability. In sum, our results show that in C. talarum some scratch-digging adaptations are already present during early postnatal ontogeny, which suggests that they are prenatally shaped, and other traits develop progressively. The role of early digging behavior as a factor influencing on

Genética poblacional de cobayas de Colombia, Cavia spp. (Rodentia: Caviidae con marcadores moleculares RAPD

Directory of Open Access Journals (Sweden)

Héctor Aníbal Campos

2008-09-01

Full Text Available En el presente estudio, mostramos los primeros resultados moleculares de formas colombianas de Cavia. Claramente, la población silvestre de C. anolaimae fue genéticamente diferenciada de la forma doméstica, C. porcellus, tal como ha sido demostrado por otros autores utilizando resultados morfométricos, osteológicos y cariotípicos. Ambas especies mostraron un considerable nivel de diversidad genética, aunque el segundo taxon mostró niveles mayores de esta diversidad. Los niveles de heterogeneidad genética también fueron mayores entre las poblaciones de C. porcellus (F ST = 0.254 que entre las poblaciones de C. anolaimae (F ST = 0.118. Esos niveles significativos de heterogeneidad genética, y los consiguientes bajos niveles de flujo génico, fueron discutidos comparativamente con los resultados por otros autores analizando otros marcadores moleculares (citocromo-b mitocondrial. Los resultados aquí mostrados son coherentes con un complejo proceso de domesticación en Cavia porcellus.Population genetics of Colombian Guinea Pigs, Cavia spp. (Rodentia: Caviidae with RAPD molecular markers. The genus Cavia occurs in South America, mainly in grasslands.. We collected blood samples from 97 individuals in six field populations and analyzed them with RAPD molecular markers. One wild type (C. anolaimae was differentiated from the domestic form (C. porcellus, in agreement with other authors who used morphological, osteological and karyotipic results. Genetic diversity was considerable in both species, but higher in C. porcellus. The levels of genetic heterogeneity were also higher among the populations of C. porcellus (F ST = 0.254 than among the populations of C. anolaimae (F ST = 0.118. These significant levels of genetic heterogeneity, and the low levels of gene flow, were consistent with a complex domestication process for Cavia porcellus. Rev. Biol. Trop. 56 (3: 1481-1501. Epub 2008 September 30.

Sulfide Generated by Sulfate Reduction is a Primary Controller of the Occurrence of Wild Rice (Zizania palustris) in Shallow Aquatic Ecosystems

Science.gov (United States)

Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.

2017-11-01

Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.

A novel electrophototrophic bacterium Rhodopseudomonas palustris strain RP2, exhibits hydrocarbonoclastic potential in anaerobic environments

Directory of Open Access Journals (Sweden)

Krishnaveni Venkidusamy

2016-07-01

Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.

Kocuria palustris sp. nov. and Kocuria rhizophila sp. nov., isolated from the rhizoplane of the narrow-leaved cattail (Typha angustifolia).

Science.gov (United States)

Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K

1999-01-01

Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.

High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-Glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae).

Science.gov (United States)

Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan

2015-08-01

Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.

Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition.

Science.gov (United States)

Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen

2009-09-02

Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

Actividad ovárica del tepezcuintle Agouti paca (Rodentia: Agoutidae en cautiverio

Directory of Open Access Journals (Sweden)

Rubén C Montes Pérez

2006-09-01

Full Text Available Se caracterizó la actividad ovárica de A. paca por medio de perfiles hormonales y estructuras ováricas. Se muestrearon ocho hembras (siete adultas y una juvenil en el criadero de la Facultad de Medicina Veterinaria y Zootecnia en el estado de Yucatán, México, durante aproximadamente dos meses. Se recolectaron muestras sanguíneas cada 3 y 6 días en animales anestesiados. Se estimaron los niveles de progesterona (P4 y 17 β estradiol (E2 sanguνneos por radioinmunoanαlisis. Las estructuras ováricas de animales muertos durante el periodo de muestreo fueron analizadas macro y microscópicamente. El ciclo ovárico duró 29±8.4 días, con niveles de 1.61±0.65 ng/ml para P4 y de 39±24 pg/ml para E2 durante la fase folicular, y de 6.18±3.70 ng/ml y 29±16 pg/ml para P4 y E2 respectivamente, en la fase luteal. Hubo diferencias (pOvarian activity of Agouti paca (Rodentia: Agoutidae under captivity. The ovarian activity of Agouti paca was characterized by hormonal profiles and ovarian structures. Samples of blood were taken from eight females (seven adults and one juvenile at the breeding grounds of the Facultad de Medicina Veterinaria y Zootecnia in Yucatán, México. Sampling lasted approximately two months and was done every three and six days. Blood was collected from anesthetized animals, and the levels of progesterone (P4 and 17 β estradiol (E2 were analized by radioimmunoassay technique. Macroscopic and microscopic analyses were carried out in ovaries of dead animals. The estrous cycle lasted 29±8.4 days, levels of 1.61±0.65 ng/ml for P4 and 39±24 pg/ml for E2 were observed for a follicular phase, 6.18±3.70 ng/ml and 29±16 pg/ml for P4 and E2 respectively in the luteal phase. Statistically significant differences were found between phases for P4 but not for E2. The presence of extragonadal steroids with levels of P4 of 1.9±0.77 ng/ml and E2 of 22±17 pg/ml were observed, which are not produced by the effects of managing stress

Differentiation of epipactis palustris (l.) crantz (orchidaceae) in habitats altered by man based on species populations within poznan city (poland)

International Nuclear Information System (INIS)

Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.

2017-01-01

The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)

How many species of mammals are there in Brazil? New records of rare rodents (Rodentia: Cricetidae: Sigmodontinae from Amazonia raise the current known diversity

Directory of Open Access Journals (Sweden)

Alexandre R. Percequillo

2017-12-01

Full Text Available Background Since 1996, when Vivo questioned how many species of mammals occur in Brazil, there has been a huge effort to assess this biodiversity. In this contribution, we present new records for rare species of the sigmodontine rodent genera Rhagomys and Neusticomys previously unknown to Brazilian Amazon. We provided detailed information on the morphologic variation to allow the proper identification of these species. We also furnished updated information on their collection, aiming to establish hypothesis of their geographic distribution, based on SDM’s, aiming to hypothesize potential occurrence areas for these species. Methods Rodent specimens were sampled in separate inventories in two sites of Rondônia State (Hydroelectric Dam Jirau and Parque Nacional de Pacaás Novos and one site in Pará State (Pacajá, Brazil, and were compared to specimens from museum collections to apply appropriate names. The SDM were conducted using two algorithms for rare species, MaxEnt and randomForest (RF, and were based on seven localities for Rhagomys, and 10 for Neusticomys. Results All specimens were collected with pitfall traps. One specimen of genus Rhagomys was trapped in the Hydroelectric Dam Jirau. We identified this specimen as R. longilingua, and the SDM species indicates suitable areas for its occurrence at high elevations near on the Andes and lowlands of Amazon Basin to the South of the Rio Amazonas. Two specimens of Neusticomys were recorded, and we identified the specimen from Pacaás Novos as N. peruviensis, with SDM suggesting main areas of occurrence on Western Amazon. We applied the name N. ferreirai to the specimen from Pacajá, with SDM recovering suitable areas in Eastern Amazon. Discussion We reinforced the importance of pitfall traps on the study of Neotropical rodents. We described morphologic variation within and among all species that do not invalidate their specific status, but in the near future a re-evaluation will be mandatory. The new records extended the species distribution considerably. SDM was successful to predict their distributions, as the two algorithms presented important differences in range size recovered by the models that can be explained by differences in the thresholds used for the construction of the models. Most suitable areas coincide with the areas facing most of the deforestation in Amazon. We added two rare species of sigmodontine rodents to the list of Brazilian Mammals, which now comprises 722 species (or 775 valid nominal taxa. Although more information is available than in 1996, it is essential that mammal experts maintain inventory and revisionary programs to update and revise this information. This is even more important, as changes in Brazilian environmental legislation are being discussed, suggesting reduced need for environmental impact reports prior to beginning commercial enterprises, resulting in the loss of information about native biodiversity in the affected areas.

Intense genomic reorganization in the genus Oecomys (Rodentia, Sigmodontinae): comparison between DNA barcoding and mapping of repetitive elements in three species of the Brazilian Amazon.

Science.gov (United States)

Gomes Júnior, Renan Gabriel; Schneider, Carlos Henrique; de Lira, Thatianna; Carvalho, Natália Dayane Moura; Feldberg, Eliana; da Silva, Maria Nazareth Ferreira; Gross, Maria Claudia

2016-01-01

Oecomys Thomas, 1906 is one of the most diverse and widely distributed genera within the tribe Oryzomyini. At least sixteen species in this genus have been described to date, but it is believed this genus contains undescribed species. Morphological, molecular and cytogenetic study has revealed an uncertain taxonomic status for several Oecomys species, suggesting the presence of a complex of species. The present work had the goal of contributing to the genetic characterization of the genus Oecomys in the Brazilian Amazon. Thirty specimens were collected from four locations in the Brazilian Amazon and three nominal species recognized: Oecomys auyantepui (Tate, 1939), Oecomys bicolor (Tomes, 1860) and Oecomys rutilus (Anthony, 1921). COI sequence analysis grouped Oecomys auyantepui , Oecomys bicolor and Oecomys rutilus specimens into one, three and two clades, respectively, which is consistent with their geographic distribution. Cytogenetic data for Oecomys auyantepui revealed the sympatric occurrence of two different diploid numbers, 2n=64/NFa=110 and 2n=66/NFa=114, suggesting polymorphism while Oecomys bicolor exhibited 2n=80/NFa=142 and Oecomys rutilus 2n=54/NFa=90. The distribution of constitutive heterochromatin followed a species-specific pattern. Interspecific variation was evident in the chromosomal location and number of 18S rDNA loci. However, not all loci showed signs of activity. All three species displayed a similar pattern for 5S rDNA, with only one pair carrying this locus. Interstitial telomeric sites were found only in Oecomys auyantepui . The data presented in this work reinforce intra- and interspecific variations observed in the diploid number of Oecomys species and indicate that chromosomal rearrangements have led to the appearance of different diploid numbers and karyotypic formulas.

Intense genomic reorganization in the genus Oecomys (Rodentia, Sigmodontinae: comparison between DNA barcoding and mapping of repetitive elements in three species of the Brazilian Amazon

Directory of Open Access Journals (Sweden)

Renan Gabriel Gomes Junior

2016-09-01

Full Text Available Oecomys Thomas, 1906 is one of the most diverse and widely distributed genera within the tribe Oryzomyini. At least sixteen species in this genus have been described to date, but it is believed this genus contains undescribed species. Morphological, molecular and cytogenetic study has revealed an uncertain taxonomic status for several Oecomys species, suggesting the presence of a complex of species. The present work had the goal of contributing to the genetic characterization of the genus Oecomys in the Brazilian Amazon. Thirty specimens were collected from four locations in the Brazilian Amazon and three nominal species recognized: Oecomys auyantepui (Tate, 1939, O. bicolor (Tomes, 1860 and O. rutilus (Anthony, 1921. COI sequence analysis grouped O. auyantepui, O. bicolor and O. rutilus specimens into one, three and two clades, respectively, which is consistent with their geographic distribution. Cytogenetic data for O. auyantepui revealed the sympatric occurrence of two different diploid numbers, 2n=64/NFa=110 and 2n=66/NFa=114, suggesting polymorphism while O. bicolor exhibited 2n=80/NFa=142 and O. rutilus 2n=54/NFa=90. The distribution of constitutive heterochromatin followed a species-specific pattern. Interspecific variation was evident in the chromosomal location and number of 18S rDNA loci. However, not all loci showed signs of activity. All three species displayed a similar pattern for 5S rDNA, with only one pair carrying this locus. Interstitial telomeric sites were found only in O. auyantepui. The data presented in this work reinforce intra- and interspecific variations observed in the diploid number of Oecomys species and indicate that chromosomal rearrangements have led to the appearance of different diploid numbers and karyotypic formulas.

Genome Assembly of the Fungus Cochliobolus miyabeanus, and Transcriptome Analysis during Early Stages of Infection on American Wildrice (Zizania palustris L..

Directory of Open Access Journals (Sweden)

Claudia V Castell-Miller

Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.

Hydrogen photo-evolution by Rhodopseudomonas palustris 6A using pre-treated olive mill wastewater and a synthetic medium containing sugars

International Nuclear Information System (INIS)

Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro

2015-01-01

Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)

Anaerobic p-coumarate degradation by Rhodopseudomonas palustris and identification of CouR, a MarR repressor protein that binds p-coumaroyl coenzyme A.

Science.gov (United States)

Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S

2012-04-01

The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.

Rare, threatened and relict species in flora of SNR Zasavica

Directory of Open Access Journals (Sweden)

Stanković, M.

2011-09-01

Full Text Available In group of biodiversity important plant species there are 23 taxa. 20 taxa are mentioned in „Preliminary Red List of flora of Serbia and Montenegro with IUCN 2001 Conservation Statuses“ in following categories: two as critically endangered (Aldrovanda vesiculosa L. and Hottonia palustris L., four as endangered (Hippuris vulgaris L., Lindernia palustris Hartm., Ranunculus lingua L. and Urtica kioviensis Rogow., five as vulnerable (Achillea aspleniifolia Vent., Dryopteris carthusiana (Vill. H. P. Fuchs, Leucojum aestivum L. subsp. aestivum, Stratiotes aloides L. and Thelypteris palustris (Schott subsp.palustris, while 9 are with indefinite categories (CR-VU, due to data deficient (DD. Special Nature Reserve „Zasavica“ is the only habitat in Serbia for Aldrovanda vesiculosa L., which was until 2005. considered as extinct from Serbia.

Functional differentiation of trailing and leading forelimbs during locomotion on the ground and on a horizontal branch in the European red squirrel (Sciurus vulgaris, Rodentia).

Science.gov (United States)

Schmidt, André

2011-06-01

Mammalian locomotion is characterized by the frequent use of in-phase gaits in which the footfalls of the left and right fore- or hindlimbs are unevenly spaced in time. Although previous studies have identified a functional differentiation between the first limb (trailing limb) and the second limb (leading limb) to touch the ground during terrestrial locomotion, the influence of a horizontal branch on limb function has never been explored. To determine the functional differences between trailing and leading forelimbs during locomotion on the ground and on a horizontal branch, X-ray motion analysis and force measurements were carried out in two European red squirrels (Sciurus vulgaris, Rodentia). The differences observed between trailing and leading forelimbs were minimal during terrestrial locomotion, where both limbs fulfill two functions and go through a shock-absorbing phase followed by a generating phase. During locomotion on a horizontal branch, European red squirrels reduce speed and all substrate reaction forces transmitted may be due to the reduction of vertical oscillation of the center of mass. Further adjustments during locomotion on a horizontal branch differ significantly between trailing and leading forelimbs and include limb flexion, lead intervals, limb protraction and vertical displacement of the scapular pivot. Consequently, trailing and leading forelimbs perform different functions. Trailing forelimbs function primarily as shock-absorbing elements, whereas leading forelimbs are characterized by a high level of stiffness. This functional differentiation indicates that European red squirrels 'test' the substrate for stability with the trailing forelimb, while the leading forelimb responds to or counteracts swinging or snapping branches. Copyright © 2011 Elsevier GmbH. All rights reserved.

Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions.

Science.gov (United States)

Xu, J; Feng, Y; Wang, Y; Lin, X

2013-11-01

As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.

Estructura genética de un grupo de capibaras, Hydrochoerus hydrochaeris (Rodentia: Hydrocheridae en los Llanos orientales colombianos

Directory of Open Access Journals (Sweden)

Adriana Maldonado-Chaparro

2011-12-01

Full Text Available Los capibaras son los roedores más grandes del mundo, sin embargo, no se han realizado estudios genético poblacionales exhaustivos con ellos. En el presente trabajo se analizó la estructura genética de una manada de 31 capibaras (Hydrochoerus hydrochaeris muestreada en Hato Corozal, Departamento de Casanare en los Llanos Orientales de Colombia, mediante cinco marcadores microsatelitales. La diversidad genética se determinó en 0.61 y un número promedio de alelos de 5.2, lo cual se puede considerar medio-bajo para este tipo de marcadores. De los cinco marcadores empleados, tres mostraron proporciones genotípicas en concordancia con lo esperado en equilibrio Hardy-Weinberg, mientras que un marcador mostró un exceso significativo de homocigotos y otro un exceso significativo de heterocigotos. No se encontraron diferencias significativas para esos cinco marcadores entre machos y hembras de la manada muestreada. La aplicación de diferentes procedimientos para detectar posibles cambios demográficos históricos (expansiones poblacionales o cuellos de botella mostró claramente que la población analizada ha pasado por un cuello de botella extremadamente fuerte en épocas recientes. La limitada variabilidad genética encontrada y la fuerte evidencia de que la manada estudiada ha pasado por un cuello de botella reciente es probablemente el resultado de la cacería ilegal.Genetic structure of a group of capybaras, Hydrochoerus hydrochaeris (Rodentia: Hydrocheridae in the Colombian Eastern Llanos. The capybaras are the biggest rodents in the world but, however, there are not extensive population genetics studies on them. In the current work, we studied the genetic structure of a troop of 31 capybaras (Hydrochoerus hydrochaeris sampled in Hato Corozal, Casanare Department at the Colombian Eastern Llanos, by means of five microsatellite markers. The gene diversity was 0.61 and the average allele number was 5.2, which is a medium-low level for

Experimental evidence and ecological perspectives for the adaptation of Schistosoma mansoni Sambon, 1907 (Digenea: Schistosomatidae to a wild host, the water-rat, Nectomys squamipes Brants, 1827 (Rodentia: Sigmodontinae

Directory of Open Access Journals (Sweden)

Paulo Sérgio D'Andrea

2002-10-01

Full Text Available Due to the semi aquatic habits and the overlap of the geographical distribution of the water-rat, Nectomys spp., with schistosomiasis endemic areas, these wild rodents are very likely to acquire Schistosoma mansoni infection in their daily activities. The role of the water-rat in the S. mansoni cycle would be substantiated if one could prove that these rodents acquire the parasite during their own activity time, a completely independent time schedule of human activities. To pursue this goal, we performed two field experiments in the municipality of Sumidouro, State of Rio de Janeiro, Brazil, a schistosomiasis endemic area where N. squamipes is found naturally infected. One experiment was devised as a series of observations of activity time of the water-rat. The other experiment was a test of the occurrence of late transmission of S. mansoni to the water-rat. The daily activity pattern showed that the water-rat is active chiefly just after sunset. At both diurnal and late exposition essays the water-rat sentinels got infected by S. mansoni. These findings clarify ecological and behavioral components necessary to the adaptation of S. mansoni to the water-rat as a non human definitive host and the existence of a transmission cycle involving this animals as a reservoir.

Scheuchzeria palustris L

Czech Academy of Sciences Publication Activity Database

Šída, O.; Štěpánková, Jitka

2015-01-01

Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics

In Situ Dark Adaptation Enhances the Efficiency of DNA Extraction from Mature Pin Oak (Quercus palustris Leaves, Facilitating the Identification of Partial Sequences of the 18S rRNA and Isoprene Synthase (IspS Genes

Directory of Open Access Journals (Sweden)

Csengele E. Barta

2017-10-01

Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.

Method of releasing and number of animals are determinants for the success of European ground squirrel (Spermophilus citellus) reintroductions

Czech Academy of Sciences Publication Activity Database

Matějů, J.; Říčanová, Štěpánka; Poláková, S.; Ambros, M.; Kala, B.; Matějů, K.; Kratochvíl, L.

2012-01-01

Roč. 58, č. 2 (2012), s. 473-482 ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Translocation * Endangered species * Rodentia Subject RIV: EH - Ecology, Behaviour Impact factor: 1.355, year: 2012

City of Freeport, Florida, State Road 20 Water Main Installation, Final Environmental Assessment, Eglin Air Force Base, Florida

Science.gov (United States)

2010-07-01

If contamination, drought or natural disaster, such as a hurricane, impacted one water supply, an interconnection with neighboring municipalities...Scientific Name Sandhills Ecological Association Longleaf Pine Pinus palustris Red-cockaded Woodpecker Picoides borealis Turkey Oak Quercus laevis...canadensis Flatwoods Ecological Association Longleaf Pine Pinus palustris Wood Duck Aix sponsa Runner Oak Quercus pumila Red-winged Blackbird Agelaius

rodentia: sciuridae

African Journals Online (AJOL)

it is apparently not an efficient vector of plague. Sucking lice. The sucking louse, Neohoematopinw heliosciuri has been found on the African tree squinels. Heliosciurus rufobrachium. Funisciurus anerythrus and Paraxerus boehmi em;"i by Rahm (19~2). and. Ledger (1976) additionally records these lice from. Paraxerus ...

RODENTIA: MURIDAE

African Journals Online (AJOL)

size of 4.7 and the rapid postnatal development are thought to be ..... the sand in the cage was fairly shallow, i.e. to mm, ZelolOmys did show that it was ... shredded, and a deep cup-shaped nest made by the female pushing her head ..... Most of our data on numbers and developmental time can be interpreted in the frame-.

(RODENTIA: SCIURIDAE).

African Journals Online (AJOL)

DOBRORUKA, L J 1970. Behaviour in the bush squirrel, Paraxerus cepapi (A Smith, 1836). Revue Zoo I. Bot. afro 82: 131-141. GUNTER, G cl ELEUTERIUS, L 1971. Bark-eating by the common gray squirrel following a hurricane. Am. Midi. Nat. 85:23S. NIXON, C M 1970. Insects as food for juvenile gray squirrels. Am. Midi.

Seasonal variation in plasma and corpus luteum oestradiol.17[3and ...

African Journals Online (AJOL)

Flemming 1993) and, in males, with circulating sex steroid concentrations ..... biology of the Cape mole-rat, Georychus capensis (Rodentia. Bathycrgidac), j, Zool" ... brain. and behavior: an emerging discipline in herpetology. In: Biology of the ...

Las Haloragaceae de Cuba

Directory of Open Access Journals (Sweden)

Betancourt Gandul, Martha

1999-12-01

Full Text Available A study of the Haloragaceae in Cuba is presented. The presence of Proserpinaca palustris, P. pectinata. Myriophyllum laxum and M. pinnatum is confirmed, and the possible extinction of M. sparsiflorum is suggestedEstudio de la familia Haloragaceae en Cuba. Se confirma la existencia de Proserpinaca palustris, P. pectinata. Myriophyllum laxum y M, pinnatum, y se plantea la posible extinción de M. sparsiflorum.

Reticulate Pleistocene evolution of Ethiopian rodent genus along remarkable altitudinal gradient

Czech Academy of Sciences Publication Activity Database

Bryja, Josef; Kostin, D.; Meheretu, Y.; Šumbera, R.; Bryjová, Anna; Kasso, M.; Mikula, Ondřej; Lavrenchenko, L. A.

2018-01-01

Roč. 118, January (2018), s. 75-87 ISSN 1055-7903 Institutional support: RVO:68081766 Keywords : Stenocephalemys * mitochondrial introgression * Ethiopian highlands * Rodentia * ecological speciation * Great Rift Valley Subject RIV: EG - Zoology Impact factor: 4.419, year: 2016

Known from a handful of specimens: analyzing the worldwide patterns of occurrence and conservation of rodents and shrews recorded only from the type locality

Directory of Open Access Journals (Sweden)

Giovanni Amori

2016-03-01

Full Text Available Traditionally, conservation research has not focused on Rodentia and Soricomorpha, and many species are known from a handful of specimens and the type locality only (few and type locality species (FETP.  Here we studied the patterns of occurrence of FETP rodents and soricomorphs in relation to geographical area and vegetation zones and report some conservation considerations.  Overall, 91 species of Rodentia and 19 species of Soricomorpha were selected.  There was a positive correlation between number of species per genus and number of FETP species in each genus.  The majority of FETP rodents occur in the Neotropical, Afrotropical and Oriental regions, and soricomorphs in the Afrotropical and Oriental regions. Higher numbers of FETP rodent species occurred in Argentina and Indonesia.  There was a positive relationship between species richness of rodents per country and number of FETP species.  In terms of habitat type, FETP species of rodents and soricomorphs showed similar patterns, with most species being found in rainforest.  The great majority of selected species of both groups were Data Deficient (DD, with Critically Endangered (CR accounting for 16.5% of Rodentia and 5.3% of Soricomorpha.  Overall, IUCN threatened species mostly occur in the Neotropical region, followed by the Afrotropical region.  It is urged that IUCN authorities should promptly revise all FETP species and their precautionary CR status, at least when a reasonable timespan (i.e., >25 years has passed since the last records. 

Distribution of the common hamster in the Czech Republic after 2000: retreating to optimum lowland habitats

Czech Academy of Sciences Publication Activity Database

Tkadlec, Emil; Heroldová, Marta; Víšková, V.; Bednář, M.; Zejda, Jan

2012-01-01

Roč. 61, 3-4 (2012), s. 246-253 ISSN 0139-7893 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Cricetus cricetus * questionnaire * Rodentia Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

Distribution patterns of terrestrial mammals in KwaZulu-Natal

African Journals Online (AJOL)

Hluhluwe-Umfolozi Park, Itala Game Reserve), the numbers of mammal species recorded .... Chiroptera and Rodentia, cannot be explained by the level of sampling, and .... generated data. A count of the ...... radarida aI/sorge;. Tmiarida condY/ ...

Relating appendicular skeletal variation of sigmodontine rodents to locomotion modes in a phylogenetic context.

Science.gov (United States)

Carvalho Coutinho, Ludmilla; Alves de Oliveira, João

2017-10-01

Sigmodontinae rodents constitute the second-largest subfamily among mammals. Alongside the taxonomic diversity, they are also ecologically diverse, exhibiting a wide array of locomotion modes, with semifossorial, terrestrial, semiaquatic, scansorial, arboreal, and saltatorial forms. To understand the ecomorphologic aspects that allow these rodents to display such locomotion diversity, we analyzed 35 qualitative characters of the appendicular skeleton (humerus, ulna, radius, scapula, femur, tibia, ilium, ischium and pubis) in 795 specimens belonging to 64 species, 34 genera and 10 tribes, representing all locomotion modes assigned to this subfamily. We performed a statistical analysis based upon the coefficient of trait differentiation to test the congruence of character states and the different locomotion modes. We also mapped characters states in a molecular phylogeny in order to reconstruct ancestral states and to evaluate how appendicular characters evolved within main lineages of Sigmodontinae radiation under a phylogenetic framework. The statistical analyses revealed six characters related to specific locomotion modes, except terrestrial. The mapping and parsimony ancestral states reconstruction identified two characters with phylogenetical signal and eight characters that are exclusively or more frequently recorded in certain modes of locomotion, four of them also detected by the statistical analysis. Notwithstanding the documented morphological variation, few changes characterize the transition to each of the locomotion modes, at least regarding the appendicular skeleton. This finding corroborates previous results that showed that sigmodontines exhibit an all-purpose appendicular morphology that allows them to use and explore a great variety of habitats. © 2017 Anatomical Society.

Fort Bragg Old Post Historic District Landscape Report

Science.gov (United States)

2011-01-01

proved to be of substantial economic value (Lefler and Powell 1973). Lon- gleaf pines ( Pinus palustris) produce higher quality pine resin/crude gum than...plants that have the same characteristics as the historic varieties; na- tive plants require relatively little upkeep, are drought tolerant, and can... Pinus palustris Longleaf Pine 1933/IDG 2009 Native Quercus alba White Oak Large Evergreen Trees 1933/IDG 2009 Native Magnolia grandiflora Southern

Further support for a palaearctic origin of Leishmania

Directory of Open Access Journals (Sweden)

Sara F Kerr

2000-08-01

Full Text Available The fossil record and systematics of murid rodents, reservoirs of zoonotic cutaneous leishmaniasis in the Palaearctic, Oriental, African, Nearctic and Neotropical, strongly support a Palaearctic origin of Leishmania. The fossil record and systematics of phlebotomine sand flies reinforce this idea. Interpretations of molecular data that place the origin of Leishmania in the Neotropical are inconsistent with the natural histories of reservoirs and vectors. The evolutionary pattern of New World rats (Sigmodontinae indicates that they may be the most important reservoirs of zoonotic cutaneous leishmaniasis throughout their range.

Measured and modelled leaf and stand-scale productivity across a soil moisture gradient and a severe drought.

Science.gov (United States)

Wright, J K; Williams, M; Starr, G; McGee, J; Mitchell, R J

2013-02-01

Environmental controls on carbon dynamics operate at a range of interacting scales from the leaf to landscape. The key questions of this study addressed the influence of water and nitrogen (N) availability on Pinus palustris (Mill.) physiology and primary productivity across leaf and canopy scales, linking the soil-plant-atmosphere (SPA) model to leaf and stand-scale flux and leaf trait/canopy data. We present previously unreported ecophysiological parameters (e.g. V(cmax) and J(max)) for P. palustris and the first modelled estimates of its annual gross primary productivity (GPP) across xeric and mesic sites and under extreme drought. Annual mesic site P. palustris GPP was ∼23% greater than at the xeric site. However, at the leaf level, xeric trees had higher net photosynthetic rates, and water and light use efficiency. At the canopy scale, GPP was limited by light interception (canopy level), but co-limited by nitrogen and water at the leaf level. Contrary to expectations, the impacts of an intense growing season drought were greater at the mesic site. Modelling indicated a 10% greater decrease in mesic GPP compared with the xeric site. Xeric P. palustris trees exhibited drought-tolerant behaviour that contrasted with mesic trees' drought-avoidance behaviour. © 2012 Blackwell Publishing Ltd.

Isolation and characterization of microsatellites in Rattus rattus

Czech Academy of Sciences Publication Activity Database

Loiseau, A.; Rahelinirina, S.; Rahalison, L.; Konečný, Adam; Duplantier, J.-M.; Brouat, C.

2008-01-01

Roč. 8, č. 4 (2008), s. 916-918 ISSN 1755-098X R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : genetic diversity * microsatellite * Rattus rattus * Rodentia Subject RIV: EB - Genetics ; Molecular Biology

Juvenile dispersal in Calomys venustus (Muridae: Sigmodontinae)

Science.gov (United States)

Priotto, José; Steinmann, Andrea; Provensal, Cecilia; Polop, Jaime

2004-05-01

Both spacing behaviour and dispersal movement are viewed as hierarchical processes in which the effects may be expressed at spatial scale. This research was carried out to examine the hypothesis that the presence of parents promotes the dispersal of juveniles from their natal nest and their father or mother home-range, in Calomys venustus.The study was carried out in four 0.25 ha fences (two controls and two experimentals), in a natural pasture. This study had two periods: Father Removal (FR) (August and December 1997; year one) and Mother Removal (MR) (August 1998 and January 1999; year two). For the FR treatment fathers were removed after juveniles were born, but in the MR treatment mothers were removed after the juveniles were weaned. The effect of parents on the dispersal distance of juveniles was analysed with respect to their natal nest and their mother and father home-range. Dispersal distance from the nest of C. venustus was independent of either male or female parent. Juveniles were more dispersing in relation to the centre of activity of their mothers than to that of their fathers, and females were more dispersing than males. Female juveniles overlap their home-range with their parents less than male juveniles do. The differences observed between female and male juveniles would be related to their different sexual maturation times, as well as to the female territoriality.

A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA.

Science.gov (United States)

Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

2014-12-01

Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

The Aragonian and Vallesian high-resolution micromammal succession from the Calatayud-Montalbán Basin (Aragón, Spain)

NARCIS (Netherlands)

García-Paredes, Israel; Álvarez-Sierra, María Ángeles; Van den Hoek Ostende, Lars W.; Hernández-Ballarín, Verónica; Hordijk, Kees; López-Guerrero, Paloma; Oliver, Adriana; Peláez-Campomanes, Pablo

We present an updated taxonomy and faunal distribution of the micromammal fossil record from the Aragonian and Lower Vallesian of the Calatayud-Montalbán Basin. The analysed record includes the orders Rodentia, Eulipotyphla, and Lagomorpha. The pattern of species turnover shows seven major faunal

Spiny mice of the Zambezian bioregion – phylogeny, biogeography and ecological differentiation within the Acomys spinosissimus complex

Czech Academy of Sciences Publication Activity Database

Petružela, Jan; Šumbera, R.; Aghová, Tatiana; Bryjová, Anna; Katakweba, A. S.; Sabuni, C. A.; Chitaukali, W. N.; Bryja, Josef

2018-01-01

Roč. 91, July (2018), s. 79-90 ISSN 1616-5047 R&D Projects: GA ČR GA15-20229S Institutional support: RVO:68081766 Keywords : phylogeography * Plio-Pleistocene climate change * Rodentia * savannah * tropical Africa Subject RIV: EG - Zoology Impact factor: 1.429, year: 2016

Spot-on Treatments of Diflubenzuron and Permethrin to Control a Guinea Pig Louse, Gliricola Porcelli (Phthiraptera: Gyropidae)

Science.gov (United States)

Guinea pigs (Cavia porcellus (L.)) (Rodentia: Caviidae) are pets and laboratory animals. They can be infested by a chewing louse, Gliricola porcelli (Schrank) (Phthiraptera: Gyropidae), which is fairly common in some animal rearing facilities, pet stores, and on wild guinea pigs. Infestation with G....

Rodentia and lagomorpha

Science.gov (United States)

Sheffield, S.R.; Sawicka-Kapusta, K.; Cohen, J.B.; Rattner, B.A.; Shore, Richard F.; Rattner, Barnett A.

2001-01-01

This comprehensive review examines the extensive literature on wild rodents and lagomorphs as biomonitors of environmental contamination. This chapter covers studies dealing with exposure and effects of environmental contaminants on rodent and lagomorph species, including pesticides (organochlorines, organophosphorus and carbamate compounds, herbicides, plant growth regulators, fungicides, and rodenticides), other organic chemicals, metals, radionuclides, and other miscellaneous contaminants. Many research needs become evident when reviewing ecotoxicological data for rodents and lagomorphs, the most striking being the paucity of information on rodent families other than Muridae (mice and rats). While our ability to qualitatively extrapolate effects observed in laboratory studies to field situations is good for a variety of contaminants, quantitative predictions of dose-response relationships are poor because inter-specific variation and differences in exposure patterns between laboratory and wild species to toxicants are for the most part unknown. More sophisticated comparative toxicity studies need to be undertaken that build on previous work in order to develop a database of information, to account for and model differences in exposure pathways, to document interactions among multiple stressors, to generate data establishing thresholds, critical concentrations, and diagnostic guidelines, and even to develop physiologically-based toxicokinetic models. Such efforts may enhance our ability to predict effects on wild populations, including threatened and endangered species.

natalensis (Muridae: Rodentia)

African Journals Online (AJOL)

2011-04-07

Apr 7, 2011 ... Mastomys natalensis, the multimammate mouse, was live-trapped on six grids varying in vegetative cover and ... induced cotton rats to occupy open patches which. without ... The presenL study was designed to test experimentally the ..... Swanepoel 1980; Monadjem 1997b) and insects (Field 1975).

Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

Czech Academy of Sciences Publication Activity Database

Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

2017-01-01

Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 4.248, year: 2016

Towards conserving regional mammalian species diversity: a case ...

African Journals Online (AJOL)

1995-03-03

Mar 3, 1995 ... Species richness maps were derived for the Transvaal region from two different databases, namely a primary point database based on ... of biological diversity is internationally supported, there is no agreement on the ..... example is that of the Rodentia. where greatest species diver- sity. based on survey ...

Ontogenesis peculiarities species of genus Rorippa Scopoli (Cruciferae in the subzone of the southern taiga

Directory of Open Access Journals (Sweden)

Svetlana Shabalkina

2014-04-01

Full Text Available Latent, pregenerative and generative periods in the ontogeny of Rorippa amphibia (L. Bess., R. palustris (L. Bess. and R. ×anceps (Wahlenb. Reichenb. were described. Skipping of a postgenerative stage, and some of ontogenetic states demonstrates the dynamic multiplicity of individual development; while the combination of seed and vegetative reproductions – multiplicity of the ways of reproduction and generation. The ontogeny of R. palustris individuals corresponds to A-type, R. amphibia and R. ×anceps – to G-type, and R. ×anceps – to D-type.

Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

Energy Technology Data Exchange (ETDEWEB)

Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)

2015-12-01

The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO₂ fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

First documented record of Holochilus brasiliensis (Desmarest, 1819 and Calomys laucha (G. Fischer, 1814 in the state of Santa Catarina, south Brazil

Directory of Open Access Journals (Sweden)

Felipe Bortolotto Peters

2013-09-01

Full Text Available Studies on the richness of small mammals in the Brazilian South Region are recent and point out the need for using varied methods. This way, this paper contributes to knowledge on the fauna of small sigmodontinae rodents in Santa Catarina, including Holochilus brasiliensis and Calomys laucha in the list of species with confirmed occurrence in this state. The records of H. brasiliensis refer to Laguna (n = 2 and Timbe do Sul (n = 1. In turn, C. laucha presents 23 records from Capinzal. The entire material is represented by skull fragments from owl pellets samples collected from nests and feeding perches of the Tyto alba.

Why can't rodents vomit? A comparative behavioral, anatomical, and physiological study.

Directory of Open Access Journals (Sweden)

Charles C Horn

Full Text Available The vomiting (emetic reflex is documented in numerous mammalian species, including primates and carnivores, yet laboratory rats and mice appear to lack this response. It is unclear whether these rodents do not vomit because of anatomical constraints (e.g., a relatively long abdominal esophagus or lack of key neural circuits. Moreover, it is unknown whether laboratory rodents are representative of Rodentia with regards to this reflex. Here we conducted behavioral testing of members of all three major groups of Rodentia; mouse-related (rat, mouse, vole, beaver, Ctenohystrica (guinea pig, nutria, and squirrel-related (mountain beaver species. Prototypical emetic agents, apomorphine (sc, veratrine (sc, and copper sulfate (ig, failed to produce either retching or vomiting in these species (although other behavioral effects, e.g., locomotion, were noted. These rodents also had anatomical constraints, which could limit the efficiency of vomiting should it be attempted, including reduced muscularity of the diaphragm and stomach geometry that is not well structured for moving contents towards the esophagus compared to species that can vomit (cat, ferret, and musk shrew. Lastly, an in situ brainstem preparation was used to make sensitive measures of mouth, esophagus, and shoulder muscular movements, and phrenic nerve activity-key features of emetic episodes. Laboratory mice and rats failed to display any of the common coordinated actions of these indices after typical emetic stimulation (resiniferatoxin and vagal afferent stimulation compared to musk shrews. Overall the results suggest that the inability to vomit is a general property of Rodentia and that an absent brainstem neurological component is the most likely cause. The implications of these findings for the utility of rodents as models in the area of emesis research are discussed.

Discrepancy variation of dinucleotide microsatellite repeats in eukaryotic genomes

Directory of Open Access Journals (Sweden)

HUAN GAO

2009-01-01

Full Text Available To address whether there are differences of variation among repeat motif types and among taxonomic groups, we present here an analysis of variation and correlation of dinucleotide microsatellite repeats in eukaryotic genomes. Ten taxonomic groups were compared, those being primates, mammalia (excluding primates and rodentia, rodentia, birds, fish, amphibians and reptiles, insects, molluscs, plants and fungi, respectively. The data used in the analysis is from the literature published in the Journal of Molecular Ecology Notes. Analysis of variation reveals that there are no significant differences between AC and AG repeat motif types. Moreover, the number of alleles correlates positively with the copy number in both AG and AC repeats. Similar conclusions can be obtained from each taxonomic group. These results strongly suggest that the increase of SSR variation is almost linear with the increase of the copy number of each repeat motif. As well, the results suggest that the variability of SSR in the genomes of low-ranking species seem to be more than that of high-ranking species, excluding primates and fungi.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...

Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

International Nuclear Information System (INIS)

Azbar, N.; Tuba, F.; Dokgoz, C.

2009-01-01

In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen

ORF Alignment: NC_004757 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 150 ... Query: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD 60 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD Sbjct: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHD 60 ... Qu

Development of a Novel Escherichia coli–Kocuria Shuttle Vector Using the Cryptic pKPAL3 Plasmid from K. palustris IPUFS-1 and Its Utilization in Producing Enantiopure (S-Styrene Oxide

Directory of Open Access Journals (Sweden)

Hiroshi Toda

2017-11-01

Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... palustris CGA009] ... Length = 157 ... Query: 95 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDA...KIETVLSDNGREFCGRP 154 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETV...LSDNGREFCGRP Sbjct: 1 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETVLSDNGREFCGRP 60 ... Query: 215 LDDYLVGY

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Query: 350 RNEMTARRIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP 409 ... RNEMTARRIVTADHT...ILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP Sbjct: 1 ... RNEMTARRIVTADHTILVSGSGYVPKGDL... ... cation-transporting P-type ATPase [Rhodopseudomonas ... palustris CGA009] ... Length = 203 ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 387 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCA...ALPEGLIES Sbjct: 1 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 60 ... Query: 448 GRPVPVDFALI...domonas palustris CGA009] ... Length = 229 ... Query: 328 MAQLSRTVRLVEAGIPVLL

Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

Energy Technology Data Exchange (ETDEWEB)

Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail: nuri.azbar@ege.edu.tr

2009-07-01

In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater

Induction of canine deciduoma in some reproductive stages with the different condition of corpora lutea.

Science.gov (United States)

Nomura, K

1997-03-01

Bitches were examined to see whether canine deciduoma could be induced at some reproductive stages with the different conditions of corpora lutea by inserting a silk suture into the uterine lumen. The bitches stimulated in the early and middle stages of diestrus or in unilateral pregnancy corresponding to these diestrous stages formed deciduoma at a high induction rate, however, no difference in the strength of decidual reaction between the pregnant and diestrous stages was recognized. On the other hand, no reaction could be seen in bitches in late diestrus, the late stage of unilateral pregnancy or the post partum repair phase in which stromal decidual cells similar to those of the rodentia can be seen. In already implanted uteri, however, no deciduoma was formed in the interplacental areas. Even though the corpora lutea were functional, new additional stimulations were not accepted at the interplacental area in which the uterine horn had already been influenced by fertilized ova. From these results, it was suggested that in the dog as well as the rodentia, the endometrium has to be under the influence of functional corpora lutea in order to form deciduoma.

Methylocella silvestris sp. nov., a novel methanotroph isolated from an acidic forest cambisol.

Science.gov (United States)

Dunfield, Peter F; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Dedysh, Svetlana N

2003-09-01

Two strains of Gram-negative, aerobic, non-pigmented, non-motile, rod-shaped, methane-oxidizing bacteria were isolated from an acidic forest cambisol near Marburg, Germany, and were designated as strains BL2(T) and A1. These bacteria were morphologically and phenotypically similar to Methylocella palustris K(T). The cells possess a highly specific bipolar appearance. They lack the intracytoplasmic membranes common to all methane-oxidizing bacteria except Methylocella, but contain a vesicular membrane system connected to the cytoplasmic membrane. A soluble methane monooxygenase was present, but no particulate methane monooxygenase could be detected. These bacteria utilize the serine pathway for carbon assimilation. Strains BL2(T) and A1 are moderately acidophilic, mesophilic organisms capable of growth at pH values between 4.5 and 7 (with an optimum at pH 5.5) and at temperatures between 4 and 30 degrees C. Compared with Methylocella palustris K(T), these strains have greater tolerance of cold temperatures, dissolved salts and methanol. On the basis of 16S rRNA gene sequence identity, of species with validly published names, strain BL2(T) is most closely related to Methylocella palustris K(T) (97.3 % identity), Beijerinckia indica subsp. indica ATCC 9039(T) (97.1 %) and Methylocapsa acidiphila B2(T) (96.2 %). The DNA G+C content is 60 mol% and the major phospholipid fatty acid is 18 : 1omega7. Strain BL2(T) showed only 21-22 % DNA-DNA hybridization with Methylocella palustris K(T). The data therefore suggest that strains BL2(T) and A1 represent a novel species of Methylocella; the name Methylocella silvestris sp. nov. is proposed, with strain BL2(T) (=DSM 15510(T)=NCIMB 13906(T)) as the type strain.

Morphological and molecular data confirm the transfer of homostylous species in the typically distylous genus Galianthe (Rubiaceae), and the description of the new species Galianthe vasquezii from Peru and Colombia.

Science.gov (United States)

Florentín, Javier Elias; Cabaña Fader, Andrea Alejandra; Salas, Roberto Manuel; Janssens, Steven; Dessein, Steven; Cabral, Elsa Leonor

2017-01-01

Galianthe (Rubiaceae) is a neotropical genus comprising 50 species divided into two subgenera, Galianthe subgen. Galianthe, with 39 species and Galianthe subgen. Ebelia , with 11 species. The diagnostic features of the genus are: usually erect habit with xylopodium, distylous flowers arranged in lax thyrsoid inflorescences, bifid stigmas, 2-carpellate and longitudinally dehiscent fruits, with dehiscent valves or indehiscent mericarps, plump seeds or complanate with a wing-like strophiole, and pollen with double reticulum, rarely with a simple reticulum. This study focused on two species that were originally described under Diodia due to the occurrence of fruits indehiscent mericarps: Diodia palustris and D. spicata . In the present study, classical taxonomy is combined with molecular analyses. As a result, we propose that both Diodia species belong to Galianthe subgen. Ebelia . The molecular position within Galianthe , based on ITS and ETS sequences, has been supported by the following morphological characters: thyrsoid, spiciform or cymoidal inflorescences, bifid stigmas, pollen grains with a double reticulum, and indehiscent mericarps. However, both species, unlike the remainder of the genus Galianthe , have homostylous flowers, so the presence of this type of flower significantly modifies the generic concept. In this framework, a third homostylous species, Galianthe vasquezii , from the Andean region is also described. Until now, this species remained cryptic under specimens of Galianthe palustris It differs however from the latter by having longer calyx lobes, the presence of dispersed trichomes inside the corolla lobes (vs. glabrous), fruits that are acropetally dehiscent (vs. basipetally dehiscent), and its Andean geographical distribution (vs. Paranaense). Additionally, a lectotype has been chosen for Diodia palustris , Borreria pterophora has been placed under synonymy of Galianthe palustris , and Galianthe boliviana is reported for the first time from Peru

Evolution of recombination in eutherian mammals: insights into mechanisms that affect recombination rates and crossover interference

OpenAIRE

Segura, Joana; Ferretti, Luca; Ramos-Onsins, Sebastián; Capilla, Laia; Farré, Marta; Reis, Fernanda; Oliver-Bonet, Maria; Fernández-Bellón, Hugo; Garcia, Francisca; Garcia-Caldés, Montserrat; Robinson, Terence J.; Ruiz-Herrera, Aurora

2013-01-01

Recombination allows faithful chromosomal segregation during meiosis and contributes to the production of new heritable allelic variants that are essential for the maintenance of genetic diversity. Therefore, an appreciation of how this variation is created and maintained is of critical importance to our understanding of biodiversity and evolutionary change. Here, we analysed the recombination features from species representing the major eutherian taxonomic groups Afrotheria, Rodentia, Primat...

AFM imaging of bacteria in liquid media immobilized on gelatin coated mica surfaces

Energy Technology Data Exchange (ETDEWEB)

Doktycz, M.J.; Sullivan, C.J.; Hoyt, P.R.; Pelletier, D.A.; Wu, S.; Allison, D.P

2003-10-15

Immobilization of particulates, especially biomolecules and cells, onto surfaces is critical for imaging with the atomic force microscope (AFM). In this paper, gelatin coated mica surfaces are shown to be suitable for immobilizing and imaging both gram positive, Staphylococcus aureus, and gram negative, Escherichia coli, bacteria in both air and liquid environments. Gelatin coated surfaces are shown to be superior to poly-L-lysine coated surfaces that are commonly used for the immobilization of cells. This cell immobilization technique is being developed primarily for live cell imaging of Rhodopseudomonas palustris. The genome of R. palustris has been sequenced and the organism is the target of intensive studies aimed at understanding genome function. Images of R. palustris grown both aerobically and anaerobically in liquid media are presented. Images in liquid media show the bacteria is rod shaped and smooth while images in air show marked irregularity and folding of the surface. Significant differences in the vertical dimension are also apparent with the height of the bacteria in liquid being substantially greater than images taken in air. In air immobilized bacterial flagella are clearly seen while in liquid this structure is not visible. Additionally, significant morphological differences are observed that depend on the method of bacterial growth.

Towards understanding the biological function of hopanoids (Invited)

Science.gov (United States)

Doughty, D. M.; Hunter, R.; Summons, R. E.; Newman, D. K.

2010-12-01

Rhodopseudomonas palustris TIE-1 expresses bacterial hopanoid lipids that are structurally similar and evolutionarily related to eukaryotic sterols. The genome of R. palustris TIE-1 contains two copies of the hpnN gene (hpnN1 and hpnN2) that are orthologs of genes encoding eukaryotic sterol and lipid transporters. Hopanoid localization to the outer membrane was found to be dependent upon hpnN1. Since the cell cycle of R. palustris TIE-1 is obligately bimodal with each cell division resulting in the generation of one mother and one swarmer cell, evidence was obtained that hopanoids where specifically localized to the outer membrane of mother cells. The sequestration of hopanoids to the mother cells was also disrupted by the deletion of the hpnN1 gene. Mutants lacking the hopanoid transporters were able to grow normally at 30 °C but showed decreased growth at 38 °C. The hopanoid transporter mutant formed cellular filaments when grown at elevated temperature. Because sedimentary steranes and hopanes comprise some of the earliest evidence for the emergence of distinct bacteria and eukaryotic phyla, a better appreciation of the function of hopanoids will improve our ability to interpret the evolution of life on Earth.

Screening of 18 species for digestate phytodepuration.

Science.gov (United States)

Pavan, Francesca; Breschigliaro, Simone; Borin, Maurizio

2015-02-01

This experiment assesses the aptitude of 18 species in treating the digestate liquid fraction (DLF) in a floating wetland treatment system. The pilot system was created in NE Italy in 2010 and consists of a surface-flow system with 180 floating elements (Tech-IA®) vegetated with ten halophytes and eight other wetland species. The species were transplanted in July 2011 in basins filled with different proportions of DLF/water (DLF/w); periodic increasing of the DLF/w ratio was imposed after transplanting, reaching the worst conditions for plants in summer 2012 (highest EC value 7.3 mS cm/L and NH4-N content 225 mg/L). It emerged that only Cynodon dactylon, Typha latifolia, Elytrigia atherica, Halimione portulacoides, Salicornia fruticosa, Artemisia caerulescens, Spartina maritima and Puccinellia palustris were able to survive under the system conditions. Halophytes showed higher dry matter production than other plants. The best root development (up to 40-cm depth) was recorded for Calamagrostis epigejos, Phragmites australis, T. latifolia and Juncus maritimus. The highest nitrogen (10-15 g/m(2)) and phosphorus (1-4 g/m(2)) uptakes were obtained with P. palustris, Iris pseudacorus and Aster tripolium. In conclusion, two halophytes, P. palustris and E. atherica, present the highest potential to be used to treat DLF in floating wetlands.

The parasitism of Ixodes luciae (Acari: Ixodidae on marsupials and rodents in Peruvian Amazon O parasitismo do Ixodes luciae (Acari: ixodidae em marsupiais e em roedores na Amazônia Peruana

Directory of Open Access Journals (Sweden)

María Mónica Díaz

2009-01-01

Full Text Available In this work the infestation with I. luciae on Didelphimorphia and Rodentia in different environments of Peruvian Amazon was studied. Didelphimorphia was represented by the family Didelphidae. Specimens belonging to Caluromys lanatus, Didelphis marsupialis, Marmosops sp.2, Metachirus nudicaudatus, Philander andersoni and Philander opossum were infested with adults I. luciae and one Micoureus sp. was infested with larvae. In Rodentia, the infestation with I. luciae nymphs was restricted to Hylaeamys perenensis, Hylaeamys yunganus and Oligoryzomys microtis, while one Oecomys bicolor (all Cricetidae was infested with larvae of this species. The few larvae were found on rodents captured in primary forest. The only significant difference (P No presente trabalho, infestações por Ixodes luciae em Didelphimorphia e Rodentia em diferentes ambientes da Amazônia peruana foram estudadas. Didelphimorphia foi representada pela família Didelphidae. Espécimes pertencentes a Caluromys lanatus, Didelphis marsupialis, Marmosops sp., Metachirus nudicaudatus, Philander andersoni e Philander opossum foram encontrados infestadas por adultos de I. luciae; um Micoureus sp. foi encontrado infestado por larvas. Em Rodentia, a infestação por ninfas de I. luciae estiveram restritas a Hylaeamys perenensis, Hylaeamys yunganus e Oligoryzomys microtis, enquanto que um Oecomys bicolor (todos Cricetidae esteve infestado por larvas de I. luciae. As poucas larvas foram encontradas em roedores capturados na floresta primária. A única diferença significante (P < 0.05 na prevalência de carrapatos adultos em Didelphimorphia foi entre P. andersoni e M. nudicaudatus (distribuição chi-quadrado. A distribuição de carrapatos adultos foi significativamente diferente em P. andersoni quando comparado com M. nudicaudatus, P. opossum e D. marsupialis (teste Kruskal-Wallis. Nenhum efeito significante do mês ou ambiente foi observado em relação à infestação por carrapato

Avaliação de possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muriade em São Paulo, SP

Directory of Open Access Journals (Sweden)

Thais Souza Guerra

2016-04-01

Full Text Available A estimativa do intervalo post-mortem (IPM é uma das principais utilizações de insetos na perícia, que pode ser fundamentado no ciclo biológico, ecologia e distribuição geográfica de uma determinada espécie, bem como o comportamento de toda fauna presente em um corpo a fim de estimar o menor intervalo possível da ocorrência da morte. Diversos fatores podem interferir no ciclo de vida de um inseto, tais como temperatura, umidade e presença de substâncias nos tecidos de uma carcaça, promovendo, em certos casos, aceleração ou retardo neste ciclo afetando diretamente na estimativa do IPM. O presente estudo teve como objetivo avaliar a possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muridae, na zona leste de São Paulo, SP, correlacionando os estágios de decomposição da carcaça e o desenvolvimento larval de moscas. A captura das larvas foi realizada durante o mês de outubro de 2014, as quais as carcaças foram acondicionadas em aparato adequado para coleta de insetos imaturos e adultos: uma contendo a carcaça tabagista e outra com a carcaça não fumante. No curso da decomposição da carcaça não fumante, foram capturados 37 indivíduos adultos da família Calliphoridae emergidos durante o processo de decomposição, ao passo que, na carcaça com fumígeno, não foi coletado nenhuma espécie emergida deste substrato, porém, a mesma apresentou uma decomposição até a fase de esqueletização em menor tempo comparado á carcaça controle, sugerindo assim, uma possível interferência do ato de tabagismo na estimativa do IPM.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available clase ... (GGDEF) [Rhodopseudomonas palustris CGA009] ... Length = 124 ... Query: 353 PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY 412 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY Sbjct: 1 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEIEMLEPARLSELVELLLTRVAEHFQY 60 ... Query: 473 DRRF 476 ... DRRF Sbjct: 121 DRRF 124

Land fauna composition of small mammals of a fragment of Atlantic Forest in the State of Sao Paulo, Brazil

Directory of Open Access Journals (Sweden)

Darci Moraes Barros-Battesti

2000-03-01

Full Text Available The Atlantic Forest small mammal land fauna, except bats, and the abiotic factors that might have an influence on its composition, were studied in the Itapevi County, State of Sao Paulo, a forested region, partly altered by antropic action, from January, 1995 to June, 1996. The trapping effort consisted of 2,888 trap-nights, resulting in a 4.6% trapping success and consisted of monthly trappings, for five consecutive days. During this period, 134 specimens were captured, of which 46.3% were Didelphimorphia and 53.7% were Rodentia. Eleven species were registered: two Didelphimorphia: Didelphis marsupialis (Linnaeus, 1758 and Marmosops incanus (Lund, 1841, and nine Rodentia: Akodon cursor (Winge, 1887, Bolomys lasiurus (Lund, 1841, Oxymycterus hispidus Pictet, 1843, Oxymycterus nasutus (Waterhouse, 1837, Oligoryzomys nigripes (Olfers, 1818, Oryzomys angouya (Fischer, 1814, Raltus norvegicus (Berkenhout, 1769, Euryzygomatomys spinosus (G. Fischer, 1814 and Cavia aperea Erxleben, 1777. The relative density indices were correlated with meteorological data by Spearman and Pearson coefficients. For marsupials these correlations were not significant. For rodents, the correlations were significant and directly related to lower temperature and rainfall indices (p<0.05. During the dry season the occurrence of small mammals was 50% greater than during the wet season, probably due to foraging strategies in the studied fragment of Atlantic Forest.

Micromamiferos andinos holocenicos del sitio arqueologico Inca Cueva 5, Ju Juy, Argentina: tafonomia, zoogeografia y reconstruccion paleoambiental

OpenAIRE

Ortiz, P. E.; Teta, P.

2002-01-01

A micromammal archaeological sequence (2120 f 120 to 780 f 100 years BP) from Inca Cueva 5 site (23" 05' S - 65" 27' W; 3700 m.a.s.l., Jujuy Province, Argentina) was studied. The following mammalian taxa were recorded: Order Didelphimorphia, Family Didelphidae, Thylamys cf. T. pallidior; Order Rodentia, Family Muridae, Akodon cf. A. albiventer, Andinomys edax, Auliscomys sublimis, Calomys lepidus, Neotomys ebriosus, Phyllotis sp.; Family Caviidae, Cavia cf. C. tschudii, Galea musteloides; Fam...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

El Aragoniense Medio y Superior en el Suroeste de Madrid: Los nuevos yacimientos de Micromamíferos del Mioceno Medio de Villaviciosa de Odón y Leganés

Directory of Open Access Journals (Sweden)

Sesé, C.

2014-06-01

Full Text Available This paper discloses two new sites in the southwestern area of Madrid, Villaviciosa de Odón and Leganés, which have provided two rich micromammals associations of different ages. The micromammal association of the Villaviciosa de Odón site determined in this work is composed by the following taxa: Lagomorpha: Lagopsis peñai; Erinaceomorpha: Galerix cf. exilis; Soricomorpha: Miosorex cf. grivensis; Rodentia: Atlantoxerus sp., Microdyromys sp., Armantomys tricristatus, Megacricetodon collongensis and Democricetodon sp. This association, mainly by the evolutionary stage of Megacricetodon collongensis, corresponds to the E local biozone after Daams & Freudenthal (1988a from the end of the Middle Aragonian which is correlated with the end of the MN 5 Unit of Mein (1975. The micromammal association of the Leganés site consists of the following taxa: Lagomorpha: Lagopsis verus; Erinaceomorpha: Galerix cf. exilis; Rodentia: Heteroxerus cf. rubricati, Armantomys sp., Megacricetodon collongensis-crusafonti and cf. Democricetodon sp. Mainly by the evolutionary stage of Megacricetodon collongensis-crusafonti this association corresponds to the G1 local biozone after Daams et al. (1999 a y b which is correlated with the MN 6 Unit of Mein (1975. It is the only site known in Madrid of this age. Both micromammals associations suggest an open environment dominated by hard vegetation of steppe kind, and a dry and relatively warm climate.En este trabajo se dan a conocer dos nuevos yacimientos de la zona suroeste de Madrid, Villaviciosa de Odón y Leganés, que han proporcionado dos ricas asociaciones de micromamíferos de edades diferentes. La asociación de micromamíferos del yacimiento de Villaviciosa de Odón determinada en este trabajo está compuesta por los siguientes taxones: Lagomorpha: Lagopsis peñai; Erinaceomorpha: Galerix cf. exilis; Soricomorpha: Miosorex cf. grivensis; Rodentia: Atlantoxerus sp., Microdyromys sp., Armantomys tricristatus

Bioregional Planning in Central Georgia, USA

National Research Council Canada - National Science Library

Dale, Virginia; Aldridge, Matthew; Arthur, Taryn; Baskaran, Latha; Berry, Michael; Chang, Michael; Efroymson, Rebecca; Garten, Chuck; Stewart, Catherine; Washington-Allen, Robert

2005-01-01

...% of the native longleaf pine (Pinus palustris) forest remains intact. Besides the loss of species, habitats, and ecosystem services associated with longleaf pine forests, the environmental concerns of the region include air, water, and noise pollution...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

Placentation in Sigmodontinae: a rodent taxon native to South America

DEFF Research Database (Denmark)

Favaron, Phelipe O; Carter, Anthony Michael; Ambrosio, Carlos E

2011-01-01

ABSTRACT: BACKGROUND: Sigmondontinae, known as "New World rats and mice," is a large subfamily of Cricetidae for which we herein provide the first comprehensive investigation of the placenta. METHODS: Placentas of various gestational ages ranging from early pregnancy to near term were obtained fo...

Ecología poblacional del ratón Peromyscus mexicanus (Rodentia: Muridae en el Parque Nacional Volcán Poás, Costa Rica

Directory of Open Access Journals (Sweden)

Licidia Rojas Rojas

2007-12-01

Full Text Available Se estudió el tamaño poblacional, la proporción de sexos, el peso y el número de adultos e inmaduros de Peromyscus mexicanus en tres sitios, durante 14 meses, en el Parque Nacional volcán Poás, Costa Rica. Se colocaron 30 trampas Sherman en cada sitio, para un estudio de captura-recaptura durante seis días consecutivos de cada mes, desde marzo de 2002 hasta abril de 2003. Se hicieron 2 393 capturas, hallándose en Tierra Fría, además de P. mexicanus, Reithrodontomys creper, R. rodriguezi, Scotinomys teguina y Oryzomys devius (Muridae. En Potrero Grande se capturaron P. mexicanus, R. creper, R. sumichrasti, S. teguina y O. devius. En Canto de las Aves se capturaron P. mexicanus, R. creper, R. rodriguezi y O. devius. El 34.77 % del total de ratones capturados fueron P. mexicanus. Se capturaron en promedio 34 individuos por mes por hectárea en Tierra Fría y 11 en Potrero Grande; en Canto de las Aves sólo se capturaron 4 individuos en todo el muestreo. El tamaño estimado de la población de P. mexicanus no varió mensualmente en Tierra Fría, pero si en Potrero Grande. No se observó variación en la proporción de sexos en ninguno de los dos sitios. El valor promedio de peso en Tierra Fría fue de 43.83+1.93 g machos 39.29+2.07 g hembras. En Potrero Grande fue 43.54+3.42 g machos y 42.08+3.45 g hembras. En ninguno de los dos sitios se encontraron diferencias en la cantidad de individuos inmaduros a través del tiempo.Population ecology of the mouse Peromyscus mexicanus (Rodentia: Muridae in Poas Volcano National Park, Costa Rica. The Mexican Deer Mouse has been reported as an abundant wild mouse in Costa Rica; nevertheless, it has not been studied as well as other Peromyscus species. Thirty Sherman traps were placed on three habitats during six consecutive days of each month, from March 2002 through April 2003 in three sites of Poás volcano National Park, Costa Rica. A total of 2 393 mice were captured. Other species such as

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

Formalized classification of European fen vegetation at the alliance level

DEFF Research Database (Denmark)

Peterka, Tomáš; Hájek, Michal; Jiroušek, Martin

2017-01-01

Aims Phytosociological classification of fen vegetation (Scheuchzerio palustris-Caricetea fuscae class) differs among European countries. Here we propose a unified vegetation classification of European fens at the alliance level, provide unequivocal assignment rules for individual vegetation plot...

Comparison Of Cd2+ Biosorption And Bioaccumulation By Bacteria – A Radiometric Study

Directory of Open Access Journals (Sweden)

Machalová Linda

2015-12-01

Full Text Available In this work, bioaccumulation and biosorption characteristics of Cd2+ ions by both dead and living non-growing biomass of gram-positive bacteria Kocuria palustris and Micrococcus luteus isolated from spent nuclear fuel pools were compared. The radioindicator method with radionuclide 109Cd was used to obtain precise and reliable data characterizing Cd compartmentalization in bacterial cells. The following cellular distribution of Cd in living non-growing biomass after 4 h incubation in solutions containing different concentration of Cd2+ ions (100, 250, 500, 750 and 1000 µmol/L spiked with 109CdCl2 under aeration at 30 °C were obtained: in M. luteus almost 85 % of Cd was localized on the cell surface and 15 % in cytoplasm. Similarly, in K. palustris 83 % of Cd was localized on the cell surface and 17 % in cytoplasm. The data were obtained by gamma spectrometry of extracts and solids after sequential extraction of biomass with 5 mM Ca(NO32 and 20 mM EDTA. Biosorption of Cd by non-living bacterial biomass is a rapid process strongly affected by solution pH and as was confirmed by FTIR analysis beside carboxylate ions also other functional groups such as amino and phosphate contribute to Cd binding by bacterial cell surfaces. Maximum sorption capacities Qmax (μmol/g calculated from the Langmuir isotherm were 444 ± 15 μmol/g for M. luteus and 381 ± 1 μmol/g for K. palustris.

Variation in manuka oil lure efficacy for capturing Xyleborus glabratus (Coleoptera: Curculionidae: Scholytinae), and Cubeb oil as an alternative attractant

Science.gov (United States)

James Hanula; Brian Sullivan; David Wakarchuk

2013-01-01

Redbay ambrosia beetle, Xyleborus glabratus Eichoff, is an exotic species to North America vectoring a deadly vascular wilt disease of redbay [Persea borbonia (L.) Spreng], swampbay [P. palustris (Raf.) Sarg.], avocado (P. americana Mill.), and sassafras [Sassafras albidum (...

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

Soil Fungi Respond More Strongly Than Fine Roots to Elevated CO2 in a Model Regenerating Longleaf Pine-Wiregrass Ecosystem

Science.gov (United States)

Increasing atmospheric CO2 will have significant effects on belowground processes which will affect forest structure and function. A model regenerating longleaf pine-wiregrass community [consisting of longleaf pine (Pinus palustris), wiregrass (Aristida stricta), sand post oak (Quescus margaretta),...

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

Micromammals (Insectivora; Rodentia of "Valle dell'Inferno" (Rome / Micromammiferi (Insectivora; Rodentia della Valle dell'Inferno (Roma

Directory of Open Access Journals (Sweden)

Roberto Federici

1986-12-01

Full Text Available Abstract A research on micromammals in the area of "Valle dell'Inferno" (in the north-west of Rome was carried out. The study was based on a previous phytosociological survey which describes a Quercus suber population in the valley (a once larger residua1 of a roman cork-tree wood which is now included in the town. Specimens from Rodents (Apodemus sylvaticus, Mus domesticus, Rattus rattus, R. norvegicus, Pitymys savii and Insectivores (Crocidura suaveolens, Erinaceus europaeus were captured by live traps. Most of Insectivores specimens are represented by C. suaveolens. Generally C. suaveolens lives in sympatry with C. leucodon but no specimens of the latter were found in this area. Three different kinds of landscape are present in the "Inferno" valley, namely, the wood, the meadow, and the bottom valley (with high anthropic impact; we have compared these three landscapes with biotic indexes (index of faunistic affinity, index of biocoenotic affinity and index of environmental evaluation. We have also compared through the same indexes, the micromammal fauna of the "Inferno" valley with six other differently polluted localities in Latium, where animals were captured with the same live traps. This area retains its natura1 environment in despite of the high anthropic impact. Riassunto È stato effettuato uno studio sulla micromammalofauna terrestre della Valle dell'Inferno situata a nord-ovest di Roma. Lo studio è basato su una precedente indagine fitosociologica effettuata per la caratterizzazione vegetazionale di una sughereta un tempo molto estesa ed ora racchiusa nell'abitato cittadino. È stato pertanto possibile tracciare, tramite gli indici biotici, una correlazione tra microteriocenosi ed effetti dell'impatto antropico.

Appendix 1

African Journals Online (AJOL)

Blyth's Reed Warbler x Marsh Warbler hybrid Acrocephalus dumetorum x A. palustris ............1. Number of .... in May 2009 when the finding date was given as “in December. 2005” ...... worn, brown wing feathers would not be replaced until the ...

Ecosystem carbon density and allocation across a chronosequence of longleaf pine forests

Science.gov (United States)

Lisa J. Samuelson; Thomas A. Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Timothy A. Martin; Wendell P. Cropper; Pete H. Anderson; Michael R. Ramirez; John C. Lewis

2017-01-01

Forests can partially offset greenhouse gas emissions and contribute to climate change mitigation, mainly through increases in live biomass. We quantified carbon (C) density in 20 managed longleaf pine (Pinus palustris Mill.) forests ranging in age from 5...

Typhaceae

NARCIS (Netherlands)

Backer, C.A.

1948-01-01

Perennial, palustrial or aquatic herbs with a creeping rhizome; stems erect, solid, submerged at the base. Leaves biseriate, partly radical or subradical, partly cauline, lower congested, higher remote, elongate-linear, rather thick and spongy, bluntmargined; their sheathing bases excreting slime on

WATER-USE ALONG A HYDROLOGICAL GRADIENT IN CENTRAL FLORIDA: A TALE OF TWO PINUS SPECIES

Science.gov (United States)

Although central Florida is relatively flat, the distribution of species on the landscape is controlled by subtle changes in elevation. Along a four-meter elevation gradient, xeric sandhill vegetation dominated by Pinus palustris (Longleaf pine) gives way to mesic pine flatwoods...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

Feasibility Report and Environmental Impact Statement for Navigation Improvements at Bayou La Batre, Alabama

Science.gov (United States)

1988-09-12

and plant corn. When coastal Alabama was opened to British and American settlers; fishing, livestock and, later, resort hotels became the important...bay (Magnolia virginiana), swamp bay ( Persea palustris), water oak (Quercus nigra), and sweet gum (Liquidambar styraciflua). Bald cypress (Taxodium

Variaciones nucleotídicas de dos grupos de tepezcuintles, Agouti paca (Rodentia: Agoutidae, en cautiverio provenientes de dos localidades de Yucatán, México

Directory of Open Access Journals (Sweden)

Rubén C Montes-Pérez

2006-09-01

Full Text Available Estimamos las variaciones nucleotídicas entre dos grupos de tepezcuintles (Agouti paca provenientes de los estados de Campeche y Quintana Roo, México y, dentro de cada grupo. Se colectaron muestras sanguíneas de once A. paca mantenidos en cautiverio. El ADN de leucocitos se utilizó para efectuar la amplificación aleatoria de polimorfismos de ADN (RAPD. Se seleccionaron los iniciadores número tres 5’ -d(GTAGACCCGT-3’ y seis 5’ -d(CCCGTCAGCA-3’ del estuche (Ready.To.Go. RAPD Analysis Beads, Amersham Pharmacia Biotech, porque produjeron un adecuado número de bandas. Los patrones electroforéticos de bandas fueron procesados con el software para análisis filogenético basado en el método de UPGMA para estimar la variación nucleotídica. El árbol filogenético obtenido con el iniciador tres reveló una agrupación dicotómica entre los animales de ambos estados de la Península de Yucatán, con un valor de divergencia de 1.983 nucleótidos de cada cien. Los animales de Quintana Roo mostraron un agrupamiento con el iniciador seis y, otro grupo más con animales procedentes de Campeche. La variación nucleotídica entre estos dos grupos fue de 2.118 nucleótidos por cada cien. Las variaciones nucleotídicas dentro de los grupos procedentes de ambos estados, para los dos iniciadores, mostraron valores que fluctuaron entre 0.46 y 1.68 nucleótidos de cada cien, lo cual indica que la variación nucleotídica entre los dos grupos de animales es alrededor de dos nucleótidos por cada cien y, dentro de grupos es menor a 1.7 nucleótidos por cada cien.Nucleotidic variations of two captive groups of tepezcuintle, Agouti paca (Rodentia: Agoutidae, from two sites in Yucatan, Mexico. The objective of this work was to estimate the nucleotidic variation between two groups of tepezcuintles (Agouti paca from the states of Campeche and Quintana Roo, Mexico and within members of each group. Blood samples were collected from eleven A. paca kept in

Evaluation of Fungal Deterioration in Liquidambar orientalis Mill. heartwood by FT-IR and light microscopy.

Science.gov (United States)

Nural Yilgor; Dilek Dogu; Roderquita Moore; Evren Terzi; S. Nami Kartal

2013-01-01

The chemical and morphological changes in heartwood specimens of Liquidambar orientalis Mill. caused by the white-rot fungus Trametes versicolor and the brown-rot fungi Tyromyces palustris and Gloeophyllum trabeum were studied by wet chemistry, FT-IR, GC-MS analyses, and photo-...

Disturbance from southern pine beetle, suppression, and wildfire affects vegetation composition in central Louisiana: a case study

Science.gov (United States)

T.W. Coleman; Alton Martin; J.R. Meeker

2010-01-01

We assessed plant composition and forest succession following tree mortality from infestation of southern pine beetle (Dendroctonus frontalis), associated suppression, and wildfire in two forest types, pine (Pinus spp.) with mixed hardwood and longleaf pine (P. palustris). In this case study, vegetation was...

Red-cockaded woodpecker nestling provisioning and reproduction in two different pine habitats

Science.gov (United States)

Richard R. Schaefer; Richard N. Conner; D. Craig Rudolph; Daniel Saenz

2004-01-01

We obtained nestling provisioning and rcpntductive data from 24 Red-cockaded Woodpecker (Picoides borealis) groups occupying two different pine habitats-longleaf pine (Pinus palustris) and a mixture of loblolly (P. taeda) and shortleaf pine (P. echinata)--in eastern Texas during 1990 and 1901....

ESTUDIOS CROMOSÓMICOS EN ARACHIS (LEGUMINOSAE

Directory of Open Access Journals (Sweden)

Graciela Inés Lavia

1996-01-01

Full Text Available Se presenta el número de cromosomas de 38 accesiones que representan 17 especies de cinco secciones del género Arachis. El primer conteo cromosómico informa de las siguientes ocho especies: Sect. Extranervosae: A.retusa, secc. Heteranthae: A. Giacomettii, secc. Procumbentes: A.vallsii, secc. Arachis: A.decora, A.microsperma, A.palustris, A.rinitensis y A.williamsii. En informes anteriores son confirmadas nueve especies. Todas las especies estudiadas tienen 2n = 2x = 20, con excepción de una adhesión de A.palustris, que tiene 2n = 2x = 18, que representa probablemente un nuevo número básico x = 9 para el género. Cromosomas satélites se analizan para la mayoría de las especies. "A" cromosomas se encuentran sólo en A.microsperma y A.trinitensis (Sect. Arachis

Eficiência de um composto de iodo orgânico contra fungos apodrecedores de madeiras e térmitas

Directory of Open Access Journals (Sweden)

Alexandre da Costa Florian

2003-01-01

Full Text Available The effectiveness of a low toxicity organic compound as fungicide and insecticide was studied by a accelerated laboratory bioassay according to the japanese standard. The compound was evaluated at concentrations of 0,5, 0,75 and 1,0% using ethanol as solvent. The subterraneous termites Coptotermes formosanus Shiraki and the decay fungi Coriolus versicolor (white rot and Tyromyces palustris (brown rot were used in the trials to evaluate the insecticide and fungicide action respectively. The wood specimens with dimensions of 40 x 20 x 5mm were treated by surface coating (brushing method at a rate of 110±10g/m2. The percentage weight loss of the wood blocks and the termite mortality (insecticide action and the weight loss of the wood blocks before and after the fungi attack (fungicide action were determined. The efficiency of the formulations were evaluated according to the Value of Efficiency. Results showed that the compound was of little or no efficient as insecticide against Coptotermes formosanus in the three concentrations analysed. The compound showed a good performance as fungicide against Coriolus versicolor and Tyromyces palustris with a Value of Efficiency higher than 90 in the three concentrations analysed. The best results were obtained with the product at 1,0% concentration in the treated and unleached wood specimens. Tyromyces palustris caused a larger damage in the wood blocks than Coriolus versicolor. The product showed a low capacity of fixation in the wood; therefore, it is not indicated for treating wood that will be in direct contact with the soil or under outdoor conditions.

Epigeic spiders of the pastures of northern Wielkopolska

Directory of Open Access Journals (Sweden)

Woźny, Marek

2000-10-01

Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

Productive Performance Of The Grasscutter (Rodentia ...

African Journals Online (AJOL)

The floor housing, open-cage and closed-cage housing systems for rearing grasscutters in captivity were respectively used to evaluate the performance of the grasscutter (Thryonomys swinderianus Temmnick, 1827) in the humid tropics of southern Nigeria. There was no significant difference (P>0.05) in the average initial ...

Environmental Impact Study of the Northern Section of the Upper Mississippi River, St. Croix River Pool.

Science.gov (United States)

1973-11-01

Poa palustris Fowl meadow-grass P Poa pratensis Blue grass Setaria viridis Green foxtail P P P P D Setaria sp. Bristly foxtail P Spartina pectinata...Juneberry) Crataegus spp. (Thorn-Apple) Fragaria vesca (Wild Strawberry) Geum canadense (White Avens) Geum laciniatum (Avens) Geum triflorum (Three

Preliminary Feasibility Report (Stage 2), Review of Reports on Lorain Harbor, Ohio. Volume 2. Appendices. Revision

Science.gov (United States)

1981-05-01

casts for iron ore within the GL/SLS region. A recent downturn in the economic health of the domestic steel industry has probably deferred any major...emergents: Swamp rose mallow Hibiscus palustris Nettle Urtica sp. Nightshade Solanum dulcamara Hedge bindweed Convolvulus sepium Peppermint Mentha arvensis

Fungicide sensitivity in the wild rice pathogen Bipolaris oryzae

Science.gov (United States)

In recent years the occurrence of fungal brown spot, caused by Bipolaris oryzae has increased in cultivated wild rice (Zizania palustris) paddies in spite of the use of fungicides. To implement an efficient integrated disease management system, we are exploring whether field isolates have developed ...

First report of laurel wilt, caused by Raffaelea lauricola, on sassafras (Sassafras albidum) in Alabama

Science.gov (United States)

C.A. Bates; Stephen Fraedrich; T.C. Harrington; R.S. Cameron; R.D. Menard; Susan Best

2013-01-01

Laurel wilt, caused by Raffaelea lauricola, a fungal symbiont of the redbay ambrosia beetle, Xyleborus glabratus, is responsible for extensive mortality of native redbays (Persea borbonia and P. Palustris) in the coastal plains of the southeastern United States. The wilt also affect the more...

Impacts of pine species, stump removal, cultivation, and fertilization on soil properties half a century after planting

Science.gov (United States)

John R. Butnor; Kurt H. Johnsen; Felipe G Sanchez; C. Dana Nelson

2012-01-01

To better understand the long-term effects of species selection and forest management practices on soil quality and soil C retention, we analyzed soil samples from an experimental planting of loblolly (Pinus taeda L.), longleaf ((Pinus palustris Mill.), and slash ((Pinus elliottii Engelm.) pines under...

Comparative serum biochemistry of captive mugger crocodiles ...

African Journals Online (AJOL)

Standard serum biochemical parameters were determined for 28 mugger crocodiles (Crocodylus palustris) using Supra-occipital plexus technique and/or Cardiocentesis technique at the Arignar Anna Zoological Park, Vandalur, Chennai, Guindy Snake Park Trust and Amaravathy Crocodile farm, Tamilnadu, India (13° 0´ N; ...

Ornitina alfa-cetoglutarato na isquemia-reperfusÃo intestinal em ratos

OpenAIRE

Eduardo Silvio Gouveia GonÃalves

2009-01-01

Objetivo: Avaliar os efeito da ornitina α-cetoglutarato (OKG) no sangue e tecido intestinal de ratos submetidos à isquemia/reperfusÃo intestinal atravÃs da determinaÃÃo das concentraÃÃes in vivo no sangue e no tecido do intestino delgado, submetido a isquemia/reperfusÃo, de glicose, G 6 PDH, piruvato, acetoacetato, lactato, 3 HBDH, glutationa, T-Bars, mieloperoxidase, CPK e LDH. MÃtodo: Sessenta ratos (Rattus norvergicus albinus, Rodentia Mammalia) foram distribuÃdos aleatoriamente em ci...

Mammal (Mammalia Fauna of Kapıdağ Peninsula

Directory of Open Access Journals (Sweden)

Erdem HIZAL

2008-01-01

Full Text Available The number of studies on mammals of Kapıdag Peninsula is insufficent. The present study is based on mammal species collected and observed in Kapıdag Peninsula. Kapıdag Peninsula was visited as a total of 226 days between 2001-2007. Field collections yielded 32 mammal species from 6 orders: Insectivora (5, Chiroptera (9,Lagomorpha (1, Rodentia (7, Carnivora (7, Artiodactyla (3. Of the species recorded in this study are rare for Kapıdag Peninsula: Lynx lynx and Felis silvestris.

Sistemática do gênero Nectomys Peters, 1861 (Cricetidae: Sigmodontinae)

OpenAIRE

Elisandra de Almeida Chiquito

2015-01-01

A tribo Oryzomyini abriga 34 dos 86 gêneros sigmodontíneos e apresenta ampla distribuição geográfica, ocorrendo em diversos habitats desde a Terra do Fogo ao sudeste dos Estados Unidos; com representantes cursoriais, arborícolas ou ainda semi-aquáticos, e com diferentes hábitos alimentares, variando de onívoros a insetívoros. Estudos sistemáticos nessa tribo têm sido desenvolvidos com base em dados de morfologia, morfometria, informações citogenéticas e moleculares, o que vêm contribuindo par...

7 CFR 457.170 - Cultivated wild rice crop insurance provisions.

Science.gov (United States)

2010-01-01

... reinsured policies: Cultivated Wild Rice Crop Provisions. 1. Definitions Approved laboratory. A testing.... Cultivated Wild Rice. A member of the grass family Zizania Palustris L., adapted for growing in man-made... for the crop year. Planted acreage. In addition to the definition contained in the Basic Provisions...

The health of loblolly pine stands at Fort Benning, GA

Science.gov (United States)

Soung-Ryoul Ryu; G. Geoff Wang; Joan L. Walker

2013-01-01

Approximately two-thirds of the red-cockaded woodpecker (Picoides borealis) (RCW) groups at Fort Benning, GA, depend on loblolly pine (Pinus taeda) stands for nesting or foraging. However, loblolly pine stands are suspected to decline. Forest managers want to replace loblolly pine with longleaf pine (P. palustris...

Silvicultural treatments for converting loblolly pine to longleaf pine dominance: Effects on planted longleaf pine seedlings

Science.gov (United States)

Huifeng Hu; G.Geoff Wang; Joan L. Walker; Benjamin O. Knapp

2012-01-01

A field study was installed to test silvicultural treatments for establishing longleaf pine (Pinus palustris Mill) in loblolly pine (P. taeda L.) stands. Harvesting was used to create seven canopy treatments, four with uniformly distributed canopies at different residual basal areas [Control (16.2 m2/ha),...

Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)

Science.gov (United States)

The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

From loblolly to longleaf: fifth-year results of a longleaf pine restoration study at two ecologically distinct sites

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Huifeng Hu

2015-01-01

Historical land-use and management practices in the southeastern United States have resulted in the widespread conversion of many upland sites from dominance of longleaf pine (Pinus palustris Mill.) to loblolly pine (P. taeda L.) in the time following European settlement. Given the ecological, economic, and cultural...

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...

Comparison of arthropod prey of red-cockaded woodpeckers on the boles of long-leaf and loblolly pines

Science.gov (United States)

Scott Horn; James L. Hanula

2002-01-01

Red-cockaded woodpeckers (Picoides borealis) forage on the boles of most southern pines. Woodpeckers may select trees based on arthropod availability, yet no published studies have evaluated differences in arthropod abundance on different species of pines. We used knockdown insecticides to sample arthropods on longleaf (Pinus palustris...

Small terrestrial mammals of Albania: annotated list and distribution

Directory of Open Access Journals (Sweden)

Ferdinand Bego

2009-02-01

Full Text Available Abstract: Abstract We report for Albania new records of small terrestrial mammals (Erinaceomorpha, Soricomorpha, Rodentia and outline previously published data. Twenty-four species (one hedgehog, six soricomorhps and 17 rodents have been collected in 161 localities surveyed throughout the country. Nine species (Neomys anomalus, Crocidura leucodon, Talpa stankovici, Dryomys nitedula, Muscardinus avellanarius, Micromys minutus, Mus macedonicus, Myodes glareolus, and Microtus thomasi are recorded for Albania for the first time. The present list is far from being complete and presence of a further 11 species has to be confirmed. Riassunto I Micromammiferi dell'Albania: status e distribuzione Viene presentato un quadro della distribuzione dei micromammiferi in Albania, evidenziando le specie di recente scoperta così come alcuni dati già pubblicati. L'esame di 161 località distribuite sull'intero territorio nazionale ha permesso di raccogliere informazioni sulla presenza di 24 specie di micromammiferi (1 Erinaceomorpha, 6 Soricomorpha e 17 Rodentia. Nove specie  (Neomys anomalus, Crocidura leucodon, Talpa stankovici, Dryomys nitedula, Muscardinus avellanarius, Micromys minutus, Mus macedonicus, Myodes glareolus, e Microtus thomasi vengono segnalate per la prima volta. L'elenco qui presentato non può essere considerato definitivo. Ulteriori ricerche potrebbero accertare la presenza di altre 11 specie.

Chemical compositions of essential oils from two Artemisia species used in Mongolian traditional medicine

Directory of Open Access Journals (Sweden)

Javzmaa N

2018-02-01

Full Text Available Essential oils of aromatic and medicinal plants generally have a diverse range of activities because they possess many active constituents that work through a several modes of action. Artemisia, the largest genus of the family Asteraceae, has a number of effects against human and plant diseases. The main purpose of the present study was to investigate chemical compositions of essential oils of two Artemisia species, Artemisia palustris L and Artemisia sericea Weber ex Stechm from the Mongolian steppe zone using gas chromatography and gas chromatography-mass spectrometry. The essential oil of A.palustris was characterized by the presence of monoterpene hydrocarbons such as  trans-β-ocimene (59.1%, cis-β-ocimene (11.6% and myrcene (7.1%, while the oil of A.sericea was dominated by the presence of three oxygenated monoterpenoids as 1,8-cineole (25.8%, borneol (22.5% and camphor (18.8% which are used for preparation of a fragrance and medicinal products.

Historia natural de un roedor raro del desierto argentino, Salinomys delicatus (Cricetidae: Sigmodontinae Natural history of a rare rodent of the Argentinean desert, Salinomys delicatus(Cricetidae: Sigmodontinae

Directory of Open Access Journals (Sweden)

DANIELA RODRÍGUEZ

2012-03-01

Full Text Available El ratón delicado de los salares (Salinomys delicatus es un pequeño roedor endémico de Argentina. Ha sido considerado como vulnerable a la extinción dada su distribución restringida y en parches, tamaño poblacional pequeño y especialización en hábitats salinos. A pesar de que el ratón delicado tiene adaptaciones morfológicas y fisiológicas para la supervivencia en ambientes áridos y salitrosos, poco es lo que se conoce de su historia natural. El presente trabajo tiene como objetivo estudiar la historia natural de S. delicatus, reportar nuevas localidades de ocurrencia, caracterizar el uso de hábitat, su dieta y el ensamble acompañante, y describir su biología reproductiva y morfología. Se registraron dos nuevos sitios de ocurrencia en ambientes de bosques en galería y bajos salinos en la región noreste de la provincia de Mendoza (Argentina, siendo las primeras citas para esta provincia. S. delicatus presenta una dieta omnívora, como es frecuente en otros roedores de desierto, y consume en igual medida semillas, artrópodos y plantas halófitas. El ensamble acompañante está compuesto por no más de tres especies de pequeños mamíferos que varían según la localidad, siendo esta riqueza similar a otros sitios del Monte. La proporción de sexos y el patrón de dimorfismo sexual mostraron un marcado desvío hacia las hembras (H:M = 3.6:1.1 y H:M = 1.151 respectivamente. La morfología externa y craneal presenta una importante variabilidad intra e interpoblacional, sugiriendo que el aislamiento juega un rol importante. Cuando se consideraron adultos y juveniles, conjuntamente dos de las seis medidas externas (longitud total y longitud de cabeza y cuerpo y siete de las 22 medidas craneales resultaron significativamente mayores en hembras que en machos. Cuando se compararon solo los adultos, cuatro características externas (longitud total, longitud de cabeza y cuerpo, largo de la cola y peso y seis medidas craneales fueron significativamente mayores en hembras que en machos. Este trabajo refuerza la importancia del desarrollo de nuevos estudios más detallados sobre la historia de vida de S. delicatus y permite reafirmar la importancia de conservación de esta especie.The delicate mouse (Salinomys delicatus is a small rodent endemic of Argentina. It has been considered vulnerable to extinction because of its restricted and patchy distribution, small population size and specialization on salty habitats. Besides its morphological and physiological adaptations to survive in arid and salty habitats, there is still little information about the natural history of the delicate mouse. The objectives of our study are to study the natural history of S. delicatus, report new localities of occurrence, characterize its habitat use, diet and accompanying assemblages and describe its reproductive biology and morphology. We report two new localities of occurrences in gallery woodlands and salt flats in the northeast of Mendoza province (Argentina, these being the first records for this province. Like other South AAmerican rodents, S. delicatus has an omnivorous diet consisting in similar proportion of seeds, arthropods and halophytic plants. The assemblages are composed by no more than three small mammal species, varying according to the locality. Sex ratio and the pattern of sexual dimorphism shows a strong bias towards females (H:M = 3.6:1.1 and H:M = 1.151 respectively. External and cranial morphology exhibits a clear intra- and inter-population variability. When considering in the analysis adults and juvenile, two of six external measurements (head and body length and total length and seven of twenty-two cranial measurements were significantly higher in females than in males. When considering only adults, four external measures (total length, head and body length, tail length and weight and six cranial measurements were significantly higher in females than in males. This integrative analysis highlights the relevance of conducting further and more detailed studies on the natural history of S. delicatus and allows us to reassert the conservation importance of this species.

A new species of Eimeria Schneider, 1875 from the Serra dos Órgãos National Park, Rio de Janeiro, Brazil, with notes on its endogenous development in the montane grass mouse, Akodon montensis Thomas, 1913 (Rodentia: Sigmodontinae).

Science.gov (United States)

de Santana Miglionico, Marcos Tobias; Viana, Lúcio André; Barbosa, Helene Santos; Mota, Ester Maria; da Costa Neto, Sócrates Fraga; Frazão-Teixeira, Edwards; D'Andrea, Paulo Sergio

2018-02-01

A total of 53 specimens of the montane grass mouse, Akodon montensis Thomas, 1913 were collected in the Serra dos Órgãos National Park (SONP) in November 2014 and July 2015. The fecal material was analyzed, and a prevalence of 7.5% was recorded for a new coccidian species of the genus Eimeria Schneider, 1875, with part of its endogenous development recorded in the small intestine. The oocysts of a new coccidian species of genus Eimeria are ellipsoidal to subspherical. The wall is bi-layered, c. 1.5 μm (1.3-1.6 μm) thick, outer layer rough. Oocyst (n = 126) mean length is 25.3 μm (21.0-28.0 μm), with a width of 20.2 μm (17.0-22.0 μm) and mean length/width (L:W) ratio of 1.3 (1.2-1.4). Polar granule is present, with the oocyst residuum as a large spherical to subspherical globule. Sporocyst shape (n = 126) is ellipsoidal, with a mean length of 11.8 μm (9.3-14.4 μm), width of 7.9 μm (6.7-9.3 μm), and mean L:W ratio of 1.5 (1.4-1.7). Sporocysts with nipple-like Stieda body and sub-Stieda body are absent. A sporocyst residuum formed by several globules, usually along the sporocyst wall. This is the first record of Eimeria in the montane grass mouse from Brazil.

New species and new records of mites of the genus Stigmaeus(Acari: Prostigmata: Stigmaeidae) from Crimea.

Science.gov (United States)

Khaustov, Alexander A

2014-05-06

Three new species of the genus Stigmaeus Koch, 1836 (Acari: Stigmaeidae) are described from various habitats in Crimea: Stigmaeus kuznetsovi sp. nov. from nests of Microtus socialis (Rodentia: Cricetidae); S. mitrofanovi sp. nov. from galleries of Pityogenes bistridentatus (Coleoptera: Curculionidae) under the bark of Pinus pallasiana, and S. silvestris sp. nov. from rotten log of Pinus pallasiana. Stigmaeus corticeus Kuznetsov and Wainstein, 1977 and S. maraghehiensis Bagheri and Ueckermann, 2012 are recorded for the first time in Crimea. A key to species of the genus Stigmaeus of Crimea is provided.

Early growth of planted longleaf pine seedlings in relation to light, soil moisture, and soil temperature

Science.gov (United States)

Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker

2006-01-01

Drastic reductions in longleaf pine (Pinus palustris Mill.) acreage have led to an increased focus on regeneration of the longleaf pine ecosystem. Many areas require artificial regeneration for establishment, and site preparation techniques may be implemented to increase regeneration success. The objectives of this study were to determine differences...

Restoration of the Native Plant Communities in Longleaf Pine Landscapes on the Kisatchie National Forest, Louisiana

Science.gov (United States)

James D. Haywood; Alton Martin; Finis L. Harris; Michael L. Elliott-Smith

1998-01-01

In January 1993, the Kisatchie National Forest and Southern Research Station began monitoring the effects of various management practices on overstory and midstory trees, shrubs, and understory woody and herbaceous vegetation in several longleaf pine (Pinus palustris Mill.) stands. The monitoring of these stands is part of several Ecosystem...

Planning for an uncertain future: Restoration to mitigate water scarcity and sustain carbon sequestration

Science.gov (United States)

Steven T. Brantley; James M. Vose; David N. Wear; Larry Band

2018-01-01

The desired future conditions of longleaf pine (Pinus palustris) can be described by ecosystem structural characteristics as well as by the provision of ecosystem services. Although the desired structural characteristics of restored longleaf pine ecosystems have been described at length, these characteristics deserve a brief review here because...

Korte mededeling

NARCIS (Netherlands)

Rensen-Bronkhorst, R.; Spronk, J.

1983-01-01

Ludwigia palustris (L.) Elliot weer in Noord-Brabant gevonden. Geïnspireerd door leuke plantevondsten op de ijsbaan van Schijndel werd op 17 augustus 1983 door de plantenwerkgroep van de KNNV-afdeling Eindhoven een bezoek gebracht aan de Nuenense ijsbaan. Door de zeer droge zomer was het terreintje

Analyzing the complexity of cone production in longleaf pine by multiscale entropy

Science.gov (United States)

Xiongwen Chen; Qinfeng Guo; Dale G. Brockway

2016-01-01

The longleaf pine (Pinus palustris Mill.) forests are important ecosystems in the southeastern USA because of their ecological and economic value. Since European settlement, longleaf pine ecosystems have dramatically declined in extent, to the degree that they are now listed as endangered ecosystems. Its sporadic seed production, which...

Growth and mortality of pin oak and pecan reforestation in a constructed wetland: analysis with management implications

Science.gov (United States)

D.E. Henderson; P. Botch; J. Cussimanio; D. Ryan; J. Kabrick; D. Dey

2009-01-01

Pin oak (Quercus palustris Muenchh.) and pecan (Carya illinoensis (Wangenh.) K. Koch) trees were planted on reforestation plots at Four Rivers Conservation Area in west-central Missouri. The study was conducted to determine survival and growth rates of the two species under different production methods and environmental variables....

Within tree variation of lignin, extractives, and microfibril angle coupled with the theoretical and near infrared modeling of microfibril angle

Science.gov (United States)

Brian K. Via; chi L. So; Leslie H. Groom; Todd F. Shupe; michael Stine; Jan. Wikaira

2007-01-01

A theoretical model was built predicting the relationship between microfibril angle and lignin content at the Angstrom (A) level. Both theoretical and statistical examination of experimental data supports a square root transformation of lignin to predict microfibril angle. The experimental material used came from 10 longleaf pine (Pinus palustris)...

Impacts of logging and prescribed burning in longleaf pine forests managed under uneven-aged silviculture

Science.gov (United States)

Ferhat Kara; Edward Francis Loewenstein

2015-01-01

The longleaf pine (Pinus palustris Mill.) ecosystem has historically been very important in the southeastern United States due to its extensive area and high biodiversity. Successful regeneration of longleaf pine forests requires an adequate number of well distributed seedlings. Thus, mortality of longleaf pine seedlings during logging operations...

Ecological, political and social challenges of prescribed fire restoration in east Texas pineywoods ecosystems: a case study

Science.gov (United States)

Sandra Rideout; Brian P. Oswald; Michael H. Legg

2003-01-01

The effectiveness of prescribed fire restoration of forested sites in three state parks in east Texas, USA was studied. Two sites consisted of mixed shortleaf (Pinus echinata Mill.) or loblolly pine (Pinus taeda L.) and broadleaf overstoreys. The third site was a longleaf pine (Pinus palustris Mill.)/little...

Stable Transmission of Borrelia burgdorferi Sensu Stricto on the Outer Banks of North Carolina.

Science.gov (United States)

Levine, J F; Apperson, C S; Levin, M; Kelly, T R; Kakumanu, M L; Ponnusamy, L; Sutton, H; Salger, S A; Caldwell, J M; Szempruch, A J

2017-08-01

The spirochaete (Borrelia burgdorferi) associated with Lyme disease was detected in questing ticks and rodents during a period of 18 years, 1991-2009, at five locations on the Outer Banks of North Carolina. The black-legged tick (Ixodes scapularis) was collected at varied intervals between 1991 and 2009 and examined for B. burgdorferi. The white-footed mouse (Peromyscus leucopus), house mouse (Mus musculus) marsh rice rat (Oryzomys palustris), marsh rabbit (Sylvilagus palustris), eastern cottontail (Sylvilagus floridanus) and six-lined racerunner (Cnemidophorus sexlineatus) were live-trapped, and their tissues cultured to isolate spirochaetes. Borrelia burgdorferi isolates were obtained from questing adult I. scapularis and engorged I. scapularis removed from P. leucopus, O. palustris and S. floridanus. The prevalence of B. burgdorferi infection was variable at different times and sites ranging from 7 to 14% of examined questing I. scapularis. Mitochondrial (16S) rRNA gene phylogenetic analysis from 65 adult I. scapularis identified 12 haplotypes in two major clades. Nine haplotypes were associated with northern/Midwestern I. scapularis populations and three with southern I. scapularis populations. Sixteen isolates obtained from tick hosts in 2005 were confirmed to be B. burgdorferi by amplifying and sequencing of 16S rRNA and 5S-23S intergenic spacer fragments. The sequences had 98-99% identity to B. burgdorferi sensu stricto strains B31, JD1 and M11p. Taken together, these studies indicate that B. burgdorferi sensu stricto is endemic in questing I. scapularis and mammalian tick hosts on the Outer Banks of North Carolina. © 2016 Blackwell Verlag GmbH.

The social and economic drivers of the southeastern forest landscape

Science.gov (United States)

R. Kevin McIntyre; Barrett B. McCall; David N. Wear

2018-01-01

The last quarter century has witnessed an unprecedented resurgence of interest in the management of longleaf pine (Pinus palustris) forests, a phenomenon that has been coupled with increased understanding of the ecology, management, and restoration of these ecosystems. As interest in longleaf pine becomes more mainstream among landowners and the...

75 FR 31387 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Mississippi...

Science.gov (United States)

2010-06-03

...-- historically forest dominated by longleaf pine (Pinus palustris) --and isolated temporary wetland breeding... frequency and duration of severe storms and droughts (McLauglin et al. 2002, p. 6074; Golladay et al. 2004, p. 504; Seager et al. 2009, p. 5043). During a period of drought from 2004 to 2007, rainfall during...

Effects of spring prescribed fire on short-term, leaf-level photosynthesis and water use efficiency in longleaf pine

Science.gov (United States)

John K. Jackson; Dylan N. Dillaway; Michael C. Tyree; Mary Anne Sword Sayer

2015-01-01

Fire is a natural and important environmental disturbance influencing the structure, function, and composition of longleaf pine (Pinus palustris Mill.) ecosystems. However, recovery of young pines to leaf scorch may involve changes in leaf physiology, which could influence leaf water-use efficiency (WUE). This work is part of a larger seasonal...

Individual tree diameter, height, and volume functions for longleaf pine

Science.gov (United States)

Carlos A. Gonzalez-Benecke; Salvador A. Gezan; Timothy A. Martin; Wendell P. Cropper; Lisa J. Samuelson; Daniel J. Leduc

2014-01-01

Currently, little information is available to estimate individual tree attributes for longleaf pine (Pinus palustris Mill.), an important tree species of the southeastern United States. The majority of available models are local, relying on stem diameter outside bark at breast height (dbh, cm) and not including stand-level parameters. We developed...

Using existing growth models to predict RCW habitat development following site preparation: pitfalls of the process and potential growth response

Science.gov (United States)

Benjamin O. Knapp; Joan L. Walker

2013-01-01

Land managers throughout the Southeast are interested in restoring the longleaf pine (Pinus palustris Mill.) ecosystem, due in part to its value as habitat for the endangered red-cockaded woodpecker (Picoides borealis). In 2003, we established a study at Camp Lejeune, NC, to determine the effects of common site preparation...

Effects of canopy treatments on early growth of planted longleaf pine seedlings and ground vegetation in North Carolina: a preliminary study

Science.gov (United States)

Huifeng Hu; Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker

2013-01-01

We installed a field experiment to support the development of protocols to restore longleaf pine (Pinus palustris Mill.) to existing mature loblolly pine (P. taeda L.) stands at Camp Lejeune, NC. Seven canopy treatments included four uniform and three gap treatments. The four uniform treatments were defined by target residual basal...

Silvicultural treatments for converting loblolly pine to longleaf pine dominance: Effects on resource availability and their relationships with planted longleaf pine seedlings

Science.gov (United States)

Huifeng Hu; G.Geoff Wang; Joan L. Walker; Benjamin O. Knapp

2012-01-01

Throughout the southeastern United States, land managers are currently interested in converting loblolly pine (Pinus taeda L.) plantations to species rich longleaf pine (Pinus palustris Mill.) ecosystems. In a 3-year study on moderately well- to well-drained soils of the Lower Coastal Plain in North Carolina, we examined the...

Fire in longleaf pine stand management: an economic analysis

Science.gov (United States)

Rodney L. Busby; Donald G. Hodges

1999-01-01

A simulation analysis of the economics of using prescribed fire as a forest management tool in the management of longleaf pine (Pinus palustris Mill.) plantations was conducted. A management regime using frequent prescribed fire was compared to management regimes involving fertilization and chemical release, chemical control, and mechanical control. Determining the...

Longleaf pine site response to repeated fertilization and forest floor removal by raking and prescribed burning

Science.gov (United States)

Kim Ludovici; Robert Eaton; Stanley Zarnoch

2018-01-01

Removal of forest floor litter by pine needle raking and prescribed burning is a common practice in longleaf pine (Pinus palustris Mill.) stands on Coastal Plain sites in the Southeastern United States. Repeated removal of litter by raking and the loss of surface organic matter from controlled burns can affect the...

Seed Bank Viability in Disturbed Longleaf Pine Sites

Science.gov (United States)

Susan Cohen; Richard Braham; Felipe Sanchez

2004-01-01

Some of the most species-rich areas and highest concentrations of threatened and endangered species in the southeastern United States are found in wet savanna and flatwood longleaf pine (Pinus palustris Mill.) communities. Where intensive forestry practices have eliminated much of the natural understory of the longleaf ecosystem, the potential for...

Assessing tolerance of longleaf pine understory herbaceous plants to herbicide applications in a container nursery

Science.gov (United States)

D. Paul Jackson; Scott A. Enebak; James West; Drew Hinnant

2015-01-01

Renewed efforts in longleaf pine (Pinus palustris Mill.) ecosystem restoration has increased interest in the commercial production of understory herbaceous species. Successful establishment of understory herbaceous species is enhanced when using quality nursery-grown plants that have a better chance of survival after outplanting. Nursery growing practices have not been...

Stand conditions and tree characteristics affect quality of longleaf pine for red-cockaded woodpecker cavity trees

Science.gov (United States)

W.G. Ross; D.L. Kulhavy; R.N. Conner

1997-01-01

We measured resin flow of longleaf (Pinus palustris Mill.) pines in red-cockaded woodpecker (Picoides borealis Vieillot) clusters in the Angelina National Forest in Texas, and the Apalachicola National Forest in Florida. Sample trees were categorized as active cavity trees, inactive cavity trees and control trees. Sample trees were further...

Carbon Dynamics of Pinus palustris Ecosystems Following Drought

Directory of Open Access Journals (Sweden)

Gregory Starr

2016-04-01

Full Text Available Drought can affect forest structure and function at various spatial and temporal scales. Forest response and recovery from drought may be a result of position within landscape. Longleaf pine forests in the United States have been observed to reduce their carbon sequestration capacity during drought. We collected eddy covariance data at the ends of an edaphic longleaf pine gradient (xeric and mesic sites over seven years; two years of normal rainfall were followed by 2.5 years of drought, then 2.5 years of normal or slightly above-average rainfall. Drought played a significant role in reducing the physiological capacity of the sites and was compounded when prescribed fire occurred during the same periods. The mesic site has a 40% greater basal area then the xeric site, which accounts for its larger sequestration capacity; however, both sites show the same range of variance in fluxes over the course of the study. Following drought, both sites became carbon sinks. However, the xeric site had a longer carry-over effect and never returned to pre-drought function. Although this study encompassed seven years, we argue that longer studies with greater spatial variance must be undertaken to develop a more comprehensive understanding of forest response to changing climate.

Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

Directory of Open Access Journals (Sweden)

Schmidt Mumm Udo

2000-07-01

Full Text Available Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984, quién comparte la opinión de Schindler (1905 en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a esta subfamilia y poco después se señaló también el hallazgo del género Laurembergia Berg. (Mora-Osejo et al. 1988. En la actualidad, sin embargo, se ha generalizado la tendencia a considerar el género Gunnera separadamente en la familia Gunneraceae (Cronquist 1988, L. E. Mora-Osejo, como pers., con lo cual las Haloragaceae de Colombia se encuentran representadas por tres especies de los géneros Myriophyllum y Laurembergia.

Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

OpenAIRE

Schmidt Mumm Udo; Posada José Andrés

2000-01-01

Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984), quién comparte la opinión de Schindler (1905) en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a...

Structure and composition of historical longleaf pine ccosystems in Mississippi, USA

Science.gov (United States)

Brice B. Hanberry; Keith Coursey; John S. Kush

2018-01-01

Longleaf pine (Pinus palustris) historically was a widespread ecosystem composed of a simple tree canopy and grasslands ground layer. After widespread loss of this ecosystem due to logging and fire exclusion, little quantitative information exists about historical structure for restoration goals. We identified composition in De Soto National Forest and Pearl River...

The influence of canopy, sky condition, and solar angle on light quality in a longleaf pine woodland

Science.gov (United States)

Stephen D. Pecot; Stephen B. Horsley; Michael A. Battaglia; Robert J. Mitchell

2005-01-01

Light transmittance estimates under open, heterogeneous woodland canopies such as those of longleaf pine (Pinus palustris Mill.) forests report high spatial and temporal variation in the quantity of the light environment. In addition, light quality, that is, the ratio of red to far-red light (R:FR), regulates important aspects of plant...

A decision tree approach using silvics to guide planning for forest restoration

Science.gov (United States)

Sharon M. Hermann; John S. Kush; John C. Gilbert

2013-01-01

We created a decision tree based on silvics of longleaf pine (Pinus palustris) and historical descriptions to develop approaches for restoration management at Horseshoe Bend National Military Park located in central Alabama. A National Park Service goal is to promote structure and composition of a forest that likely surrounded the 1814 battlefield....

Are we over-managing longleaf pine?

Science.gov (United States)

John S. Kush; Rebecca J. Barlow; John C. Gilbert

2012-01-01

Longleaf pine (Pinus palustris Mill.) is not loblolly (Pinus taeda L.) or slash pine (Pinus elliottii L.). There is the need for a paradigmatic shift in our thinking about longleaf pine. All too often we think of longleaf as an intolerant species, slow-grower, difficult to regenerate, and yet it dominated the pre...

A whole stand growth and yield system for young longleaf pine plantations in Southwest Georgia

Science.gov (United States)

John R. Brooks; Steven B. Jack

2006-01-01

A whole stand growth and yield system for planted longleaf pine (Pinus palustris Mill.) was developed from permanent plot data collected annually over an 8 year period. The dataset consists of 12 intensively-managed longleaf pine plantations that are located in Lee, Worth, Mitchell, and Baker counties in southwest Georgia. Stand survival, dominant...

Understory fuel variation at the Carolina Sandhills National Wildlife Refuge: a description of chemical and physical properties

Science.gov (United States)

Evelyn S. Wenk; G. Geoff Wang; Joan L. Walker

2013-01-01

Upland forest in the Carolina Sandhills National Wildlife Refuge is characterized by a longleaf pine (Pinus palustris) canopy with a variable understory and ground-layer species composition. The system was historically maintained by fire and has been managed with prescribed fire in recent decades. A management goal is to reduce turkey oak (...

The quest for methods to identify longleaf pine stump relicts in Southeastern Virginia

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Chi-Leung So; Arvind A.R. Bhuta; Karen G. Reed

2015-01-01

The discovery of lightwood and turpentine stumps in southeastern Virginia raised questions about the true historical range for longleaf pine (Pinus palustris Mill.). Several investigative studies were therefore carried out to develop a method to determine the taxa of these relicts. Chemical approaches included the use of near infrared (NIR) spectroscopy coupled with...

Protecting and restoring longleaf pine forests on the Kisatchie National Forest in Louisiana

Science.gov (United States)

James D. Haywood; Michael Elliot-Smith; Finis Harris; Alton Martin

2000-01-01

Longleaf pine (Pinus palustris Mill.) forests once constituted a major ecosystem in the Southern United States stretching from southeastern Virginia south to central Florida and west into East Texas. These forests covered a wide range of site conditions, from wet pine flatwoods to dry mountain slopes. Intensive exploitation reduced the extent of old-...

Introducing close-range photogrammetry for characterizing forest understory plant diversity and surface fuel structure at fine scales

Science.gov (United States)

Benjamin C. Bright; E. Louise Loudermilk; Scott M. Pokswinski; Andrew T. Hudak; Joseph J. O' Brien

2016-01-01

Methods characterizing fine-scale fuels and plant diversity can advance understanding of plant-fire interactions across scales and help in efforts to monitor important ecosystems such as longleaf pine (Pinus palustris Mill.) forests of the southeastern United States. Here, we evaluate the utility of close-range photogrammetry for measuring fuels and plant...

The role of large container seedlings in afforesting oaks in bottomlands

Science.gov (United States)

Daniel C. Dey; John M. Kabrick; Michael Gold

2006-01-01

We planted large container (RPM®) and 1-0 bareroot seedlings of pin oak (Quercus palustris Muenchh.) and swamp white oak (Q. bicolor Willd.) in crop fields in the Missouri River floodplain. We also evaluated the benefits of soil mounding and a grass (Agrostis gigantea Roth) cover crop. RPM®) oak seedlings had significantly greater...

Picloram Movement in Soil Solution and Streamflow from a Coastal Plain Forest

Science.gov (United States)

Jerry L. Michael; D.G. Neary; M.J.M. Wells

1989-01-01

Picloram (4-amino-3,5,6-trichloropicolinic acid) was aerially applied to P longleaf pine (Pinus palustris L.) site in the upper constnl plain of Alabama to control kudzu [Purraria lobota (Willd.) Ohwi]. Pellets (10% a.i.) were spread at the rate of 56 kg ha-1 on loamy sand Typic Knnhspludult soils....

Fertilizer responses of longleaf pine trees within a loblolly pine plantation: separating direct effects from competition effects

Science.gov (United States)

Peter H Anderson; Kurt H. Johnsen

2009-01-01

Evidence is mixed on how well longleaf pine (Pinus palustris Mill.) responds to increased soil nitrogen via fertilization. We examined growth and physiological responses of volunteer longleaf pine trees within an intensive loblolly pine (Pinus taeda L.) fertilization experiment. Fertilizer was applied annually following thinning at age 8 years (late 1992) at rates...

Financial performance of loblolly and longleaf pine plantations

Science.gov (United States)

Steven D. Mills; Charles T. Stiff

2013-01-01

The financial performance of selected management regimes for loblolly (Pinus taeda L.) and longleaf pine (P. palustris Mill.) plantations were compared for four cases, each with low- and high-site productivity levels and each evaluated using 5 and 7 percent real discount rates. In all cases, longleaf pine was considered both with...

Longleaf and loblolly pine seedlings respond differently to soil compaction, water content, and fertilization

Science.gov (United States)

D. Andrew Scott; James A. Burger

2014-01-01

Aims Longleaf pine (Pinus palustris Mill.) is being restored across the U.S. South for a multitude of ecological and economic reasons, but our understanding of longleaf pine’s response to soil physical conditions is poor. On the contrary, our understanding of loblolly pine (Pinus taeda L.) root and...

Modeling survival, yield, volume partitioning and their response to thinning for longleaf pine plantations

Science.gov (United States)

Carlos A. Gonzalez-Benecke; Salvador A. Gezan; Daniel J. Leduc; Timothy A. Martin; Wendell P. Cropper Jr; Lisa J Samuelson

2012-01-01

Longleaf pine (Pinus palustris Mill.) is an important tree species of the southeast U.S. Currently there is no comprehensive stand-level growth and yield model for the species. The model system described here estimates site index (SI) if dominant height (Hdom) and stand age are known (inversely, the model can project H

Oligocene stratigraphy across the Eocene and Miocene boundaries in the Valley of Lakes (Mongolia).

Science.gov (United States)

Daxner-Höck, Gudrun; Badamgarav, Demchig; Barsbold, Rinchen; Bayarmaa, Baatarjav; Erbajeva, Margarita; Göhlich, Ursula Bettina; Harzhauser, Mathias; Höck, Eva; Höck, Volker; Ichinnorov, Niiden; Khand, Yondon; López-Guerrero, Paloma; Maridet, Olivier; Neubauer, Thomas; Oliver, Adriana; Piller, Werner; Tsogtbaatar, Khishigjav; Ziegler, Reinhard

2017-01-01

Cenozoic sediments of the Taatsiin Gol and TaatsiinTsagaan Nuur area are rich in fossils that provide unique evidence of mammal evolution in Mongolia. The strata are intercalated with basalt flows. 40 Ar/ 39 Ar data of the basalts frame the time of sediment deposition and mammal evolution and enable a composite age chronology for the studied area. We investigated 20 geological sections and 6 fossil localities of Oligocene and early Miocene deposits from this region. Seventy fossil beds yielded more than 19,000 mammal fossils. This huge collection encompasses 175 mammal species: 50% Rodentia, 13% Eulipotyphla and Didelphomorphia, and 12% Lagomorpha. The remaining 25% of species are distributed among herbivorous and carnivorous large mammals. The representation of lower vertebrates and gastropods is comparatively poor. Several hundred SEM images illustrate the diversity of Marsupialia, Eulipotyphla, and Rodentia dentition and give insight into small mammal evolution in Mongolia during the Oligocene and early Miocene. This dataset, the radiometric ages of basalt I (∼31.5 Ma) and basalt II (∼27 Ma), and the magnetostratigraphic data provide ages of mammal assemblages and time ranges of the Mongolian biozones: letter zone A ranges from ∼33 to ∼31.5 Ma, letter zone B from ∼31.5 to ∼28 Ma, letter zone C from ∼28 to 25.6 Ma, letter zone C1 from 25.6 to 24 Ma, letter zone C1-D from 24 to ∼23 Ma, and letter zone D from ∼23 to ∼21 Ma.

Parasitic arthropods of some wild rodents from Juréia-Itatins Ecological Station, State of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Bossi David Eduardo Paolinetti

2002-01-01

Full Text Available A study of the associations between three species of rodents in the Atlantic forest and their parasitic arthropods was undertaken at the Juréia-Itatins Ecological Station, located in the State of São Paulo, Southeastern Brazil, from March 1989 to February 1990. Individuals of three species, Oryzomys russatus, Proechimys iheringi and Nectomys squamipes were captured and examined for ectoparasites. Eleven species of parasitic arthropods were found, including four species of insects and seven of Acari. Parasitism intensity, phenology, and rainfall were positively correlated with the abundance of the ectoparasites and their hosts. The most abundant host was O. russatus (Muridae: Sigmodontinae, and the most common parasite on it was the laelapid mite Gigantolaelaps oudemansi. The cuterebrid Metacuterebra apicalis caused myiasis in O. russatus. A mutualistic association between the staphylinid beetle Amblyopinus sp. and its host P. iheringi (Echimyidae was observed. The few N. squamipes captured had small numbers of ectoparasites.

What 45 years of RLGS data has to say about longleaf pine mortality - not much

Science.gov (United States)

John S. Kush; John C. Gilbert; Rebecca J. Barlow

2015-01-01

The original longleaf pine (Pinus palustris Mill.) forest was self-perpetuating where seedlings always had to be present. It reproduced itself in openings in the overstory where dense young stands developed. These openings would range from a few tenths of an acre to large openings of several thousand acres. Regardless of the event size, longleaf...

Ecological restoration of an old-growth longleaf pine stand utilizing prescribed fire

Science.gov (United States)

J. Morgan Varner; John S. Kush; Ralph S. Meldahl

2000-01-01

Ecological restoration using prescribed fire has been underway for 3 years in an uncut, old-growth longleaf pine (Pinus palustris) stand located in south Alabama. The longleaf pine ecosystem requires frequent (once every 1-10 years) surface fire to prevent succesion to later several stages. Before this study began, this stand had not burned in >...

North American Lauraceae: terpenoid emissions, relative attraction and boring preferences of redbay ambrosia beetle, Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae).

Science.gov (United States)

Paul E. Kendra; Wayne S. Montgomery; Jerome Niogret; Grechen E. Pruett; Albert (Bud) Mayfield; Martin MacKenzie; Mark A. Deyrup; Gary R. Bauchan; Randy C. Ploetz

2014-01-01

Abstract The invasive redbay ambrosia beetle, Xyleborus glabratus, is the primary vector of Raffaelea lauricola, a symbiotic fungus and the etiologic agent of laurel wilt. This lethal disease has caused severe mortality of redbay (Persea borbonia) and swampbay (P. palustris) trees in the southeastern USA, threatens avocado (P. americana) production in Florida, and has...

On the number of genes controlling the grass stage in longleaf pine

Science.gov (United States)

C. Dana Nelson; C. Weng; Thomas L. Kubisiak; M. Stine; C.L. Brown

2003-01-01

The grass stage is an inherent and distinctive developmental trait of longleaf pine (Pinus palustris), in which height growth in the first few years after germination is suppressed. In operational forestry practice the grass stage extends for nvo to several years and often plays a role in planting failures and decisions to plant alternative species....

Insect Pollinators of Three Rare Plants in a Florida Longleaf Pine Forest

Science.gov (United States)

Theresa Pitts-Singer; James L. Hanula; Joan L. Walker

2002-01-01

As a result of human activity, longleaf pine (Pinus palustris Miller) forests in the southern United States have been lost or drastically altered. Many of the plant species that historically occupied those forests now persist only as remnants and are classified as threatened or endangered. In order to safeguard such species, a better understanding of...

Longleaf Pine: An Updated Bibliography

Science.gov (United States)

John S. Kush; Ralph S. Meldahl; William D. Boyer; Charles K. McMahon

1996-01-01

The longleaf pine (Pinus palustris Mill.) forest figured prominently in the cultural and economic development of the South. What was once one of the most extensive forest ecosystems in North America has now become critically endangered (6). At the time of European settlement, this ecosystem dominated as much as 92 million acres throughout the...

Use of weathered diesel oil as a low-cost raw material for biosurfactant production

Directory of Open Access Journals (Sweden)

A. P. Mariano

2008-06-01

Full Text Available This work aimed to investigate the capability of biosurfactant production by Staphylococcus hominis, Kocuria palustris and Pseudomonas aeruginosa LBI, using weathered diesel oil from a long-standing spillage as raw material. The effect of the culture media (Robert or Bushnell-Haas and of the carbon source (spilled diesel oil or commercial diesel oil on biosurfactant production was evaluated. Erlenmeyer flasks (250 mL containing the cell broth were agitated (240 rpm for 144 h at 27±2ºC. Biosurfactant production was monitored according to the De Nöuy ring method using a Krüss K6 tensiometer. Considering the possibility of intracellular storage of biosurfactant in the cell wall of the cultures S. hominis and K. palustris, experiments were also done applying ultrasound as a way to rupture the cells. For the conditions studied, the cultures did not indicate production of biosurfactants. Results obtained with a hydrocarbon biodegradability test based on the redox indicator 2,6-dichlorophenol indophenol showed that only the commercial diesel was biodegraded by the cultures.

Fossil Vertebrates and peleomagnetism update of one of the earlier stages of cave evolution in the classical karst, Slovenia: pliocene of Črnotiče II site and Račiška Pečina

Czech Academy of Sciences Publication Activity Database

Horáček, I.; Mihevc, A.; Zupan Hajna, N.; Pruner, Petr; Bosák, Pavel

2007-01-01

Roč. 36, č. 3 (2007), s. 453-468 ISSN 0583-6050 R&D Projects: GA AV ČR IAA300130701; GA AV ČR IAA3013201 Grant - others:Ministry of Science of Slovenia and Slovenian Research Agency(SI) P6-0119-0618; Ministry of Science of Slovenia and Slovenian Research Agency(SI) J6-3035-0618-01; Ministry of Science of Slovenia and Slovenian Research Agency(SI) J6-6345-0618-04 Institutional research plan: CEZ:AV0Z30130516 Keywords : cave sediments * magnetostratigraphy * mammals * Soricomorpha * Rodentia Subject RIV: DB - Geology ; Mineralogy http://carsologica.zrc-sazu.si/downloads/363/10horacek.pdf

Competitive responses of seedlings and understory plants in longleaf pine woodlands: separating canopy influences above and below ground

Science.gov (United States)

Stephen D. Pecot; Robert J. Mitchell; Brian J. Palik; Barry Moser; J. Kevin Hiers

2007-01-01

A trenching study was used to investigate above- and below-ground competition in a longleaf pine (Pinus palustris P. Mill.) woodland. Trenched and nontrenched plots were replicated in the woodland matrix, at gap edges, and in gap centers representing a range of overstory stocking. One-half of each plot received a herbicide treatment to remove the...

Analysis of seasonal, diurnal, and noctural growth patterns of young longleaf pine

Science.gov (United States)

John C. Gilbert; Ralph S. Meldahl; John S. Kush; William D. Boyer

2006-01-01

Forty longleaf pine (Pinus palustris Mill.) trees initially ranging from 1 to 1.5 m in height were measured on the Escambia Experimental Forest from 1969 through 1980. The trees were evenly divided between two soil types. From 1969 through 1970, height and diameter measurements were recorded one to four times weekly during the growing seasons and...

Overhead shading and growth of young longleaf pine

Science.gov (United States)

John C. Gilbert; John S. Kush; Ralph S. Meldahl; William D. Boyer; Dean H. Gjerstad

2014-01-01

A study to determine the effects of environmental conditions on the growth of longleaf pine (Pinus palustris Mill.) was initiated in 1969 on the Escambia Experimental Forest near Brewton, Alabama, USA. This study sample consisted of forty young naturally regenerated, even aged longleaf pine seedlings evenly divided between two soil types. At the beginning of the study...

Spatial analysis of longleaf pine stand dynamics after 60 years of management

Science.gov (United States)

John C. Gilbert; John S. Kush; Rebecca J. Barlow

2012-01-01

There are still many questions and misconceptions about the stand dynamics of naturally-regenerated longleaf pine (Pinus palustris Mill.). Since 1948, the “Farm Forty,” a forty-acre tract located on the USDA Forest Service Escambia Experimental Forest near Brewton, Alabama, has been managed to create high quality wood products, to successfully...

Prescribed fire effects in a longleaf pine ecosystem--are winter fires working?

Science.gov (United States)

Rebecca J. Barlow; John S. Kush; John C. Gilbert; Sharon M. Hermann

2015-01-01

Longleaf pine (Pinus palustris Mill.) ecosystems once dominated 60 to 90 million acres and supported one of the most diverse floras in North America. It is well-known that longleaf pine ecosystems must burn frequently to maintain natural structure and function. This vegetation type ranks as one of the most fire-dependent in the country and must...

Chesapeake Bay Low Freshwater Inflow Study. Biota Assessment. Phase I. Appendices.

Science.gov (United States)

1980-08-01

Resources Coastal Resources Power Plant Siting Maryland Geological Survey Maryland Environmental Health Administration university of Maryland Marine...are very common: Acorus calamus Polygonum spp. Hibiscus palustris Pontederia cordata Leersia spp. Sagittaria latifolia Nuphar leiteum Typha... Hibiscus ) penetrate to mesohaline salinities. In general, the fresh water marsh associations are limited to areas upstream of 3 - 50Xsalinity

Air lateral root pruning affects longleaf pine seedling root system morphology

Science.gov (United States)

Shi-Jean Susana Sung; Dave Haywood

2016-01-01

Longleaf pine (Pinus palustris) seedlings were cultured with air lateral root pruning (side-vented containers, VT) or without (solid-walled containers, SW). Seedling root system morphology and growth were assessed before planting and 8 and 14 months after planting. Although VT seedlings had greater root collar diameter than the SW before planting,...

Site Index Curves for Direct-Seeded Loblolly and Longleaf Pines in Louisiana

Science.gov (United States)

Quang V. Cao; V. Clark Baldwin; Richard E. Lohrey

1995-01-01

Site index equations were developed for direct-seeded loblollypine (Pinus taeda L.) and longleaf pine (Pinus palustris Mill.) based on data from 148 and 75 permanent plots, respectively. These plots varied from 0.053 to 0.119 ac in size, and were established in broadcast, row, and spot seeded stands throughout Louisiana. The Bailey and Clutter (1974) model was...

Long-term effects of biennial prescribed fires on the growth of longleaf pine

Science.gov (United States)

William D. Boyer

2000-01-01

The effects of several hardwood control treatments on understory succession and overstory growth have been followed for 22 years on a Coastal Plain site in southwest Alabama. The study began in 1973, with 12 treatment combinations in 14-year-old naturally established longleaf pine (Pinus palustris) thinned to about 1,236 stems per hectare (500 stems...

Surfing the Koehler Curve: revisiting a method for the identification of longleaf pine stumps and logs

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Karen G. Reed

2009-01-01

Measurements of pith and second growth ring diameters were used by Koehler in 1932 to separate longleaf pine (Pinus palustris Mill.) timbers from those of several southern pines (e.g., loblolly, shortleaf). In the current study, measurements were taken from plantation-grown longleaf, loblolly and shortleaf pine trees, as well as old growth longleaf pine, lightwood, and...

Revivification of a method for identifying longleaf pine timber and its application to southern pine relicts in southeastern Virginia

Science.gov (United States)

Thomas L. Eberhardt; Philip M. Sheridan; Arvind A.R. Bhuta

2011-01-01

Abstract: Longleaf pine (Pinus palustris Mill.) cannot be distinguished from the other southern pines based on wood anatomy alone. A method that involves measuring pith and second annual ring diameters, reported by Arthur Koehler in 1932 (The Southern Lumberman, 145: 36–37), was revisited as an option for identifying longleaf pine timbers and stumps. Cross-section...

Arthropod density and biomass in longleaf pines: effects of pine age and hardwood midstory

Science.gov (United States)

Richard N. Conner; Christopher S. Collins; Daniel Saenz; Toni Trees; Richard R. Schaefer; D. Craig Rudolph

2004-01-01

During a 2-year study we examined arthropod communities (density and biomass) on longleaf pines (Pinus palustris) in eastern Texas during spring, summer, and winter on trees in 3 age classes: 40-50, 60-70, and 130-1 50 years, as a potential food source for the red-cockaded woodpecker (Picoides borealis). We also examined arthropod...

Ground-dwelling arthropod association with coarse woody debris following long-term dormant season prescribed burning in the longleaf pine flatwoods of North Carolina

Science.gov (United States)

James L Hanula; Dale Wade; Joseph O' Brien; Susan Loeb

2009-01-01

A 5-year study of long-term (40 years) study plots was conducted on the Osceola National Forest in northern Florida to determine how dormant-season fire frequency (annual, biennial, quadrennial, or unburned) affects ground-dwelling macroarthropod use of coarse woody debris in longleaf pine (Pinus palustris Mill.) forests. Pitfall traps were used to sample arthropods...

Thickness and roughness measurements for air-dried longleaf pine bark

Science.gov (United States)

Thomas L. Eberhardt

2015-01-01

Bark thicknesses for longleaf pine (Pinus palustris Mill.) were investigated using disks collected from trees harvested on a 70-year-old plantation. Maximum inner bark thickness was relatively constant along the tree bole whereas maximum outer bark thickness showed a definite decrease from the base of the tree to the top. The minimum whole bark thickness followed the...

Preliminary Guide to the Onsite Identification and Delineation of the Wetlands of the South Atlantic United States.

Science.gov (United States)

1982-05-01

shield) Ceratophyilum demersum (Coontail) Myriophyllum spp. (Watermilfoil) Nelumbo lutea ( American lotus) Nuphar luteum (Spatterdock) Nymphaea odorata...Overcup oak) Quercus palustris (Pin oak) Quercus phelios (Willow oak) Ulmus americana ( American elm) UlmuS rubra (Slippery elm) c. Atlantic White...var. biflora (Swamp black gum) Persea borbonia (Red bay) Pinus serotina (Pond pine) Smilax laurifolia (Bamboo vine) Sphagnum spp. (Sphagnum moss

Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing the Functions of Headwater Slope Wetlands on the Mississippi and Alabama Coastal Plans

Science.gov (United States)

2007-08-01

sourwood Bignonia capreolata crossvine Panicum virgatum switchgrass Callicarpa americana American beautyberry Persea borbonia redbay Calystegia sepium...sweetbay (Magnolia virginiana), loblolly-bay (Gordonia lasianthus), redbay ( Persea borbonia), and swamp bay ( Persea palustris) make up a significant...com- munity model. The Society of American Foresters (Eyre 1980) recognizes a “Sweetbay- Swamp Tupelo (Nyssa sylvatica var. biflora)-Redbay” forest

Early density management of longleaf pine reduces susceptibility to ice storm damage

Science.gov (United States)

Timothy B. Harrington; Thaddeus A. Harrington

2016-01-01

The Pax winter storm of February 2014 caused widespread damage to forest stands throughout the southeastern U.S. In a long-term study of savanna plant community restoration at the Savannah River Site, Aiken, SC, precommercial thinning (PCT) of 8- to 11-year-old plantations of longleaf pine (Pinus palustris) in 1994 reduced...

Influence of herbicides and felling, fertilization, and prescribed fire on longleaf pine growth and understory vegetation through ten growing seasons and the outcome of an ensuing wildfire

Science.gov (United States)

James D. Haywood

2011-01-01

Restoring longleaf pine (Pinus palustris Mill.) over much of its original range requires artificial regeneration. In central Louisiana, USA, two fertilization levels - No (NF) or Yes (F-36 kg/ha N and 40 kg/ha P) in combination with three vegetation treatments - Check, four prescribed fires (PF), or multi-year vegetation control by herbicidal and mechanical means (IVM...

Carbon sequestration and natural longleaf pine ecosystems

Science.gov (United States)

Ralph S. Meldahl; John S. Kush

2006-01-01

A fire-maintained longleaf pine (Pinus palustris Mill.) ecosystem may offer the best option for carbon (C) sequestration among the southern pines. Longleaf is the longest living of the southern pines, and products from longleaf pine will sequester C longer than most since they are likely to be solid wood products such as structural lumber and poles....

Modeling the effects of forest management on in situ and ex situ longleaf pine forest carbon stocks

Science.gov (United States)

C.A. Gonzalez-Benecke; L.J. Samuelson; T.A. Martin; W.P. Cropper Jr; Kurt Johnsen; T.A. Stokes; John Butnor; P.H. Anderson

2015-01-01

Assessment of forest carbon storage dynamics requires a variety of techniques including simulation models. We developed a hybrid model to assess the effects of silvicultural management systems on carbon (C) budgets in longleaf pine (Pinus palustris Mill.) plantations in the southeastern U.S. To simulate in situ C pools, the model integrates a growth and yield model...

Impact of fire in two old-growth montane longleaf pine stands

Science.gov (United States)

John S. Kush; John C. Gilbert; Crystal Lupo; Na Zhou; Becky Barlow

2013-01-01

The structure of longleaf pine (Pinus palustris Mill.) forests of the Southeastern United States Coastal Plains has been the focus of numerous studies. By comparison, the forests in the mountains of Alabama and Georgia are not well understood. Less than 1 percent of longleaf pine stands found in the montane portion of longleaf’s range are considered...

Weather effects on the success of longleaf pine cone crops

Science.gov (United States)

Daniel J. Leduc; Shi-Jean Susana Sung; Dale G. Brockway; Mary Anne Sword Sayer

2016-01-01

We used National Oceanic and Atmospheric Administration weather data and historical records of cone crops from across the South to relate weather conditions to the yield of cones in 10 longleaf pine (Pinus palustris Mill.) stands. Seed development in this species occurs over a three-year time period and weather conditions during any part of this...

Final Environmental Assessment for Aircraft Maintenance Operations Center

Science.gov (United States)

2014-06-01

lies within the Southern Mixed Forest Province that is typically characterized by forests of broadleaf deciduous and needleleaf evergreen trees ...virginiana), pin oak (Q. palustris), and southern magnolia (Magnolia grandiflora). Small tree and shrub species include the eastern red cedar, eastern ...this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Washington

Cavity size and copper root pruning affect production and establishment of container-grown longleaf pine seedlings

Science.gov (United States)

Marry Anne Sword Sayer; James D. Haywood; Shi-Jean Susana Sung

2009-01-01

With six container types, we tested the effects of cavity size (i.e., 60, 93, and 170 ml) and copper root pruning on the root system development of longleaf pine (Pinus palustris Mill.) seedlings grown in a greenhouse. We then evaluated root egress during a root growth potential test and assessed seedling morphology and root system development 1 year after planting in...

Root system architecture: The invisible trait in container longleaf pine seedlings

Science.gov (United States)

Shi-Jean Susana Sung; R. Kasten Dumroese

2013-01-01

Longleaf pine (Pinus palustris Mill.) seedlings cultured in four cavity volumes (60 to 336 ml [3.7 to 20.5 cubic inches]), two root pruning treatments (with or without copper coating), and 3 nitrogen levels (low to high) were grown for 29 weeks before they were outplanted into an open area in central Louisiana. Twenty-two months after outplanting, 3 seedlings were...

Effects of container cavity size and copper coating on field performance of container-grown longleaf pine seedlings

Science.gov (United States)

Shi-Jean Susana Sung; James D. Haywood; Mary A. Sword-Sayer; Kristina F. Connor; D. Andrew Scott

2010-01-01

Longleaf pine (Pinus palustris Mill.) seedlings were grown for 27 weeks in 3 container cavity sizes [small (S), medium (M), and large (L)], and half the containers were coated with copper (Cu). In November 2004, we planted 144 seedlings from each of 6 container treatments in each of 4 replications in central LA. All plots were burned in February 2006...

The hip adductor muscle group in caviomorph rodents: anatomy and homology.

Science.gov (United States)

García-Esponda, César M; Candela, Adriana M

2015-06-01

Anatomical comparative studies including myological data of caviomorph rodents are relatively scarce, leading to a lack of use of muscular features in cladistic and morphofunctional analyses. In rodents, the hip adductor muscles constitute an important group of the hindlimb musculature, having an important function during the beginning of the stance phase. These muscles are subdivided in several distinct ways in the different clades of rodents, making the identification of their homologies hard to establish. In this contribution we provide a detailed description of the anatomical variation of the hip adductor muscle group of different genera of caviomorph rodents and identify the homologies of these muscles in the context of Rodentia. On this basis, we identify the characteristic pattern of the hip adductor muscles in Caviomorpha. Our results indicate that caviomorphs present a singular pattern of the hip adductor musculature that distinguishes them from other groups of rodents. They are characterized by having a single m. adductor brevis that includes solely its genicular part. This muscle, together with the m. gracilis, composes a muscular sheet that is medial to all other muscles of the hip adductor group. Both muscles probably have a synergistic action during locomotion, where the m. adductor brevis reinforces the multiple functions of the m. gracilis in caviomorphs. Mapping of analyzed myological characters in the context of Rodentia indicates that several features are recovered as potential synapomorphies of caviomorphs. Thus, analysis of the myological data described here adds to the current knowledge of caviomorph rodents from anatomical and functional points of view, indicating that this group has features that clearly differentiate them from other rodents. Copyright © 2015 Elsevier GmbH. All rights reserved.

Lung and hearth nematodes in some Spanish mammals.

Science.gov (United States)

Alvarez, F; Iglesias, R; Bos, J; Rey, J; Sanmartin Durán, M L

1991-01-01

Thirteen host species belonging to the orders Rodentia, Insectivora and Carnivora from various localities in Galicia (NW Spain) were examined for heart and lung parasites. The following species were found: Parastrongylus dujardini (5.5%) in Apodemus sylvaticus, Crenosoma striatum in Erinaceus europaeus (83%), Angiostrongylus vasorum, Crenosoma vulpis and Eucoleus aerophilus in Vulpes vulpes (3, 3.46 and 0.50%, respectively), Crenosoma taiga in Putorius putorius (100%) and Crenosoma sp. in Meles meles (25%). In Crocidura russula nematode larvae were found (3.3%). Mus musculus, Rattus norvegicus, Rattus rattus, Talpa caeca, Sorex araneus, Genetta genetta and Canis lupus were not parasitized by lung or heart parasites.

Distribución geográfica de Boeckella y Neoboeckella (Calanoida: Centropagidae en el Perú

Directory of Open Access Journals (Sweden)

Iris Samanez

2014-12-01

Full Text Available El análisis de muestras de plancton colectadas en diferentes localidades a lo largo de los Andes peruanos, dieron como resultado el registro de siete especies de Boeckella (gracilis, gracilipes, calcaris, poopoensis, occidentalis, titicacae y palustris y dos de Neoboeckella (kinzeli y loffleri. Todas las especies citadas, exceptuando a las especies de Neoboeckella, fueron registradas en la cuenca del lago Titicaca (Puno. Además, B. palustris, B. gracilipes y B. calcaris fueron también reportadas en Moquegua, Apurímac y Pasco (Andes del sur y central. Boeckella titicacae parece estar restringida a la cuenca del lago Titicaca. Boeckella poopoensis ocurre en cuerpos de agua con elevada conductividad reportándose sólo en Las Salinas en Arequipa. Boeckella occidentalis fue la especie con mayor rango de distribución desde el sur en Puno hasta el norte en Cajamarca y se registra por primera vez para el país Neoboeckella loffleri. Las muestras están depositadas en la Colección de Plancton del Departamento de Limnología del Museo de Historia Natural de la Universidad Nacional Mayor de San Marcos, Lima-Perú.

Fire Science Strategy: Resource Conservation and Climate Change

Science.gov (United States)

2014-09-01

are southern yellow pine ( Pinus spp.; this currently includes over 0.6 million acres of managed longleaf pine [P. palustris], Robert Larimore, pers...Prosopis spp.), pinyon ( Pinus spp.)-juniper (Juniperus spp.), and chaparral-type ecosystems, and 0.7 million acres of annual and perennial grasslands...that meet current and future military land-use and stewardship objectives. Under current conditions, the presence of insects, disease, and drought

Destroyed virgin longleaf pine stand lives-on digitally

Science.gov (United States)

John C. Gilbert; S. Kush; Rebecca J. Barlow

2015-01-01

The Flomaton Natural Area (FNA) once stood as one of the few remnant fragments of virgin, old-growth longleaf pine stands (Pinus palustris Mill.) in the Southeast. This 80-acre stand contained trees over 200 years old. A restoration effort began in 1994 to remove off-site trees and to reintroduce fire to the site after over 40 years of fire suppression. A geographic...

Application of Hyperspectal Techniques to Monitoring & Management of Invasive Plant Species Infestation

Science.gov (United States)

2008-01-09

Scirpus olnei, S. robustus, Hibiscus palustris, Eryngium virginianum. 1. Common reed (Phragmites australis) - large cane or bamboo-like grass...Index 2 760 695 R R plant stress status Zarco-Tejada (1998) PI3, Pigment Index 3 690 440 R R vegetation health , based on chlorophyll fluorescence...ratios Lichtenthaler et al. (1996) PI4, Pigment Index 4 740 440 R R vegetation health , based on chlorophyll fluorescence ratios

Demonstration and Certification of Amphibian Ecological Risk Assessment Protocol

Science.gov (United States)

2009-04-01

pools observed on site persist through the breeding season and long enough for the larvae to metamorphose, suitable amphibian breeding habitat exists in...frog (R. palustris): vocalizations • Fairy shrimp (Eubranchipus sp.): dip net • Isopoda: dip net • Unknown water beetle (Coleoptera): dip net...oxygen-lacking) conditions that favor the growth and regeneration of hydrophytic vegetation)) to amphibians. This test procedure uses larvae of the

Location and Description of Transects for Ecological Studies in Floodplain Forests of the Lower Suwannee River, Florida

Science.gov (United States)

2002-01-01

Level Datum of 1929. Horizontal datum: In this report, horizontal coordinate information is referenced to the North American Datum of 1927 (NAD27...ileopa Ilex opaca Ait. var. opaca American holly junsil Juniperus silicicola (Small) Bailey 1 southern red cedar liqsty Liquidambar styraciflua L...swamp gum nyssyl Nyssa sylvatica Marsh.1 blackgum ostvir Ostrya virginiana (Mill.) K. Koch eastern hophornbeam perpal Persea palustris (Raf.) Sarg

Vegetation in the Forsmark biotest basin, 1974-1986

International Nuclear Information System (INIS)

Renstroem, S.; Svensson, Roger; Wigren-Svensson, M.

1990-05-01

Since 1980, Forsmark Power Plants has discharged large amount of cooling water into the Biotest basin. In 1974, before the dam was constructed, and 1980 to 1986, the macrophytic algae and higher vegetation inside and around the basin has been investigated. The observed changes are mainly caused by the increased water temperature causing lack of ice cover during the winter, the embankment reducing the exposition, the heavy water stream through the basin and the reduced light transmission in the water. The macroscopic vegetation in the Biotest basin was originally distributed all over the lake, but is now mainly found in more shallow water. The deepest part, a passage from the input of the cooling water to the output, totally lack vegetation. The reason for this is a combination of the heavy stream, raised temperature and reduced light transmission. The total biomass of macroscopic vegetation in the basin has been reduced from c. 70 metric ton in 1980 to c. 27 ton in 1982 and 1986. Among the most important species, the production of Chara spp. and Potamogeton pectinatus have been strongly reduced, while Cladophora glomerata and Vaucheria sp. have increased. Especially for Vaucheria, the raised temperature has been of vital importance. Among other species, Tolypella nidifica first increased, but has now totally disappeared. Zannichellia palustris was the only phanerogam which increased all the time. It is Z. palustris var. major which stands for the increase, while Z. palustris var. repens has disappeared from the basin. The shore vegetation, mainly reeds, has expanded conspicuously. From 1974 to 1980, the shore vegetation was favoured by the reduced exposition caused by the embankment. Since then, the raised temperature and absence of ice cover have resulted in an accelerating expansion of mainly Phragmites communis. Scirpus tabernaemontani and S. maritimus were first increasing, but do not seem to be able to compete with Phragmites in the long run. (au)

Insights into the relationships of Palearctic and Nearctic lymnaeids (Mollusca : Gastropoda by rDNA ITS-2 sequencing and phylogeny of stagnicoline intermediate host species of Fasciola hepatica

Directory of Open Access Journals (Sweden)

Bargues M.D.

2003-09-01

Full Text Available Fascioliasis by Fasciola hepatica is the vector-borne disease presenting the widest latitudinal, longitudinal and altitudinal distribution known. F. hepatica shows a great adaptation power to new environmental conditions which is the consequence of its own capacities together with the adaptation and colonization abilities of its specific vector hosts, freshwater snails of the family Lymnaeidae. Several lymnaeid species only considered as secondary contributors to the liver fluke transmission have, however, played a very important role in the geographic expansion of this disease. Many of them belong to the so-called "stagnicoline" type group. Stagnicolines have, therefore, a very important applied interest in the Holarctic region, to which they are geographically restricted. The present knowledge on the genetics of stagnicolines and on their parasite-host interrelationships is, however, far from being sufficient. The present paper analyses the relationships between Palaearctic and Nearctic stagnicoline species on the base of the new light furnished by the results obtained in nuclear rDNA ITS-2 sequencing and corresponding phylogenetic studies of the lymnaeid taxa Lymnaea (Stagnicola occulta, L. (S. palustris palustris (topotype specimens and L.(S. p. turricula from Europe. Natural infections with F. hepatica have been reported in all of them. Surprisingly, ITS-2 length and G C content of L. occulta were similar and perfectly fitted within the respective ranges known in North American stagnicolines. Nucleotide differences and genetic distances were higher between L. occulta and the other European stagnicolines than between L. occulta and the North American ones. The ITS-2 sequence of L. p. turricula from Poland differed from the other genotypes known from turricula in Europe. The phylogenetic trees using the maximum-parsimony, distance and maximum-likelihood methods confirmed (i the inclusion of L. occulta in the branch of North American

Study of hantavirus infection in captive breed colonies of wild rodents

Directory of Open Access Journals (Sweden)

RC Oliveira

2004-10-01

Full Text Available Wild sigmondontine rodents are known to be the reservoir of several serotypes of New World hantaviruses. The mechanism of viral transmission is by aerosol inhalation of the excreta from infected rodents. Considering that the captive breed colonies of various wild mammals may present a potencial risk for hantaviral transmission, we examined 85 speciemens of Thrichomys spp. (Echimyidae and 17 speciemens of Nectomys squamipes (Sigmodontinae from our colony for the presence of hantavirus infections. Blood samples were assayed for the presence of antibodies to Andes nucleocapsid antigen using enzyme-linked immunosorbent assay (ELISA. Additionally, serum samples from workers previously exposed to wild rodents, in the laboratories where the study was conducted, were also tested by ELISA to investigate prevalence of anti-hantavirus IgG antibodies. All blood samples were negative for hantavirus antibodies. Although these results suggest that those rodent's colonies are hantavirus free, the work emphasizes the need for hantavirus serological monitoring in wild colonized rodents and secure handling potentially infected rodents as important biosafety measures.

Population dynamics of Lemniscomys rosalia (Muridae: Rodentia) in ...

African Journals Online (AJOL)

Numerous studies have reported increases in rodent populations following good rainfall (Nel 1978; Perrin & Swanepoel 1987; Bronner, Rau- ten bach & Meester 1988). This relationship is thought to be an indirect one where increased rainfall acts to increase cover and food supply. thus enabling rodents to reproduce (Neal.

Population dynamics of Lemniscomys rosalia (Muridae: Rodentia) in ...

African Journals Online (AJOL)

ecology of L. rosalia over a twelve month period. Materials and methods. Study area. Three permanently marked grids (100 m x 100 m) were established in an .... of the study. The habitat characteristics of the three grids are shown in Table I. There were significant differences in per cent cover, per cent green grass and grass ...

Notes on Mesocapromys sanfelipensis (Rodentia: Capromyidae) from Cuba.

Science.gov (United States)

LÓpez, Lazaro W viÑola; Garrido, Orlando H; BermÚdez, Alberto

2018-04-16

The San Felipe Hutia, Mesocapromys sanfelipensis, is one of the most endangered species of rodents in the world, and little is known about its ecology, evolution, and ancient distribution. At present, this hutia has been found only in its type locality, Cayo Juan Garcia, a cay in the southwest Cuban insular platform. Here we report for the first time a well preserved fossil skull referred to this species, collected in Cueva del Indio, Mayabeque province, western Cuba. This specimen shows that the modern population of M. sanfelipensis is a marginal relic of its former distribution, a consequence of climatic, eustatic, and neotectonic changes in the last 8 ka years. Also, we reevaluate the cranial characters and measurements that correspond to M. sanfelipensis and found that two of the eight specimens referred to this species and deposited at the Instituto de Ecologia y Sistematica belong to Mesocapromys auritus. Finally, we include six unpublished photos of specimens of M. sanfelipensis captured in 1970 during two expeditions to Cayo Juan Garcia.

PRIMEROS DATOS SOBRE LOS MICROMAMÍFEROS (ROEDORES E INSECTÍVOROS COETÁNEOS AL SOLUTRENSE EN LA CUEVA DE KIPUTZ IX (MUTRIKU, GUIPUZKOA, ESPAÑA

Directory of Open Access Journals (Sweden)

Naroa García Ibaibarriaga

2013-09-01

Full Text Available En este artículo describimos los micromamíferos de los lechos del yacimiento paleontológico de Kiputz IX correspondientes a una cronología arqueológica solutrense. La buena preservación de los restos óseos y la aplicación de las actuales técnicas micropaleontológicas nos permiten realizar la reconstrucción paleoambiental para el periodo estudiado. Los pequeños mamíferos están representados en el yacimiento por ocho taxones, cinco pertenecientes al Orden Rodentia y tres al Orden Soricomorpha. Las variaciones de la temperatura determinadas a partir de la asociación de micromamíferos, sugieren que el clima en el momento de la formación del conjunto sería más frío y húmedo que en la actualidad.In this article, the small mammal assemblage contemporary to the Solutrean age from the paleontological site of Kiputz IX cave (Mutriku, Gipuzkoa, Spain is described. The good preservation of bones and the application of latest micropaleontological techniques allow a paleoenvironmental reconstruction of the period analyzed. Small mammals are represented in the site by ten taxa, seven belonging to the Orden Rodentia (Arvicola amphibius, Microtus (Microtus agrestis, Microtus (Microtus arvalis, Microtus (Alexandromys oeconomus, Chionomys nivalis, Microtus (Terricola sp., Apodemus sylvaticus-flavicollis and three to the Orden Eulipotyphla (Sorex (Sorex minutus, Sorex (Sorex araneus-coronatus, Talpa sp.. The environmental variations estimated on the basis of the micromammal association, suggested that the weather in the moment of the assemblage’s formation would be colder than the one occurring in the area at the present day. The humidity also could be higher than the current one.

Flying lemurs – The 'flying tree shrews'? Molecular cytogenetic evidence for a Scandentia-Dermoptera sister clade

Directory of Open Access Journals (Sweden)

Volobouev Vitaly

2008-05-01

Full Text Available Abstract Background Flying lemurs or Colugos (order Dermoptera represent an ancient mammalian lineage that contains only two extant species. Although molecular evidence strongly supports that the orders Dermoptera, Scandentia, Lagomorpha, Rodentia and Primates form a superordinal clade called Supraprimates (or Euarchontoglires, the phylogenetic placement of Dermoptera within Supraprimates remains ambiguous. Results To search for cytogenetic signatures that could help to clarify the evolutionary affinities within this superordinal group, we have established a genome-wide comparative map between human and the Malayan flying lemur (Galeopterus variegatus by reciprocal chromosome painting using both human and G. variegatus chromosome-specific probes. The 22 human autosomal paints and the X chromosome paint defined 44 homologous segments in the G. variegatus genome. A putative inversion on GVA 11 was revealed by the hybridization patterns of human chromosome probes 16 and 19. Fifteen associations of human chromosome segments (HSA were detected in the G. variegatus genome: HSA1/3, 1/10, 2/21, 3/21, 4/8, 4/18, 7/15, 7/16, 7/19, 10/16, 12/22 (twice, 14/15, 16/19 (twice. Reverse painting of G. variegatus chromosome-specific paints onto human chromosomes confirmed the above results, and defined the origin of the homologous human chromosomal segments in these associations. In total, G. variegatus paints revealed 49 homologous chromosomal segments in the HSA genome. Conclusion Comparative analysis of our map with published maps from representative species of other placental orders, including Scandentia, Primates, Lagomorpha and Rodentia, suggests a signature rearrangement (HSA2q/21 association that links Scandentia and Dermoptera to one sister clade. Our results thus provide new evidence for the hypothesis that Scandentia and Dermoptera have a closer phylogenetic relationship to each other than either of them has to Primates.

Mamíferos de la Reserva de la Biosfera "La Sepultura", Chiapas, México

Directory of Open Access Journals (Sweden)

Eduardo Espinoza Medinilla

2004-03-01

Full Text Available Con el objeto de conocer la riqueza de mamíferos de la Reserva de la Biosfera La Sepultura, fue elaborado un listado de especies para esta área natural protegida. Através de transectos lineales, donde se realizaron observaciones directas, búsqueda de rastros y captura de ejemplares, durante el periodo de mayo de 1994 a diciembre de 1999, además de la revisión de bases de datos nacionales y extranjeras; con registros de esta localidad, se pudo recolectar 848 especimenes (248 pieles y cráneos, 32 huellas en molde de yeso y nueve fragmentos óseos. Se obtuvo un listado compuesto de 98 especies, 70 géneros, 29 familias y 10 órdenes. El 86.7 % de estas especies pertenecen a los órdenes Chiroptera, Rodentia y Carnivora. Por lo menos 21 especies están clasificadas dentro de alguna categoría de conservación. Los datos obtenidos de este manuscrito son una base sólida y actualizada y pueden ser usados como parte de los planes de manejo y conservación para esta reservaA species list was elaborated for La Sepultura Biosphere Reserve, Chiapas, Mexico. Line transects and direct observations were made, national and international databases were consulted, and animal traces were registered. Animals were captured during the period May 1994 - December 1999. A total of 848 specimen (248 furs and skulls, 32 tracks in plaster, and 9 osseous fragments were collected. A total of 98 species, 70 genera, 29 families, and 10 orders compose the species list. Of these species 87.7% belong to the orders Chiroptera, Rodentia and Carnivora and 21 species were classified according to some kind of legal protection. These data represent a solid and actualized database useful for designing management and conservation plans for this Biosphere Reserve

Impacts of Flooding Regime Modification on Wildlife Habitats of Bottomland Hardwood Forests in the Lower Mississippi Valley.

Science.gov (United States)

1981-10-01

Diospyros virginiana White ash Fraxinus americana Shingle oak Quercus imbricaria Pin oak 0 palustris (Continued) Able to survive deep, prolonged...Mississippi, and found little significant dif- ference in overall capture data. Natural stands almost exclusively sup- ported mice of the genus Peromyscus...frequent wetlands but are not restricted to them. k. Although the cottonmouth is common in wetlands, water snakes of the genus Nerodia are most important in

Surface-based GPR underestimates below-stump root biomass

Science.gov (United States)

John R. Butnor; Lisa J. Samuelson; Thomas A. Stokes; Kurt H. Johnsen; Peter H. Anderson; Carlos A. Gonzalez-Benecke

2016-01-01

Aims While lateral root mass is readily detectable with ground penetrating radar (GPR), the roots beneath a tree (below-stump) and overlapping lateral roots near large trees are problematic for surface-based antennas operated in reflection mode. We sought to determine if tree size (DBH) effects GPR root detection proximal to longleaf pine (Pinus palustris Mill) and if...

Parasitological surveillance in a rat (Rattus norvegicus) colony in São Paulo Zoo animal house

Science.gov (United States)

Chagas, Carolina Romeiro Fernandes; Gonzalez, Irys Hany Lima; Favoretto, Samantha Mesquita; Ramos, Patrícia Locosque

Rattus norvegicus (Mammalia: Rodentia) is a widespread and synanthropic rodent, broadly used in medical experiments. It can also be used for feeding captive animals in zoos. Parasitological surveys are important to guarantee the health of both the animals and the staff responsible for their management. The aim of this study was to identify intestinal parasites of Rattus norvegicus offered as food to captive animals from São Paulo Zoo, and demonstrate the importance of sanitary hurdling, disease control and biosecurity. The identified protozoan parasites were Eimeria sp., Entamoeba sp., Spironucleus sp., Giardia sp., Tritrichomonas sp., Chilomastix sp., unidentified cysts and non-sporulated coccidians oocysts (Isospora/Eimeria). The following helminths were found: Syphacia muris, Rodentolepis nana and Aspiculuris tetraptera.

Diet of two sympatric felids (Leopardus tigrinus and Leopardus wiedii in a remnant of Atlantic forest, in the montane region of Espírito Santo, southeastern Brazil (English

Directory of Open Access Journals (Sweden)

Jardel Brandão Seibert

2015-06-01

Full Text Available We analyzed the diet of two sympatric felids, the oncilla and the margay, in the Brazilian Atlantic Forest. Fecal samples were collected from 2003 to 2005. Of the 52 fecal samples examined, 34 were confirmed to be from the oncilla and 18 of them from the margay. Small mammals (Rodentia and Didelphimorphia were the most important food item, followed by insects and birds. The food habit of the oncilla and the margay in the area were classified as a specialist carnivore, feeding in a variety of prey, which mammals were the most consumed item. The coexistence between those species may involve spatial and temporal segregation and the use of complementary items in the diet. (English

Electrophoretic variation in low molecular weight lens crystallins from inbred strains of rats.

Science.gov (United States)

Donner, M E; Skow, L C; Kunz, H W; Gill, T J

1985-10-01

Analysis of rat lens soluble proteins by analytical isoelectric focusing detected two inherited electrophoretic differences in low molecular weight (LM) crystallins from inbred strains of rats (Rattus norvegicus). The polymorphic lens crystallins were shown to be similar to a genetically variant LM crystallin, LEN-1, previously described in mice (Mus musculus) and encoded on chromosome 1, at a locus linked to Pep-3 (dipeptidase). Linkage analysis demonstrated that the rat crystallin locus was loosely linked to Pep-3 at a recombination distance of 38 +/- 4.5 U. These data suggest the conservation of a large chromosomal region during the evolution of Rodentia and support the hypothesis that the gamma-crystallins are evolving more rapidly than alpha- or beta-crystallins.

Methylocella tundrae sp. nov., a novel methanotrophic bacterium from acidic tundra peatlands.

Science.gov (United States)

Dedysh, Svetlana N; Berestovskaya, Yulia Y; Vasylieva, Lina V; Belova, Svetlana E; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Liesack, Werner; Zavarzin, George A

2004-01-01

A novel species, Methylocella tundrae, is proposed for three methanotrophic strains (T4T, TCh1 and TY1) isolated from acidic Sphagnum tundra peatlands. These strains are aerobic, Gram-negative, non-motile, dinitrogen-fixing rods that possess a soluble methane monooxygenase and utilize the serine pathway for carbon assimilation. Strains T4T, TCh1 and TY1 are moderately acidophilic organisms capable of growth between pH 4.2 and 7.5 (optimum 5.5-6.0) and between 5 and 30 degrees C (optimum 15 degrees C). The major phospholipid fatty acid is 18:1omega7c. The DNA G+C content of strain T4T is 63.3 mol%. The three strains possess almost identical 16S rRNA gene sequences and are most closely related to two previously identified species of Methylocella, Methylocella palustris (97% similarity) and Methylocella silvestris (97.5% similarity). DNA-DNA hybridization values of strain T4T with Methylocella palustris KT and Methylocella silvestris BL2T were respectively 27 and 36%. Thus, the tundra strains represent a novel species, for which the name Methylocella tundrae sp. nov. is proposed. Strain T4T (=DSM 15673T=NCIMB 13949T) is the type strain.

Contribuciones al conocimiento de la flora de navarra

Directory of Open Access Journals (Sweden)

BALDA, Angel

2002-01-01

Full Text Available Nuevos datos acerca de 58 táxones de plantas de interés, bien por su rareza en el terrirorio navarro o por la ampliación de área que suponen. De ellos, 12 se citan por primera vez para Navarra : Epilobium angustifolium, Fraxinus pennylvanica, Galinsoga quadriradiata, Gamochaeta falcata, Isatis tinctoria subsp. tinctoria, Ludwigia palustris, Lycopodeilla inundata, Pseudorchis albida, Ramonda myconi, Rynchospora alba, Rynchospora fusca y Spiranthes aestivalis

Accumulation of 226Ra, 238U and 230Th by wetland plants in a vicinity of U-mill tailings at Zirovski vrh (Slovenia)

International Nuclear Information System (INIS)

Marko Cerne; Borut Smodis; Marko Strok; Radojko Jacimovic

2010-01-01

The impact of a U-mill tailing on radionuclide accumulation by plants was assayed. In particular, a preliminary screening of 226 Ra, 238 U and 230 Th in Marsh marigold (Caltha palustris L.), soft rush (Juncus effusus L.) and Tall Moor grass (Molinia arundinacea (L.) Moench) grown in a marsh habitat is presented. Activity concentrations for the studied radionuclides and their transfer factors for the particular plants are shown and discussed. (author)

A Guide to the George Palmiter River Restoration Techniques.

Science.gov (United States)

1982-03-01

reduction. The raft is driven by a 35 h.p. ’ outboard engine, weighs 4 tons, and has 1500 lb. of flotation material under it. Additionally, the raft has a...Sycamore (Platanus occidentalis) 4. Red Maple (Acer rubrum) 5. Silver Maple (Acer saccharinum) 6. Pin Oak (Quercus palustris) 7. Red Oak (Quercus...safety goggles 5 - ear protectors 5 - flotation jackets 1, - industrial first aid kit--one that floats and is waterproof 1 - snake bite kit several

North American Lauraceae: Terpenoid Emissions, Relative Attraction and Boring Preferences of Redbay Ambrosia Beetle, Xyleborus glabratus (Coleoptera: Curculionidae: Scolytinae)

OpenAIRE

Kendra, Paul E.; Montgomery, Wayne S.; Niogret, Jerome; Pruett, Grechen E.; Mayfield, Albert E.; MacKenzie, Martin; Deyrup, Mark A.; Bauchan, Gary R.; Ploetz, Randy C.; Epsky, Nancy D.

2014-01-01

The invasive redbay ambrosia beetle, Xyleborus glabratus, is the primary vector of Raffaelea lauricola, a symbiotic fungus and the etiologic agent of laurel wilt. This lethal disease has caused severe mortality of redbay (Persea borbonia) and swampbay (P. palustris) trees in the southeastern USA, threatens avocado (P. americana) production in Florida, and has potential to impact additional New World species. To date, all North American hosts of X. glabratus and suscepts of laurel wilt are mem...

Integrating large-scale functional genomics data to dissect metabolic networks for hydrogen production

Energy Technology Data Exchange (ETDEWEB)

Harwood, Caroline S

2012-12-17

The goal of this project is to identify gene networks that are critical for efficient biohydrogen production by leveraging variation in gene content and gene expression in independently isolated Rhodopseudomonas palustris strains. Coexpression methods were applied to large data sets that we have collected to define probabilistic causal gene networks. To our knowledge this a first systems level approach that takes advantage of strain-to strain variability to computationally define networks critical for a particular bacterial phenotypic trait.

Epidemiological role of a rodent in Morocco: Case of cutaneous leishmaniasis

Directory of Open Access Journals (Sweden)

Mohamed Echchakery

2015-08-01

Full Text Available Commensal rodents as well as wild ones may present a potential risk to public health. They are reservoirs or vectors of many pathogens. This review provides an update on their epidemiological role in the spread of leishmaniasis in Morocco. In Morocco, the order Rodentia is represented by 7 families and 32 species of which Rattus norvegicus, Psammomys obesus, Mastomys erythrolecus, Meriones shawi, Meriones crassus and Meriones libycus are considered reservoirs of leishmaniasis in Asia, Midle East and Africa. With the aim to define the extent of zoonotic leishmaniasis risk in Morocco, we represent and discuss the geographical distribution of these potential reservoirs in relation to that of Phlebotomus papatasi, proven vector of cutaneous leishmaniasis by Leishmania major in Morocco.

Discussion to several tapeworm species from the families Hymenolepididae, Anoplocephalidae and Davaineidae parasitizing rodents and man

Directory of Open Access Journals (Sweden)

František Tenora

2004-01-01

Full Text Available With the more recent knowledge, the hypothesis by Joyeux and Baer (1929 is consulted: “... most of rarer species of tapeworms occurring in man are probably parasites of other mammals, specially of Rodentia .....“. In connection with that, the host specificity in several species from the families Hymenolepididae, Anoplocephalidae and Davaineidae is discussed. So far parasites of rodents are concerned, they are the species Rodentolepis straminea, R. fraterna, Hymenolepis diminuta, H. pseudodiminuta, H. hibernia and Inermicapsifer arvicanthidis. So far parasites of man are concerned, they are the species Rodentolepis nana, Hymenolepis flavopunctata and Inermicapsifer madagascariensis. Attention is drawn also to discrepancies in the opinions published on the views of hosts’ specificity or of zoogeographical distribution of several species from the family Davaineidae.

[Ovarian activity of Agouti paca (Rodentia: Agoutidae) under captivity].

Science.gov (United States)

Montes Pérez, Rubén C; Cabrera Baz, Elsy A

2006-09-01

The ovarian activity of Agouti paca was characterized by hormonal profiles and ovarian structures. Samples of blood were taken from eight females (seven adults and one juvenile) at the breeding grounds of the Facultad de Medicina Veterinaria y Zootecnia in Yucatśn, Mexico. Sampling lasted approximately two months and was done every three and six days. Blood was collected from anesthetized animals, and the levels of progesterone (P4) and 17 beta estradiol (E2) were analized by radioimmunoassay technique. Macroscopic and microscopic analyses were carried out in ovaries of dead animals. The estrous cycle lasted 29+/-8.4 days, levels of 1.61+/-0.65 ng/ml for P4 and 39+/-24 pg/ml for E2 were observed for a follicular phase, 6.18+/-3.70 ng/ml and 29+/-16 pg/ml for P4 and E2 respectively in the luteal phase. Statistically significant differences were found between phases for P4 but not for E2. The presence of extragonadal steroids with levels of P4 of 1.9+/-0.77 ng/ml and E2 of 22+/-17 pg/ml were observed, which are not produced by the effects of managing stress. The changes in the levels of P4 during the cycle are indicators of luteal activity, with the intersticial tissue acting probably as active steroids-producing gland. Follicular growth was observed during the entire cycle.

Esqueletogênese em punaré (Thrichomys laurentinus- Rodentia, Echimyidae

Directory of Open Access Journals (Sweden)

Phelipe O. Favaron

Full Text Available Resumo: O objetivo deste estudo foi descrever o desenvolvimento do esqueleto do punaré (Thrichomys laurentinus. Para tanto, foram utilizados 11 embriões e 12 fetos em diferentes estágios de desenvolvimento, sendo divididos em 4 grupos de acordo com o período gestacional. As amostras foram obtidas no Centro de Multiplicação de Animais Silvestres da Universidade Federal Rural do Semi-Árido, Mossoró-RN, Brasil. Após fixados em formol (10% ou glutaraldeído (2,5%, foi realizada a analise morfológica com auxílio de lupa, sendo as características macroscópicas fotodocumentadas. Análises de raios-x e coloração por alizarina red foram realizadas para melhor compreensão do desenvolvimento ósseo. Nas análises de raio-x os embriões não apresentaram nenhuma radiopacidade, ao contrário dos fetos que apresentavam radiopacidade gradual ao longo dos grupos. No grupo II houve aumento de radiopacidade na região da coluna vertebral e das regiões mandibular e maxilar. No grupo III a radiopacidade estava aumentada nos membros pélvicos, nas costelas e na região frontal e no grupo IV nos membros torácicos e nas regiões occipital, temporal e frontal do crânio. Tais características foram confirmadas pelas analises histológicas e pela técnica de Alizarina Red. Com isso podemos concluir que o conhecimento acerca da embriologia do sistema ósseo normal é fundamental para o entendimento dos efeitos adversos causados pela nutrição e uso de drogas durante o desenvolvimento.

Skull size and shape variation in Psammomys spp. (Rodentia ...

African Journals Online (AJOL)

This finding might explain the uncertainty in classification of these species in the past. The interspecific allometric-free phenotypic differences observed may be associated with adaptive processes linked to the different environmental and trophic preferences of the two species. Keywords: allometry, cranium, geometric ...

Diagnóstico virológico y molecular de virus transmitidos por roedores. Hantavirus y arenavirus

Directory of Open Access Journals (Sweden)

Silvana Levis

2010-04-01

Full Text Available Los hantavirus (familia Bunyaviridae y arenavirus (familia Arenaviridae son virus de roedores; cada uno de ellos parece estar estrictamente asociado con una especie de roedor en la que causa una infección persistente y asintomática. En las Américas tienen como reservorios primarios a roedores de la sub-familia Sigmodontinae, y son causantes de síndrome pulmonar por Hantavirus (SPH y fiebres hemorrágicas, respectivamente (1,2. El número de estos virus identificados en los últimos años ha aumentado significativamente; actualmente, el género Hantavirus está compuesto por más de 28 tipos diferentes, mientras que al menos 23 arenavirus conforman el género Arenavirus. Entre los hantavirus asociados con SPH se destacan el virus Sin Nombre en Norteamérica, y los virus Andes, Laguna Negra, Caño Delgadito, Araraquara y Juquitiba, en el cono sur de América, entre otros (2. Los arenavirus asociados a fiebres hemorrágicas reconocidos en Sud América al presente son: Junín (Argentina, Guanarito (Venezuela, Sabiá (Brasil, y Machupo y Chapare (Bolivia (3.

Experimental Life Cycle of Hypoderaeum conoideum (Block, 1872 Diez, 1909(Trematoda: Echinostomatidae Parasite from the North of Iran

Directory of Open Access Journals (Sweden)

Hakim AZIZI

2015-03-01

Full Text Available Background: Human Echinostomiasis is an intestinal disease caused by the members of family Echinostomatidae parasites. The aim of present research was to identify echinos­tomatidae cercariae emitted by Lymnaea palustris snails from Mazandaran province in the north of Iran based on the morphological and morphometrical charac­teristics of the different stages of experimental parasite life cycle.Methods: Echinostomatidae cercariae were collected from L. palustris (Gastropoda: Lymnaeidae of the north of Iran. To collect metacercaria, 50 healthy snails were infected with cercariae experimentally (50 cercariae for each. To obtain the adult stage, 9 laboratory animals (3 ducks, 2 rats, 2 mice and 2 quails were fed with 60 metacercaria for each. To identify parasite, the different stages of worm were exam­ined using light microscope and then the figures were draw under camera Lucida microscope and measures were determined.Results: Averagely, 15metacercaria were obtained from each snail that had been previously exposed with cercariae. Ducks presented worm eggs in feces after 10-15 days post-infection. Intestinal worms were collected and identified as Hypoderaeum conoideum on the bases of figures and measures of cephalic collar, the number of collar spine, suckers diameter ratio, testes arrangement, etc.Conclusion: H. conoideum cercariae and adult worm are described. This is the first report of the different stages of the experimental life cycle of this parasite in Iran.

Endogenous abscisic acid as a key switch for natural variation in flooding-induced shoot elongation.

Science.gov (United States)

Chen, Xin; Pierik, Ronald; Peeters, Anton J M; Poorter, Hendrik; Visser, Eric J W; Huber, Heidrun; de Kroon, Hans; Voesenek, Laurentius A C J

2010-10-01

Elongation of leaves and stem is a key trait for survival of terrestrial plants during shallow but prolonged floods that completely submerge the shoot. However, natural floods at different locations vary strongly in duration and depth, and, therefore, populations from these locations are subjected to different selection pressure, leading to intraspecific variation. Here, we identified the signal transduction component that causes response variation in shoot elongation among two accessions of the wetland plant Rumex palustris. These accessions differed 2-fold in petiole elongation rates upon submergence, with fast elongation found in a population from a river floodplain and slow elongation in plants from a lake bank. Fast petiole elongation under water consumes carbohydrates and depends on the (inter)action of the plant hormones ethylene, abscisic acid, and gibberellic acid. We found that carbohydrate levels and dynamics in shoots did not differ between the fast and slow elongating plants, but that the level of ethylene-regulated abscisic acid in petioles, and hence gibberellic acid responsiveness of these petioles explained the difference in shoot elongation upon submergence. Since this is the exact signal transduction level that also explains the variation in flooding-induced shoot elongation among plant species (namely, R. palustris and Rumex acetosa), we suggest that natural selection results in similar modification of regulatory pathways within and between species.

Post-Fire Peat Land Understory Plant in Rimba Panjang, Sumatera, Indonesia

Science.gov (United States)

Firdaus, L. N.; Nursal; Wulandari, Sri; Syafi'i, Wan; Fauziah, Yuslim

2017-12-01

The existence of understory plants during early post-fire succession is essential in term of natural post-fire ecological restoration. More than fifty percent of fire incidents in Riau, Sumatera, Indonesia occurred in shallow peat lands which have the huge impact on vegetation damage. This study aims to explore the understory plants species and diversity in post-fire peat land at Rimba Panjang, Kampar Regency, Sumatera, Indonesia. By using survey method, the observations were conducted on 150 plots which were distributed randomly over four locations based on the year after fire: 2009, 2014, 2015 and 2016. We found respectively 12, 14, 19 and 17 species at that sites with respective Shannon Wiener diversity index were 1.72, 2.00, 2.14 and 2.40. All the sites were dominated by Stenochlaena palustris (Burm.). Coverage percentage of understory vegetation were respectively 28.87%, 25.50%, 51.60% and 54.13%. Overall, we found 31 species of 17 familia. The result showed that the species composition, diversity index and coverage percentage of understory plant are likely to decrease in line with the length of time after the fire. Post peatland fires in Rimba Panjang are still having the characteristics of the peat swamp habitat which was dominated by Stenochlaena palustris (Burm.). Ecological restoration of that habitat is still possible, but it is necessary to consider technological and socio-economical aspects of local communities.

Genes essential for phototrophic growth by a purple alphaproteobacterium: Genes for phototrophic growth

Energy Technology Data Exchange (ETDEWEB)

Yang, Jianming [Key Lab of Applied Mycology, College of Life Sciences, Qingdao Agricultural University, Qingdao Shandong Province People' s Republic of China; Department of Microbiology, University of Washington, Seattle WA USA; Yin, Liang [Department of Microbiology, University of Washington, Seattle WA USA; Lessner, Faith H. [Department of Biological Sciences, University of Arkansas, Fayetteville AR USA; Nakayasu, Ernesto S. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Payne, Samuel H. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Fixen, Kathryn R. [Department of Microbiology, University of Washington, Seattle WA USA; Gallagher, Larry [Department of Genome Sciences, University of Washington, Seattle WA USA; Harwood, Caroline S. [Department of Microbiology, University of Washington, Seattle WA USA

2017-07-24

Anoxygenic purple phototrophic bacteria have served as important models for studies of photophosphorylation. The pigment-protein complexes responsible for converting light energy to ATP are relatively simple and these bacteria can grow heterotrophically under aerobic conditions, thus allowing for the study of mutants defective in photophosphorylation. In the past, genes responsible for anoxygenic phototrophic growth have been identified in a number of different bacterial species. Here we systematically studied the genetic basis for this metabolism by using Tn-seq to identify genes essential for the anaerobic growth of the purple bacterium Rhodopseudomonas palustris on acetate in light. We identified 171 genes required for growth in this condition, 35 of which are annotated as photosynthesis genes. Among these are a few new genes not previously shown to be essential for phototrophic growth. We verified the essentiality of many of the genes we identified by analyzing the phenotypes of mutants we generated by Tn mutagenesis that had altered pigmentation. We used directed mutagenesis to verify that the R. palustris NADH:quinone oxidoreductase complex IE is essential for phototrophic growth. As a complement to the genetic data, we carried out proteomics experiments in which we found that 429 proteins were present in significantly higher amounts in cells grown anaerobically in light compared to aerobically. Among these were proteins encoded by subset of the phototrophic growth-essential genes.

Light and electron microscopic study of Pelomyxa binucleata (Gruber, 1884) (Peloflagellatea, Pelobiontida)

OpenAIRE

Frolov, Alexander; Chystjakova, Ludmila; Goodkov, Andrew

2005-01-01

Morphology of a pelobiont Pelomyxa binucleata (Gruber, 1884) has been studied using light and electron microscopy. The organisation of P. binucleata has been shown to differ from that of P. palustris, P. prima and P. corona. The cell surface of P. binucleata is represented by the plasma membrane with a thin but distinct layer of non structured glycocalyx. The ectoplasm, containing a network of fine fibrils, is separated from the endoplasm with a boundary layer of cisterns and reticulum channe...

DIVERSIDADE, BIOGEOGRAFIA, CARACTERIZAÇÃO CARIOTÍPICA E TRICOLÓGICA DOS PEQUENOS MAMÍFEROS NÃO VOADORES DO PARQUE ESTADUAL RIO DA ONÇA, LITORAL SUL DO PARANÁ

Directory of Open Access Journals (Sweden)

FERNANDA GATTO-ALMEIDA

Full Text Available RESUMO Das 1.361 espécies de vertebrados que a Mata Atlântica abriga, 567 são endêmicas. Rodentia e Didelphimorphia somam 71% dos endemismos observados para mamíferos nesse bioma. No Brasil, esses animais ainda carecem de informações básicas a cerca de sua biologia, distribuição, e mesmo riqueza total. Esse trabalho objetivou identificar as espécies de marsupiais e roedores do Parque Estadual Rio da Onça e caracterizar a morfologia dos pelos-guarda e do conjunto cromossômico das mesmas, além de verificar a composição de pequenos mamíferos não voadores em diferentes ambientes e estratos vegetais. Foram realizadas treze campanhas de campo e como esforço adicional, três linhas de armadilhas de queda foram instaladas. O esforço amostral total foi de 6.633 armadilhas e 1.181 baldes distribuídos ao longo de 69 noites de amostragem, que resultaram em 196 capturas de 166 indivíduos de 12 espécies. Foram registradas sete espécies da Ordem Rodentia: Akodon montensis, Delomys sublineatus, Euryoryzomys russatus, Juliomys pictipes, Nectomys squamipes, Oligoryzomys nigripes e Thaptomys nigrita, além de cinco espécies de marsupiais da Ordem Didelphimorphia: Didelphis aurita, Gracilinanus microtarsus, Metachirus nudicaudatus, Marmosa paraguayana e Monodelphis iheringi. Os resultados tricológicos e citogenéticos foram condizentes com os disponíveis na literatura. Quanto à estratificação vertical, somente sete capturas foram feitas em árvore: quatro da espécie Marmosa paraguayana, duas de Didelphis aurita e uma de Akodon montensis. Portanto, para o ambiente de Terras Baixas da área de estudo, a amostragem realizada no extrato arbóreo e arbustivo do sub-bosque não contribuiu para o incremento da lista de espécies.

First record of entodiniomorph ciliates in a carnivore, the maned wolf (Chrysocyon brachyurus), from Brazil.

Science.gov (United States)

Vynne, Carly; Kinsella, John M

2009-06-01

The entodiniomorph ciliates (Ciliophora: Entodiniomorphida) are endosymbiotes widely found in the intestines of herbivorous mammals. These commensals commonly occur in the Artiodactyla and Perissodactyla and have also been described in the Proboscidea, Primates, Rodentia, and Diprotodontia. This study reports the first finding of a ciliate in a member of order Carnivora, the maned wolf (Chrysocyon brachyurus). Fecal samples from wild and captive maned wolves were screened using ethyl acetate sedimentation. Prevalence in fecal samples collected from free-ranging maned wolves in Brazil was 40% (6 of 15). Fecal samples from two of four captive individuals from the St. Louis Zoo also had the same species of ciliate. The largely frugivorous diet of the maned wolf likely explains the occurrence of these normally herbivore-associated endosymbiotes in a carnivore.

Notes i contribucions al coneixement de la flora de Menorca (X). Notes florístiques

OpenAIRE

Fraga-Arguimbau, Pere

2014-01-01

Es donen a conèixer noves dades corològiques i observacions taxonòmiques per a la flora de Menorca referents a 50 tàxons. D'aquests 13 són novetat per a la flora de les Balears: Agrostis stolonifera subsp. gaditana (Boiss. & Reut.) Valdés & H. Scholz, Asteriscus pygmaeus (DC.) Coss. & Durieu, Callitriche obtnsangula Le Gall, Dactylis glomerata subsp. hackelii (Asch. & Graebn.) Cif. & Giacom., Daucus muricatus (L.) L., Ehrharta calycina J.E. Sm., Eleocharis palustris subsp. waltersii Bures & D...

Recipient-Biased Competition for an Intracellularly Generated Cross-Fed Nutrient Is Required for Coexistence of Microbial Mutualists.

Science.gov (United States)

McCully, Alexandra L; LaSarre, Breah; McKinlay, James B

2017-11-28

Many mutualistic microbial relationships are based on nutrient cross-feeding. Traditionally, cross-feeding is viewed as being unidirectional, from the producer to the recipient. This is likely true when a producer's waste, such as a fermentation product, has value only for a recipient. However, in some cases the cross-fed nutrient holds value for both the producer and the recipient. In such cases, there is potential for nutrient reacquisition by producer cells in a population, leading to competition against recipients. Here, we investigated the consequences of interpartner competition for cross-fed nutrients on mutualism dynamics by using an anaerobic coculture pairing fermentative Escherichia coli and phototrophic Rhodopseudomonas palustris In this coculture, E. coli excretes waste organic acids that provide a carbon source for R. palustris In return, R. palustris cross-feeds E. coli ammonium (NH 4 + ), a compound that both species value. To explore the potential for interpartner competition, we first used a kinetic model to simulate cocultures with varied affinities for NH 4 + in each species. The model predicted that interpartner competition for NH 4 + could profoundly impact population dynamics. We then experimentally tested the predictions by culturing mutants lacking NH 4 + transporters in both NH 4 + competition assays and mutualistic cocultures. Both theoretical and experimental results indicated that the recipient must have a competitive advantage in acquiring cross-fed NH 4 + to sustain the mutualism. This recipient-biased competitive advantage is predicted to be crucial, particularly when the communally valuable nutrient is generated intracellularly. Thus, the very metabolites that form the basis for mutualistic cross-feeding can also be subject to competition between mutualistic partners. IMPORTANCE Mutualistic relationships, particularly those based on nutrient cross-feeding, promote stability of diverse ecosystems and drive global biogeochemical

Field Assessment of Gopher Tortoise Habitat at Camp Shelby, MS. Phase II: Overstory and Combined Assessments

Science.gov (United States)

2010-10-17

Magnolia virginiana 0 4.5 0 3.3 0 8.4 Nyssa sylvatica 0 6.7 0 8.8 0 2.5 Pinus echinata 0 0.2 1.8 0.7 0 0 Pinus elliotii 0 0 0.9 0 0.7 0 Pinus...palustris 93.0 53.4 71.9 38.2 88.1 73.6 Pinus taeda 0.5 5.3 0.9 8.8 0.7 1.9 Prunus serotina 0 6.7 1.4 1.1 0 0 Quercus spp. (red) 4.9 16.7 16.1 10.6

First report of partial albinism in genus Thrichomys (Rodentia: Echimyidae

Directory of Open Access Journals (Sweden)

Antonio Carlos da S.A. Neves

2014-01-01

Full Text Available Reports about albinism in rodents are common. In the family Echimyidae, however, albinism is very rare. This is the second case of coat color variation reported within Echimyidae and the first for the genus Thrichomys. The pelages of Thrichomys pachyurus individuals with normal and variant coat color were observed under a fluorescent artificial light and were examined with a stereoscopic microscope. The descriptions of pelage color were based on the book "Color Standards and Color Nomenclature". The predominantly white pattern of coat color in individuals of T. pachyurus suggests a partial albinism caused by delay in migration time of melanoblasts from neural crest to epidermis. The habitat of T. pachyurus has a heavy vegetative cover, which offers natural protection against predators and high-quality nutrition.

Phylogeographic study of Apodemus ilex (Rodentia: Muridae in Southwest China.

Directory of Open Access Journals (Sweden)

Qi Liu

Full Text Available BACKGROUND: The Mountains of southwest China have complex river systems and a profoundly complex topography and are among the most important biodiversity hotspots in the world. However, only a few studies have shed light on how the mountains and river valleys promote genetic diversity. Apodemus ilex is a fine model for investigating this subject. METHODOLOGY/PRINCIPAL FINDINGS: To assess the genetic diversity and biogeographic patterns of Apodemus ilex, the complete cytochrome b gene sequences (1,140 bp were determined from 203 samples of A. draco/ilex that were collected from southwest China. The results obtained suggested that A. ilex and A. draco are sistergroups and diverged from each other approximately 2.25 million years ago. A. ilex could be divided into Eastern and Western phylogroups, each containing two sub-groups and being widespread in different geographical regions of the southern Hengduan Mountains and the western Yunnan - Guizhou Plateau. The population expansions of A. ilex were roughly from 0.089 Mya to 0.023 Mya. CONCLUSIONS: Our result suggested that A. ilex is a valid species rather than synonym of A. draco. As a middle-high elevation inhabitant, the phylogenetic pattern of A. ilex was strongly related to the complex geographical structures in southwest China, particularly the existence of deep river valley systems, such as the Mekong and Salween rivers. Also, it appears that the evolutionary history of A. ilex, such as lineage divergences and population expansions were strongly affected by climate fluctuation in the Late Pleistocene.

(De Winton, 1897) and A. namaquensis (A. Smith, 1834) (Rodentia

African Journals Online (AJOL)

1993-03-24

Mar 24, 1993 ... genus Aethornys Thomas, the present study examines non- geographic variation in ... Watson 1986; Visser & Robinson 1986; 1987; Brecd, Cox,. Leigh & Hawkins 1988) ... Verheyen & Bracke (J 966), Morris (J 972), Perrin (J 982) and Dippenaar ...... GENOWA YS, H.H. & JONES, Jr., J.K. t972. Variation and.

The ways of formation Rodentis (Rodentia helminth fauna in Azerbaijan

Directory of Open Access Journals (Sweden)

Q. Q. Fataliyev

2009-01-01

Full Text Available There were researched 314 animals related to 6 genious in different zones of Azerbaijan. It is defined that 6 genious helminthes parasits on Sсiurus anomalus, 2 genious helminthes parasits on Hystrix leucura, 5 on Myocastor coypus, 3 on Dryomys nitedula, 13 genious helminthes and etc. parasits on Arvikola terrestris –totally 28 helminthes. There were fully analyzed bioecological connection with different living organisms in Azerbaijan.

The ways of formation Rodentis (Rodentia) helminth fauna in Azerbaijan

OpenAIRE

Q. Q. Fataliyev

2009-01-01

There were researched 314 animals related to 6 genious in different zones of Azerbaijan. It is defined that 6 genious helminthes parasits on Sсiurus anomalus, 2 genious helminthes parasits on Hystrix leucura, 5 on Myocastor coypus, 3 on Dryomys nitedula, 13 genious helminthes and etc. parasits on Arvikola terrestris –totally 28 helminthes. There were fully analyzed bioecological connection with different living organisms in Azerbaijan.

Cytogenetic investigations in Sciurus anomalus from Turkish Thrace (Rodentia: Sciuridae)

Czech Academy of Sciences Publication Activity Database

Arslan, A.; Zima, Jan

2012-01-01

Roč. 64, č. 4 (2012), s. 421-426 ISSN 0324-0770 Institutional support: RVO:68081766 Keywords : karyotype * C-banding * Ag-NOR staining * Caucasian squirrel * Turkey Subject RIV: EG - Zoology Impact factor: 0.309, year: 2012 http://www.acta-zoologica-bulgarica.eu/downloads/acta-zoologica-bulgarica/2012/64-4-421-426.pdf

CARACTERIZAÇÃO MORFOLÓGICA DE ACESSOS DE GERMOPLASMA DE QUATRO ESPÉCIES BRASILEIRAS DE AMENDOIM-SILVESTRE MORPHOLOGICAL CHARACTERIZATION OF GERMPLASM ACESSIONS OF FOUR BRAZILIAN SPECIES OF WILD PEANUT

Directory of Open Access Journals (Sweden)

RENATO FERRAZ DE ARRUDA VEIGA

2001-01-01

Full Text Available Caracterizaram-se morfologicamente os acessos de germoplasma de espécies silvestres brasileiras de amendoim do gênero Arachis L., Sect. Arachis e analisaram-se a similaridade genética entre acessos da mesma espécie e entre as espécies. Realizou-se o experimento nos anos agrícolas de 1993 a 1996, no Núcleo Experimental de Campinas, do Instituto Agronômico (IAC. Avaliaram-se os acessos disponíveis no Banco Ativo de Germoplasma de Espécies Silvestres de Arachis, da Embrapa Recursos Genéticos e Biotecnologia (CENARGEN - Brasília, DF, das espécies A. palustris Krapov., W.C. Gregory & Valls, A. decora Krapov., W.C. Gregory & Valls, A. praecox Krapov., W.C. Gregory & Valls e A. stenosperma Krapov. & W.C. Gregory, efetuando-se anotações fenotípicas quantitativas e qualitativas, conforme lista de descritores morfológicos. Observou-se que os acessos de A. stenosperma são semelhantes, apesar da sua grande distância geográfica, e diferem das demais espécies, formando um grupo mais coeso. Caracteres como o diâmetro do eixo central e o comprimento dos frutos e das sementes serviram para distingui-la das demais espécies. Arachis decora apresentou alta variação entre acessos nos vários caracteres morfológicos estudados. A. palustris apresentou alta variação morfológica entre acessos, ainda que tenham sido analisados apenas dois, para altura da planta, largura da semente, dimensões do esporão, istmo, folíolo, raque e eixo central e quanto à presença e ausência de tricomas no folíolo. Arachis praecox, representada por um único acesso, aproximou-se mais de A. decora que das demais espécies.In this work, a morphological characterization of germplasm accessions of wild Brazilian species of peanut, section Arachis was accomplished. Also, an analysis of the genetic similarity among accessions and between species was evaluated. The experiment was undertaken from 1993 to 1996, at the Campinas Experimental Station of the Instituto

Tula and Puumala hantavirus NSs ORFs are functional and the products inhibit activation of the interferon-beta promoter.

Science.gov (United States)

Jääskeläinen, Kirsi M; Kaukinen, Pasi; Minskaya, Ekaterina S; Plyusnina, Angelina; Vapalahti, Olli; Elliott, Richard M; Weber, Friedemann; Vaheri, Antti; Plyusnin, Alexander

2007-10-01

The S RNA genome segment of hantaviruses carried by Arvicolinae and Sigmodontinae rodents encodes the nucleocapsid (N) protein and has an overlapping (+1) open reading frame (ORF) for a putative nonstructural protein (NSs). The aim of this study was to determine whether the ORF is functional. A protein corresponding to the predicted size of Tula virus (TULV) NSs was detected using coupled in vitro transcription and translation from a cloned S segment cDNA, and a protein corresponding to the predicted size of Puumala virus (PUUV) NSs was detected in infected cells by Western blotting with an anti-peptide serum. The activities of the interferon beta (IFN-beta) promoter, and nuclear factor kappa B (NF-kappaB)- and interferon regulatory factor-3 (IRF-3) responsive promoters, were inhibited in COS-7 cells transiently expressing TULV or PUUV NSs. Also IFN-beta mRNA levels in IFN-competent MRC5 cells either infected with TULV or transiently expressing NSs were decreased. These data demonstrate that Tula and Puumala hantaviruses have a functional NSs ORF. The findings may explain why the NSs ORF has been preserved in the genome of most hantaviruses during their long evolution and why hantavirus-infected cells secrete relatively low levels of IFNs. (c) 2007 Wiley-Liss, Inc.

MÉTODOS DIRETOS E INDIRETOS PARA O REGISTRO DE MAMÍFEROS NO FRAGMENTO DE MATA ATLÂNTICA - UNIVAP, CAMPUS URBANOVA

Directory of Open Access Journals (Sweden)

Caio Ferreira

2017-05-01

Full Text Available A Mata Atlântica é um dos biomas mais ameaçados do Brasil e o estabelecimento de áreas protegidas é uma das formas para se conservar este bioma. Para legalizar uma unidade de conservação, é preciso conhecer a fauna e flora local. O trabalho objetiva inventariar a mastofauna terrestre em um fragmento de Mata Atlântica, localizado na divisa entre os municípios de Jacareí e São José dos Campos, SP. Foram utilizados dois métodos distintos: método direto (transecto linear e método indireto (parcela de areia. Como resultados foram registrados oito táxons distribuídos em quatro ordens: Cingulata, Carnivora, Didelphimorphia e Rodentia. Os dois métodos foram eficientes para o registro da mastofauna presente na área de estudo.

Filogenia molecular de especies colombianas de tres tribus de roedores dentro de la subfamilia Sigmodontinae (Muridae

Directory of Open Access Journals (Sweden)

Gabriel Ernesto Pantoja Peña

2006-01-01

Es importante la generación de estudios adicionales de información de tipo morfológico y molecular que ayuden a definir los límites a nivel de especies y géneros para estos importantes organismos de mamíferos del neotrópico, muchos de ellos presentes en Colombia.

Presence of indicator plant species as a predictor of wetland vegetation integrity

Science.gov (United States)

Stapanian, Martin A.; Adams, Jean V.; Gara, Brian

2013-01-01

We fit regression and classification tree models to vegetation data collected from Ohio (USA) wetlands to determine (1) which species best predict Ohio vegetation index of biotic integrity (OVIBI) score and (2) which species best predict high-quality wetlands (OVIBI score >75). The simplest regression tree model predicted OVIBI score based on the occurrence of three plant species: skunk-cabbage (Symplocarpus foetidus), cinnamon fern (Osmunda cinnamomea), and swamp rose (Rosa palustris). The lowest OVIBI scores were best predicted by the absence of the selected plant species rather than by the presence of other species. The simplest classification tree model predicted high-quality wetlands based on the occurrence of two plant species: skunk-cabbage and marsh-fern (Thelypteris palustris). The overall misclassification rate from this tree was 13 %. Again, low-quality wetlands were better predicted than high-quality wetlands by the absence of selected species rather than the presence of other species using the classification tree model. Our results suggest that a species’ wetland status classification and coefficient of conservatism are of little use in predicting wetland quality. A simple, statistically derived species checklist such as the one created in this study could be used by field biologists to quickly and efficiently identify wetland sites likely to be regulated as high-quality, and requiring more intensive field assessments. Alternatively, it can be used for advanced determinations of low-quality wetlands. Agencies can save considerable money by screening wetlands for the presence/absence of such “indicator” species before issuing permits.

Multilocus phylogeography and systematic revision of North American water shrews (genus: Sorex)

Science.gov (United States)

Hope, Andrew G.; Panter, Nicholas; Cook, Joseph A.; Talbot, Sandra L.; Nagorsen, David W.

2014-01-01

North American water shrews, which have traditionally included Sorex alaskanus, S. bendirii, and S. palustris, are widely distributed through Nearctic boreal forests and adapted for life in semiaquatic environments. Molecular mitochondrial signatures for these species have recorded an evolutionary history with variable levels of regional divergence, suggesting a strong role of Quaternary environmental change in speciation processes. We expanded molecular analyses, including more-comprehensive rangewide sampling of specimens representing North American water shrew taxa, except S. alaskanus, and sequencing of 4 independent loci from the nuclear and mitochondrial genomes. We investigated relative divergence of insular populations along the North Pacific Coast, and newly recognized diversity from southwestern montane locations, potentially representing refugial isolates. Congruent independent genealogies, lack of definitive evidence for contemporary gene flow, and high support from coalescent species trees indicated differentiation of 4 major geographic lineages over multiple glacial cycles of the late Quaternary, similar to a growing number of boreal taxa. Limited divergence of insular populations suggested colonization following the last glacial. Characterization of southwestern montane diversity will require further sampling but divergence over multiple loci is indicative of a relictual sky-island fauna. We have reviewed and revised North American water shrew taxonomy including the recognition of 3 species within what was previously known as S. palustris. The possibility of gene flow between most distantly related North American water shrew lineages coupled with unresolved early diversification of this group and other sibling species reflects a complex but potentially productive system for investigating speciation processes.

Anatomía foliar y caulinar en especies de Stemodia (Scrophulariaceae Foliar and caulinar anatomy in species of Stemodia (Scrophulariaceae

Directory of Open Access Journals (Sweden)

Maria De Las Mercedes Sosa

2005-07-01

Full Text Available Se describe la estructura anatómica foliar y caulinar en el género Stemodia. Son consideradas siete especies: S. ericifolia (Kuntze K. Schum., S. hyptoides Cham. & Schltdl., S. lanceolata Benth., S. lobelioides Lehm., S. palustris A. St.-Hil., S. stricta Cham. & Schltdl. y S. verticillata (Mill. Hassl. Se hallaron diferencias en la epidermis foliar, donde hay variación en el tipo de estomas y de tricomas, y en la forma de las papilas epidérmicas; también en la estructura del mesofilo. Se describen e ilustran cuatro tipos de tricomas considerando si son o no glandulares y el número de células que lo conforman. El estudio de la anatomía caulinar mostró diferencias en cuanto a la presencia de aerénquima cortical y de laguna medular, y el porcentaje de espacios en el aerénquima cortical.Comparative anatomical studies of the leaves and stems on the genus Stemodia are presented. Seven species are considered: S. ericifolia (Kuntze K. Schum., S. hyptoides Cham. & Schltdl., S. lanceolata Benth., S. lobelioides Lehm., S. palustris A. St.-Hil., S. stricta Cham. & Schltdl. and S. verticillata (Mill. Hassl. There are variation in the stomatal and trichome types, form of the papillae and mesophyll structure. Four trichome types are described and illustrated considering if they are glandular or non-glandular and the number of cells. The stems present a quite homogeneous anatomical structure. Some differences in the amount and distribution of the aerenchyma and the size of the intercellular spaces are observed.

Relaciones biogeográficas de los sistemas montañosos de la Península Ibérica: el caso de los micromamíferos

Directory of Open Access Journals (Sweden)

Vargas, J. M.

2003-12-01

Full Text Available In the present paper we analyse the biogeographical relationship between the 12 mountain ranges surrounding the western Mediterranean basin, according to their micromammal fauna (70 species belonging to the orders Erinaceomorpha, Soricomorpha and Rodentia. Using an area classification analysis, we performed a biogeographical regionalization of the study area, and later we characterised the biotic boundaries detected. We also identified the interchanges of species that could have happened between the mountain ranges considered. A strong boundary exists between the European and African faunas, which is characterised by a higher energy availability in the south. For non-rodents micromammals there is also a week boundary between the exclusively-Iberian mountain ranges and the northern ones, which is characterised by a higher simultaneous availability of water and energy in the north. Finally, we suggest the existence of a main interchange of species between Europe and the Iberian Peninsula.

En el presente artículo se analiza la relación biogeográfica de los 12 sistemas montañosos que circundan la parte más occidental de la cuenca mediterránea, en función de su fauna de micromamíferos (70 especies pertenecientes a los órdenes Erinaceomorpha, Soricomorpha y Rodentia. Se ha llevado a cabo una regionalización biogeográfica del área de estudio, mediante un análisis de clasificación de áreas, y posteriormente se han caracterizado ambientalmente las fronteras bióticas detectadas. Por último, se han identificado los posibles intercambios de especies que han tenido lugar entre los sistemas montañosos considerados. Existe una frontera fuerte entre las faunas europea y africana, caracterizada en términos ambientales por una mayor disponibilidad de energía en el sur. Además, para los micromamíferos no roedores, se detecta una frontera débil que separa los sistemas montañosos exclusivamente ibéricos del resto, caracterizada por

Identification and growth conditions of purple non-sulfur photosynthetic bacteria isolated from palm oil mill effluent

International Nuclear Information System (INIS)

Radziah Ariffin

2004-01-01

An indigenous strain of the purple non-sulphur photosynthetic bacterium, isolated from palm oil mill effluent was presumably identified as species of Rhodopseudomonas palustris. Cultivation in synthetic medium under different conditions indicated that it gave maximum carotenoid and bacteriophyll synthesis under anaerobic conditions in the light with values of 12.6 and 108.1 mg/g dry cell weight respectively. These values were significantly higher than the pigment content obtained from aerobic cultivation. The specific growth rates in anaerobic was twice those in aerobic conditions in the light. Growth was not occurred in anaerobic or aerobic conditions in the dark. (Author)

Comportamentos e atividade diária de Sciurus ingrami (Thomas em cativeiro (Rodentia, Sciuridae Behaviour and diary activity of Sciurus ingrami (Thomas in captivity (Rodentia, Sciuridae

Directory of Open Access Journals (Sweden)

Marcelo Bordignon

1997-09-01

Full Text Available From October 1994 to November 1995 the behaviour, postures and diurnal activity of tive captive squirrels Sciurus ingrami were observed and registered. Four basics postures, five grooming behaviours, displacements and face wiping behaviour were identified. Based on behavioural observations, the diurnal activity was divided into four categories: resting, displacement, teeding and maintenance. The time spent in each category varied seasonally and the squirrels spent more time resting during winter and spring. However, more time was spent feeding during autum and summer and was reduced the displacement in autum. Two types of breeding behaviour were identified: sexual trailing and mating chase of females by males. However copulatori behaviour was not recorded during the studied period. We also verified that S. ingrami presents thermorregulation behaviour during winter, remaining resting in the nest to conserve energy in heath maintenance. During the hottest seasons, the squirrels remain resting out of the nest, placed on the branchs to decrease their body heat to normal temperature, The behaviours observed in this study were similar to those described in the literature, as well as the mating behaviour, which was very similar to S. carolinensis.

Fungi from interior organs of free-living small mammals in Czechoslovakia and Yugoslavia.

Science.gov (United States)

Hubálek, Z; Rosický, B; Otcenásek, M

1980-01-01

A total of 308 fungi was isolated from interior organs (lungs, spleen, liver) of 529 small mammals belonging to 21 species, 7 families and 3 orders (Insectivora, Chiroptera, Rodentia), some of these being potentially pathogenic to vertebrates (e.g. Aspergillus flavus, A. fumigatus, Geotrichum candidum, Mucor pusillus, Rhizopus arrhizus). In one vole (Microtus arvalis) captured in South Moravia, adiaspiromycosis (Emmonsia crescens) was demonstrated. Comparison of mycoflora of hair and that of interior organs of wild small mammals revealed that out of the total number of isolates the following fungi were represented in a higher proportion from visceral organs than from the hair: Aspergillus (A. amstelodami, A. flavus, A. repens), Aureobasidium (A. pullulans), Candida, Cladosporium (C. herbarum), Cryptococcus, Fusarium, Gliocladium (G. deliquescens), Helminthosporium, Kloeckera, Mucor (M. fragilis, M. hiemalis, M. pusillus), Paecilomyces marquandii, Penicillium (P. purpurogenum), Phoma, Rhizopus arrhizus, Scopulariopsis (S. candida, S. koningii) and Torulopsis.

Morphogenesis of palatal ridges in the golden hamster (Mesocricetus auratus, Rodentia)

Czech Academy of Sciences Publication Activity Database

Buchtová, M.; Matulová, Petra; Witter, K.; Tichý, F.

2005-01-01

Roč. 74, č. 3 (2005), s. 319-327 ISSN 0001-7213 R&D Projects: GA MŠk OC B23.001 Institutional research plan: CEZ:AV0Z50450515 Keywords : oral cavity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.353, year: 2005

The role of the water voles (Arvicola, Rodentia in the Quatemary

Directory of Open Access Journals (Sweden)

Ruiz Bustos, A.

1999-04-01

Full Text Available Arvicolids are rodents which have molars with a morphology formed by a sequence of enamel folds similar to the curve y = sin f(x. The morphology of the crown of the first lower molar (mi of living species of Arvicola (large voles is identified with six criteria, irrespective of tooth size. When rootless arvicolid fossil communities are analysed, it can be seen that the mi morphology of Arvicola is present in those communities represented by specimens of small size at the beginning of the Quaternary. Before this data was known, the presence of Arvicola communities could only be detected in the second half of the Quaternary, when the specimens were comparable to the large size characterising living species. The existence of communities of small-sized Arvicola at the beginning of the Quaternary implies that the mi of Arvicola undergoes a continuous and accelerated growth throughout the entire Quatemary, which allows representatives the genus to be used as a chronological tool. These data mean that it is necessary to change the concept of the genus Allophaiomys and to formulate a new classification to reflect evolutionary relationships of quatemary arvicolids.Los arvicólidos son roedores que tienen la morfología de la corona de los dientes formada por una secuencia de pliegues de esmalte que se asemeja a la curva y=sen f(x. Las especies actuales del género Arvicola cumplen en la morfología del molar mI, seis criterios que son independientes de la talla. El examen de las poblaciones de arvicólidos sin raíz, procedentes del Pleistoceno inferior, indica la existencia de molares con una morfología idéntica a la de los ejemplares vivos de Arvicola, pero con menor talla. La existencia de esta identidad permite proponer la hipótesis de poblaciones primitivas del género Arvicola con pequeña talla durante el Pleistoceno Inferior. Estas han pasado desapercibidas entre las poblaciones de Allophaiomys. a causa de su identidad morfológica entre ambos. La hipótesis de la existencia de Arvicola en el Pleistoceno Inferior supone un profundo cambio en el concepto de Allophaiomys como género y convierte la talla de Arvicola, por su continuo crecimiento durante todo el Pleistoceno, en un útil instrumento cronológico.

Fleas (Siphonaptera) in the Nests of Dormice (Gliridae: Rodentia) in Lithuania.

Science.gov (United States)

Lipatova, I; Stanko, M; Paulauskas, A; Spakovaite, S; Gedminas, V

2015-05-01

Negative effects of flea (Siphonaptera) parasitism on the host may be expressed in different ways. The aim of this study was to assess distribution of the flea fauna in nests of dormice in Lithuania. Nests of Glis glis (L.), Dryomys nitedula (Pallas), and Muscardinus avellanarius (L.) were collected from nest boxes in 2012 and 2013. Fleas were collected from nests in the laboratory and put into plastic tubes with 70% ethanol. Flea species were identified using morphological keys. From 400 nest boxes, 112 nests of dormice were collected from eight sites from mixed forests of central Lithuania. Twenty-three nests of G. glis were collected from nest boxes, with 16 of them containing 286 fleas belonging to four species: Ceratophyllus sciurorum (Schrank) (259), C. gallinae (Schrank) (23), Hystrichopsylla talpae (Curtis) (3), and Megabothris turbidus (Rothschild) (1). Fourteen nests of M. avellanarius were collected from nest boxes, 4 of which contained 224 fleas belonging to two species: C. sciurorum (221) and C. gallinae (3). Twenty-four nests of D. nitedula were collected from nest boxes, including 17 containing 207 fleas belonging to two species: C. sciurorum (205) and C. gallinae (2). Fifty-one nests of undetermined dormice species also were collected from nest boxes, 12 of them contained 395 fleas belonging to three species: C. sciurorum (374), Ctenophthalmus agyrtes (Heller) (19), and Ctenophthalmus assimilis (Taschenberg) (2). C. sciurorum was a predominant species in the nests of dormice. The occurrence of C. gallinae was documented in Lithuania for the first time. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

A new species of Lentiella (Cestoda: Anoplocephalidae from Proechimys simonsi (Rodentia: Echimyidae in Bolivia Una especie nueva de Lentiella (Cestoda: Anoplocephalidae de Proechimys (Rodentia: Echimyidae en Bolivia

Directory of Open Access Journals (Sweden)

Terry R. Haverkost

2008-08-01

Full Text Available During a biodiversity survey of mammals and their parasites in the Beni, Bolivia in the summer of 2000, several spiny rats, Proechimys simonsi Thomas, 1900, were collected and examined for parasites. Herein we describe Lentiella lamothei n. sp. from one of these hosts. This species is can be distinguished from L. machadoi Rêgo, 1964 by having a greater total length but smaller maximum width, a greater number of segments, a smaller cirrus sac, a smaller scolex diameter, and in the eggs, a larger pyriform apparatus. In addition, we formally validate the genus Lentiella Rêgo, 1964, that had been placed in synonomy with Monoecocestus Beddard, 1914.Como parte del monitoreo de la biodiversidad de Bolivia, varias ratas espinosas (Proechimys simonsi Thomas, 1900 fueron examinadas en busca de parásitos durante el verano boreal del año 2000. En el presente trabajo se describe el céstodo Lentiella lamothei n. sp. recolectado en estos hospederos. Esta especie puede distinguirse de L. machadoi Rêgo, 1964 por tener una mayor longitud total pero menor ancho máximo, mayor número de proglótidos, bolsa del cirro más pequeña, escólex de menor diámetro, y un mayor aparato piriforme en los huevos. Además, se revalida formalmente al género Lentiella Rêgo, 1964, anteriormente sinonimizado con Monoecocestus Beddard, 1914.

Serological Evidence of Hantavirus Infection in Apparently Healthy People from Rural and Slum Communities in Southern Chile

Directory of Open Access Journals (Sweden)

Claudia Muñoz-Zanzi

2015-04-01

Full Text Available Hantavirus disease in America has been recognizable because of its rapid progression in clinical cases, occurrence in previously healthy young adults, and high case fatality rate. Hantavirus disease has been proposed now to define the diversity of clinical manifestations. Since 1995, a total of 902 cases of hantavirus pulmonary syndrome have been reported in Chile, caused by Andes virus (ANDV, with overall fatality of 32%. This report describes the sero-epidemiology of hantavirus in apparently healthy people in rural and urban slum communities from southern Chile. Ten of 934 samples yielded a positive result resulting in a seroprevalence of 1.07% (95% confidence intervals: 0.05%–2.0%. A higher proportion of positive samples was found among individuals from rural villages (1.3% and slums (1.5% compared with farms (0.5%. Seropositivity was associated with age (p = 0.011, low education level (p = 0.006 and occupations linked to the household (homemaker, retired, or student (p = 0.016. No evidence of infection was found in 38 sigmodontinae rodents trapped in the peri-domestic environment. Our findings highlight that exposure risk was associated with less documented risk factors, such as women in slum and rural villages, and the occurrence of infection that may have presented as flu-like illness that did not require medical attention or was misdiagnosed.

Prevalence and risk factors for encephalomyocarditis virus infection in Peru.

Science.gov (United States)

Czechowicz, Josephine; Huaman, Jose Luis; Forshey, Brett M; Morrison, Amy C; Castillo, Roger; Huaman, Alfredo; Caceda, Roxana; Eza, Dominique; Rocha, Claudio; Blair, Patrick J; Olson, James G; Kochel, Tadeusz J

2011-04-01

Although encephalomyocarditis virus (EMCV) infection has been commonly documented among domestic animals, less is known about EMCV transmission among humans. Recently, we described the isolation of EMCV from two febrile patients in Peru. To further investigate EMCV transmission in Peru, we screened febrile patients reporting to health clinics in Peru for serological evidence of recent EMCV infection. We also conducted a serological survey for EMCV-neutralizing antibodies in the city of Iquitos, located in the Amazon basin department of Loreto, Peru. Additionally, we screened serum from rodents collected from 10 departments in Peru for evidence of EMCV exposure. EMCV infection was found to be only rarely associated with acute febrile disease in Peru, accounting for 17% in cities in the tropical rainforest of northeastern Peru (Iquitos and Yurimaguas). On the basis of the serological survey conducted in Iquitos, risk factors for past infection include increased age, socioeconomic indicators such as residence construction materials and neighborhood, and swine ownership. Evidence from the rodent survey indicates that EMCV exposure is common among Murinae subfamily rodents in Peru (9.4% EMCV IgG positive), but less common among Sigmodontinae rodents (1.0% positive). Further studies are necessary to more precisely delineate the mode of EMCV transmission to humans, other potential disease manifestations, and the economic impact of EMCV transmission among swine in Peru.

Methylocapsa acidiphila gen. nov., sp. nov., a novel methane-oxidizing and dinitrogen-fixing acidophilic bacterium from Sphagnum bog.

Science.gov (United States)

Dedysh, Svetlana N; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Semrau, Jeremy D; Liesack, Werner; Tiedje, James M

2002-01-01

A novel genus and species, Methylocapsa acidiphila gen. nov., sp. nov., are proposed for a methane-oxidizing bacterium isolated from an acidic Sphagnum peat bog. This bacterium, designated strain B2T, represents aerobic, gram-negative, colourless, non-motile, curved coccoids that form conglomerates covered by an extracellular polysaccharide matrix. The cells use methane and methanol as sole sources of carbon and energy and utilize the serine pathway for carbon assimilation. Strain B2T is a moderately acidophilic organism with growth between pH 4.2 and 7.2 and at temperatures from 10 to 30 degrees C. The cells possess a well-developed system of intracytoplasmic membranes (ICM) packed in parallel on only one side of the cell membrane. This type of ICM structure represents a novel arrangement, which was termed type III. The resting cells are Azotobacter-type cysts. Strain B2T is capable of atmospheric nitrogen fixation; it possesses particulate methane monooxygenase and does not express soluble methane monooxygenase. The major phospholipid fatty acid is 18:1omega7c and the major phospholipids are phosphatidylglycerols. The G+C content of the DNA is 63.1 mol%. This bacterium belongs to the alpha-subclass of the Proteobacteria and is most closely related to the acidophilic methanotroph Methylocella palustris KT (97.3% 16S rDNA sequence similarity). However, the DNA-DNA hybridization value between strain B2T and Methylocella palustris K(T) is only 7%. Thus, strain B2T is proposed to comprise a novel genus and species, Methylocapsa acidiphila gen. nov., sp. nov. Strain B2T (= DSM 13967T = NCIMB 13765T) is the type strain.

Systematic studies of Oryzomyine rodents (Muridae, Sigmodontinae): diagnoses and distributions of species formerly assigned to Oryzomys 'capito'

Science.gov (United States)

Musser, G.G.; Carleton, M.D.; Brothers, E.M.; Gardner, A.L.

1998-01-01

We describe the morphological species-boundaries and geographic distributions of ten Neotropical Oryzomys based on analyses of museum specimens (skins and skulls, examples preserved in fluid, chromosomal spreads, and information about collection sites from skin tags, field catalogs, and other sources). These species have been regarded as members of an Oryzomys capito complex and for a long time were consolidated into a single entity identified as O. capito. Our study documents the following: 1. Defining the limits of species within the O. capito complex first requires a comprehensive review and rigorous definition of O. capito itself. We consider Fischer's (1814) Mus megacephalus to be valid and available, designate a neotype to bear the name, and reinstate it as a senior synonym of capito Olfers (1818). We then provide a working definition of O. megacephalus and its close relative, O. laticeps, derived from analyses of morphometric variation, estimates of geographic distributions, and evaluations of synonyms. In our view, O. megacephalus occurs in Amazonia but also extends into eastern Paraguay; its synonyms are capito Olfers (1818), cephalotes Desmarest (1819), velutinus Allen and Chapman (1893), goeldi Thomas (1897), modestus Allen (1899), and perenensis Allen (1901). Oryzomys laticeps Lund (1840) occurs in the Atlantic Forest region of eastern Brazil. We designate a lectotype for laticeps and allocate the names saltator Winge (1887) and oniscus Thomas (1904) as synonyms. 2. We provide the first comprehensive taxonomic revision of Oryzomys yunganus Thomas (1902). Its range covers tropical evergreen rainforest formations in the Guiana region and the Amazon Basin where, as documented by voucher specimens, it has been collected at the same localities as O. megacephalus, O. nitidus, and O. tern of carotid arterial circulation, occlusal patterns of second upper and lower molars, cranial proportions, and chromosomal features. Appreciable intraspecific geographic variation occurs in diploid number of chromosomes and frequency of occurrence of the hypothenar plantar pad, but sampling inadequacies obscure the significance of this variation. Large body size is characteristic of populations in the western Amazon Basin and in the tepui region of eastern Venezuela; smaller size characterizes populations in the Guianas and along the eastern margin of the Amazon Basin. No other scientific name has been correctly associated with the species. Samples from Mirador, Palmera, and Mera in the western Andean foothills of central Ecuador possess a combination of pelage, cranial, and dental traits that distinguish them from all samples of O. yunganus. These specimens are the basis for a new species we describe here, one that is more closely related to O. yunganus than to any other member of the former O. 'capito' complex. 3. We redescribe Oryzomys bolivaris (reviewed by Pine, 1971, under the name O. bombycinus), amplify its geographic range, and contrast it with O. talamancae and O. alfaroi, two sympatric congeners often confused with it. A distinctive set of morphological traits allows unambiguous identification of specimens belonging to O. bolivaris. It is a trans-Andean species recorded from very wet tropical evergreen rainforests extending from eastern Honduras and Nicaragua through Costa Rica and Panama to western Colombia and Ecuador. Allen's (1901) bolivaris is the oldest name for this species; castaneus Allen (1901), rivularis Allen (1901), bombycinus Goldman (1912), alleni Goldman (1915), and orinus Pearson (1939) are synonyms. 4. We revise the definition of Oryzomys talamancae Allen (1891) provided by Musser and Williams (1985), document additional specimens, describe karyotypes from Ecuadoran and Venezuelan samples, and contrast its morphology, chromosomes, and distribution with those of O. alfaroi and O. megacephalus. The geographic distribution of O. talamancae is also trans-Andean, but it inh

Macrophytes of the Grlište reservoir (Serbia: Fifteen years after its establishment

Directory of Open Access Journals (Sweden)

Stanković Ž.

2009-01-01

Full Text Available A large number of macrophytes, often in dense populations, have developed on the Grlište Reservoir, Serbia over a period of 15 years. Fast development of vegetation is a consequence of anthropogenic impact in lake management. The methodology used in this research covered 100% of the water body, including all areas with or without aquatic plants. The results indicate that plant communities are still in the early phase of development. This leaves space for future development of competitor macrophyte species (Najas marina, Eleocharis palustris, Typha latifolia, Typha angustifolia, Phragmites australis, etc. capable of endangering stability of the lake, which will tend toward eutrophication.

Influence of unreasoned economic activity on the condition of macrophytes of the Bol’shoye Goluboye Lake

Science.gov (United States)

Palagushkina, O. V.; Zaripova, N. R.; Mingazova, N. M.; Yarutkin, T. O.

2018-01-01

The ecosystem of Lake Bolshoye Goluboe had undergone a strong anthropogenic impact in 2013 as a result of the implementation of the dam reconstruction project. Studies in 2014 have shown that the implementation of the project for the reconstruction of the Bolshoye Goluboe dam has negatively affected on the species richness of macrophytes. The total species composition of the lake and species richness of the water core decreased twofold, Hippuris vulgaris L., Zannichellia palustris L, Ceratophyllum demersum L., and the species listed in the Red Book of the Republic of Tatarstan - Batrachium circinatum (Sibth.) Spach disappeared from the species composition. The area occupied by macrophyte communities has decreased by 55%.

REVISED AND COMMENTED CHECKLIST OF MAMMAL SPECIES OF THE ROMANIAN FAUNA

Directory of Open Access Journals (Sweden)

Dumitru Murariu

2015-12-01

Full Text Available Due to the permanent influences of different factors (habitat degradation and fragmentation, deforestation, infrastructure and urbanization, natural extension or decreasing of some species’ distribution, increasing number of alien species etc., from time to time the faunistic structure of a certain area is changing. As a result of the permanent and increasing anthropic and invasive species’ pressure, our previous checklist of recent mammals from Romania (since 1984 became out of date. A number of 108 taxa are mentioned in this checklist, representing 7 orders of mammals: Insectivora (10 species, Chiroptera (30 sp., Lagomorpha (2 sp., Rodentia (35 sp., Cetacea (3 sp., Carnivora (19 sp., Artiodactyla (8 sp.. In this list are mentioned the scientific and vernacular names (in Romanian and English languages, species distribution and conservation status, according to the Romanian regulations. Thus, only 21 species have stable populations while 76 have populations in decline or in drastic decline. Other categories are not evaluated or even present an increase in their population.

Unusual loss of chymosin in mammalian lineages parallels neo-natal immune transfer strategies.

Science.gov (United States)

Lopes-Marques, Mónica; Ruivo, Raquel; Fonseca, Elza; Teixeira, Ana; Castro, L Filipe C

2017-11-01

Gene duplication and loss are powerful drivers of evolutionary change. The role of loss in phenotypic diversification is notably illustrated by the variable enzymatic repertoire involved in vertebrate protein digestion. Among these we find the pepsin family of aspartic proteinases, including chymosin (Cmy). Previous studies demonstrated that Cmy, a neo-natal digestive pepsin, is inactivated in some primates, including humans. This pseudogenization event was hypothesized to result from the acquisition of maternal immune immunoglobulin G (IgG) transfer. By investigating 94 mammalian subgenomes we reveal an unprecedented level of Cmy erosion in placental mammals, with numerous independent events of gene loss taking place in Primates, Dermoptera, Rodentia, Cetacea and Perissodactyla. Our findings strongly suggest that the recurrent inactivation of Cmy correlates with the evolution of the passive transfer of IgG and uncovers a noteworthy case of evolutionary cross-talk between the digestive and the immune system, modulated by gene loss. Copyright © 2017 Elsevier Inc. All rights reserved.

Bov-B-mobilized SINEs in vertebrate genomes.

Science.gov (United States)

Gogolevsky, Konstantin P; Vassetzky, Nikita S; Kramerov, Dmitri A

2008-01-15

Two new short retroposon families (SINEs) have been found in the genome of springhare Pedetes capensis (Rodentia). One of them, Ped-1, originated from 5S rRNA, while the other one, Ped-2, originated from tRNA-derived SINE ID. In contrast to most currently active mammalian SINEs mobilized by L1 long retrotransposon (LINE), Ped-1 and Ped-2 are mobilized by Bov-B, a LINE family of the widely distributed RTE clade. The 3' part of these SINEs originates from two sequences in the 5' and 3' regions of Bov-B. Such bipartite structure of the LINE-derived part has been revealed in all Bov-B-mobilized SINEs known to date (AfroSINE, Bov-tA, Mar-1, and Ped-1/2), which distinguishes them from other SINEs with only a 3' LINE-derived part. Structural analysis and the distribution of Bov-B LINEs and partner SINEs supports the horizontal transfer of Bov-B, while the SINEs emerged independently in lineages with this LINE.

An explanation of the relationship between mass, metabolic rate and characteristic length for placental mammals.

Science.gov (United States)

Frasier, Charles C

2015-01-01

The Mass, Metabolism and Length Explanation (MMLE) was advanced in 1984 to explain the relationship between metabolic rate and body mass for birds and mammals. This paper reports on a modernized version of MMLE. MMLE deterministically computes the absolute value of Basal Metabolic Rate (BMR) and body mass for individual animals. MMLE is thus distinct from other examinations of these topics that use species-averaged data to estimate the parameters in a statistically best fit power law relationship such as BMR = a(bodymass) (b) . Beginning with the proposition that BMR is proportional to the number of mitochondria in an animal, two primary equations are derived that compute BMR and body mass as functions of an individual animal's characteristic length and sturdiness factor. The characteristic length is a measureable skeletal length associated with an animal's means of propulsion. The sturdiness factor expresses how sturdy or gracile an animal is. Eight other parameters occur in the equations that vary little among animals in the same phylogenetic group. The present paper modernizes MMLE by explicitly treating Froude and Strouhal dynamic similarity of mammals' skeletal musculature, revising the treatment of BMR and using new data to estimate numerical values for the parameters that occur in the equations. A mass and length data set with 575 entries from the orders Rodentia, Chiroptera, Artiodactyla, Carnivora, Perissodactyla and Proboscidea is used. A BMR and mass data set with 436 entries from the orders Rodentia, Chiroptera, Artiodactyla and Carnivora is also used. With the estimated parameter values MMLE can calculate characteristic length and sturdiness factor values so that every BMR and mass datum from the BMR and mass data set can be computed exactly. Furthermore MMLE can calculate characteristic length and sturdiness factor values so that every body mass and length datum from the mass and length data set can be computed exactly. Whether or not MMLE can

[Methanotrophic bacteria of acid sphagnum bogs].

Science.gov (United States)

Dedysh, S N

2002-01-01

Acid sphagnum bogs cover a considerable part of the territory of Russia and are an important natural source of biogenic methane, which is formed in their anaerobic layers. A considerable portion of this methane is consumed in the aerobic part of the bog profile by acidophilic methanotrophic bacteria, which comprise the methane filter of sphagnum bogs and decrease CH4 emission to the atmosphere. For a long time, these bacteria escaped isolation, which became possible only after the elucidation of the optimal conditions of their functioning in situ: pH 4.5 to 5.5; temperature, from 15 to 20 degrees C; and low salt concentration in the solution. Reproduction of these conditions and rejection of earlier used media with a high content of biogenic elements allowed methanotrophic bacteria of two new genera and species--Methylocella palustris and Methylocapsa acidophila--to be isolated from the peat of sphagnum bogs of the northern part of European Russia and West Siberia. These bacteria are well adapted to the conditions in cold, acid, oligotrophic sphagnum bogs. They grow in a pH range of 4.2-7.5 with an optimum at 5.0-5.5, prefer moderate temperatures (15-25 degrees C) and media with a low content of mineral salts (200-500 mg/l), and are capable of active nitrogen fixation. Design of fluorescently labeled 16S rRNA-targeted oligonucleotide probes for the detection of Methylocella palustris and Methylocapsa acidophila and their application to the analysis of sphagnum peat samples showed that these bacteria represent dominant populations of methanotrophs with a density of 10(5)-10(6) cells/g peat. In addition to Methylocella and Methylocapsa populations, one more abundant population of methanotrophs was revealed (10(6) cells/g peat), which were phylogenetically close to the genus Methylocystis.

[Construction and Characterization of B850-Only LH2 Energy Transfer System in Purple Bacteria].

Science.gov (United States)

Li, Kai; Zhao, Chun-gui; Yue, Hui-ying; Yang, Su-ping; Qu, Yin-bo; Jiao, Nian-zhi

2015-04-01

To seek microscopic molecular mechanism of energy transfer and complex reconstitution in the photosynthesis, the conditions for construction of B850-only peripheral light-harvesting complex (LH2) and their properties were investigated using absorption, fluorescence spectroscopy, molecular sieve chromatography, ultrafiltration and sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) from the purple bacteria. The results indicated that bacteriochlorophylls (BChl) of B800 incubated in 10 mmo · L(-1) Tris-HCl (pH 8.0) buffer are selectively released from their binding sites of LH2 of Rhodobacter azotoformans (A-LH2) by 0.08% (W/V) SDS. B850-only A-LH2 was constructed after removing free BChl mixing with 10% methyl alcohol by ultrafiltration. B850 BChl was released after A-LH2 was incubated for 240 min in dark at room temperature (RT). While BChl of B800 incubated in pH 1.9 buffer were selectively released from their binding sites of LH2 of Rhodopseudomonas palustris (P-LH2). The authors acquired two components using molecular sieve chromatography. Free BChl of one component was not removed and self-assembled to P-LH2. The other removed free BChl and B850-only P-LH2 was constructed. B850 unchanged after P-LH2 was incubated. P-LH2 α and β subunits have different molecular weights, but those of A-LH2 are in the contrary. It is concluded that B850-only P-LH2 is more stable than A-LH2. The enigmatic split of the B800 absorption band was not observed in these LH2, but we acquired two kinds of B800-released LH2 from Rhodopseudomonas palustris. The authors' results may provide a new light to separate homogeneous Apoprotein LH2.

Distribution of cobalt 60 in a mollusc, a crustacean and a freshwater teleost: variations as a function of the source of pollution and during elimination

International Nuclear Information System (INIS)

Amiard, J.C.; Amiard-Triquet, C.

1979-01-01

57 Co, 58 Co and 60 Co are present in nuclear test debris as well as in effluents of the non-military nuclear industry. The stable isotope, which is a constituent of vitamin B 12 , has very important biological functions. For each species, three experiments were carried out: (1) starved animals were immersed in 60 Co-contaminated water; (2) animals were immersed in contaminated water and received radioactive food and (3) animals were placed in fresh water without any pollutant but received contaminated food. Radiation doses were calculated for contamination via both food and water. When 60 Co is taken up directly from water, the most contaminated organs are external ones, especially the shell of the snail Lymnaea palustris and the exoskeleton and feeding appendages of the crayfish Astacus leptodactylus. Contamination via food is responsible for a relatively greater accumulation of radiocobalt in internal organs. The cobalt content of muscles - that is to say the edible parts of crayfish and common carp Cyprinus carpio -is very low. The highest concentrations recorded are in the visceral mass of the snail, the digestive gland of the crayfish and the kidneys of the carp. Internal doses for these organs are considerably higher than those for entire animals. Therefore, as a result of 60 Co distribution, they are critical organs for the freshwater species. Except for the carp, external radiation is very weak compared with internal radiation. A strong retention of 60 Co is observed for the shell of L. palustris while the desorption of radiocobalt from the exoskeleton of A. leptodactylus is easier. In carp, the 60 Co taken up by the gut from food, as well as from water, is rapidly eliminated. (author)

A Borrelia afzelii Infection Increases Larval Tick Burden on Myodes glareolus (Rodentia

NARCIS (Netherlands)

Duijvendijk, van Gilian; Andel, van Wouter; Fonville, Manoj; Gort, Gerrit; Hovius, Joppe W.; Sprong, Hein; Takken, Willem

2017-01-01

Several microorganisms have been shown to manipulate their host or vector to enhance their own transmission. Here we examined whether an infection with Borrelia afzelii affects its transmission between its bank vole (Myodes glareolus, Schreber, 1780) host and tick vector. Captive-bred bank voles

ectoparasites of the bush cep.a.pi, in the transvaal (rodentia: sciuridae)

African Journals Online (AJOL)

plague in Mrica and in some places it is probably the main vector. An additional record of the flea,. Xenopsylla sp., was also recorded from Naboom- spruit (July). The cat flea, CtenocepluJlidesfelis, is widespread over Mrica on Canidae, Felidae, Viver- ridae, Hyaenidae and Leporidae as well as on domestic animals and ...

Evolutionary history of tree squirrels (Rodentia, Sciurini) based on multilocus phylogeny reconstruction

Czech Academy of Sciences Publication Activity Database

Pečnerová, P.; Martínková, Natália

2012-01-01

Roč. 41, č. 3 (2012), s. 211-219 ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012

Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size

Czech Academy of Sciences Publication Activity Database

Martínková, Natália; Moravec, J.

2012-01-01

Roč. 61, 3-4 (2012), s. 254-267 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

Natural Intestinal Protozoa in Rodents (Rodentia: Gerbillinae, Murinae, Cricetinae in Northwestern Iran

Directory of Open Access Journals (Sweden)

Mehdi MOHEBALI

2017-09-01

Full Text Available Background: Majority of parasitic infections in rodents have zoonotic importance. This study aimed to determine the frequency and intensity of intestinal protozoa infections of rodents including Meriones persicus, Mus musculus and, Cricetulus migratorius.Methods: This survey was conducted in Meshkin Shahr district in northwestern Iran from Mar. to Dec. of 2014. Intestinal samples of 204 rodents including M. persicus (n=117, M. musculus (n=63 and C. migratorius (n=24 were parasitologically examined. Formalin-ether concentration method was done for all of rodents stool samples and observed with light microscope. All of suspected cases were stained with trichorome staining Method. Cultivation in dichromate potassium 2.5% was carried out for all of coccidian positive samples. Acid fast and aniline blue staining methods were used for detecting of coccidian oocysts and intestinal microsporidial spores, respectively.Results: About 121(59.3% of the caught rodents were generally infected with intestinal protozoa. Entamoeba muris 14(6.9%, Trichomonas muris 55(27.0%, Chilomastix betencourtti 17 (8.3%, Giardia muris 19(9.3%, Eimeria spp. 46(22.5%, Isospora spp. 4(2% and Cryptosporidium spp. 1(0.5% were found from the collected rodents. Microsporidian spores were identified in 63 (31% out of the 204 collected rodents using aniline blue staining method.Conclusion: Since some of the infections are zoonotic importance thus, control of rodents can be decreased new cases of the parasitic zoonoses in humans.

Dinomys branickii Peters, 1873 (Rodentia, Dinomyidae: consumption and food preference in captivity

Directory of Open Access Journals (Sweden)

Raymundo Tomaz Melo dos Santos Neto

2017-02-01

Full Text Available Dinomys branickii is a large rodent listed as Endangered (EN, that suffers pressure from anthropogenic activities such as hunting and habitat destruction. Captive breeding methods are viable for supplementation of conservation projects, and may enhance our knowledge of main aspects of the biology of this species. The objective of this study was to determine consumption and food preferences in a captive group of D. branickii. To determine feeding preferences, the Food Preference Index (P was used for the type of food with highest consumption. The mean amount of food provided was 6.6 kg per day per group, with 4.4 kg per day/group consumed (66%. An average of 11 ± 2.9 types of food were offered daily. The consumption of fruits (71% was higher than the consumption of other food groups, followed by roots/tubers (65.3%. The food groups least consumed were cereals and seeds (39.4% and leaves (38.3%. The preferred foods were: Brassica oleracea (P = 1.38, Zea mays (P = 1.25, Ipomoea batatas (P = 1.17, Mangifera indica (P = 1.13, Cucurbita moschata (P = 1.10, Talinum esculentum (P = 1.00 and Manihot esculenta (P = 1.00. These results suggest that foods with high fiber and carbohydrate content are the best choices for D. branickii development and well-being in captivity.

Behaviour and diary activity of Sciurus ingrami (Thomas) in captivity (Rodentia, Sciuridae)

OpenAIRE

Bordignon, Marcelo; Monteiro Filho, Emygdio L.A

1997-01-01

From October 1994 to November 1995 the behaviour, postures and diurnal activity of tive captive squirrels Sciurus ingrami were observed and registered. Four basics postures, five grooming behaviours, displacements and face wiping behaviour were identified. Based on behavioural observations, the diurnal activity was divided into four categories: resting, displacement, teeding and maintenance. The time spent in each category varied seasonally and the squirrels spent more time resting during win...

Evolutionary history and species diversity of African pouched mice (Rodentia: Nesomyidae: Saccostomus)

Czech Academy of Sciences Publication Activity Database

Mikula, Ondřej; Šumbera, R.; Aghová, Tatiana; Mbau, J. S.; Katakweba, A. S.; Sabuni, C. A.; Bryja, Josef

2016-01-01

Roč. 45, č. 6 (2016), s. 595-617 ISSN 0300-3256 R&D Projects: GA ČR GAP506/10/0983; GA ČR GA15-20229S Institutional support: RVO:68081766 Keywords : Saccostomus * phylogeny * phylogeography * Plio-Pleistocene climate changes * taxonomic revision * Nesomyidae * Cricetomyinae Subject RIV: EG - Zoology Impact factor: 2.837, year: 2016

Natural Intestinal Protozoa in Rodents (Rodentia: Gerbillinae, Murinae, Cricetinae) in Northwestern Iran

Science.gov (United States)

MOHEBALI, Mehdi; ZAREI, Zabiholah; Khanaliha, Khadijeh; KIA, Eshrat Beigom; MOTAVALLI-HAGHI, Afsaneh; DAVOODI, Jaber; REZAEIAN, Tahereh; TARIGHI, Fathemeh; REZAEIAN, Mostafa

2017-01-01

Background: Majority of parasitic infections in rodents have zoonotic importance. This study aimed to determine the frequency and intensity of intestinal protozoa infections of rodents including Meriones persicus, Mus musculus and, Cricetulus migratorius. Methods: This survey was conducted in Meshkin Shahr district in northwestern Iran from Mar. to Dec. of 2014. Intestinal samples of 204 rodents including M. persicus (n=117), M. musculus (n=63) and C. migratorius (n=24) were parasitologically examined. Formalin-ether concentration method was done for all of rodents stool samples and observed with light microscope. All of suspected cases were stained with trichorome staining Method. Cultivation in dichromate potassium 2.5% was carried out for all of coccidian positive samples. Acid fast and aniline blue staining methods were used for detecting of coccidian oocysts and intestinal microsporidial spores, respectively. Results: About 121(59.3%) of the caught rodents were generally infected with intestinal protozoa. Entamoeba muris 14(6.9%), Trichomonas muris 55(27.0%), Chilomastix betencourtti 17 (8.3%), Giardia muris 19(9.3%), Eimeria spp. 46(22.5%), Isospora spp. 4(2%) and Cryptosporidium spp. 1(0.5%) were found from the collected rodents. Microsporidian spores were identified in 63 (31%) out of the 204 collected rodents using aniline blue staining method. Conclusion: Since some of the infections are zoonotic importance thus, control of rodents can be decreased new cases of the parasitic zoonoses in humans. PMID:28979348

The complete mitochondrial genome of the bank vole Clethrionomys glareolus ( Rodentia: Arvicolinae)

Czech Academy of Sciences Publication Activity Database

Bendová, Karolína; Marková, Silvia; Searle, J. B.; Kotlík, Petr

2016-01-01

Roč. 27, č. 1 (2016), s. 111-112 ISSN 1940-1736 R&D Projects: GA ČR GAP506/11/1872; GA AV ČR IAA600450901 Institutional support: RVO:67985904 Keywords : mtDNA capture * Myodes glareolus * phylogeography Subject RIV: EG - Zoology Impact factor: 3.350, year: 2016

Phylogenetic position of a monotypic Ethiopian endemic rodent genus Megadendromus (Rodentia, Nesomyidae)

Czech Academy of Sciences Publication Activity Database

Lavrenchenko, L. A.; Nadjafova, R. S.; Bekele, A.; Mironova, T. A.; Bryja, Josef

2017-01-01

Roč. 81, č. 1 (2017), s. 71-82 ISSN 0025-1461 Institutional support: RVO:68081766 Keywords : Dendromurinae * Ethiopia * karyotype * Megadendromus * phylogeny Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.805, year: 2016

Ethylene, nitric oxide and haemoglobins in plant tolerance to flooding

DEFF Research Database (Denmark)

Mur, Luis A J; Gupta, Kapuganti J; Chakraborty, U

2015-01-01

-tolerant species Rumex palustris and the model plant Arabidopsis thaliana have been extensively exploited to reveal some key molecular events. Our groups have recently demonstrated that nitric oxide (NO) triggers the biosynthesis of ethylene during stress and that NO plays key roles in PCD and the hyponastic......As much as 12% of the world's soils may suffer excess water so that flooding is a major limiting factor on crop production in many areas. Plants attempt to deal with submergence by forming root aerenchyma to facilitate oxygen diffusion from the shoot to the root, initiating a hyponastic response....... This chapter will detail our understanding of the roles of ethylene, NO and haemoglobin in flooding stress....

Response of the Invasive Grass Imperata cylindrica to Disturbance in the Southeastern Forests, USA

Directory of Open Access Journals (Sweden)

Shibu Jose

2012-09-01

Full Text Available Imperata cylindrica is an invasive plant species that threatens diversity and forest productivity in southeastern ecosystems. We examined the effects of disturbance events, particularly fire and hurricane/salvage harvesting, to determine the effects on I. cylindrica abundance in longleaf pine (Pinus palustris forests in the Florida panhandle. Areas that were burned or had greater biomass removal following a hurricane had a greater number of I. cylindrica patches and larger patch size. These results highlight the importance of disturbance events on expanding invasive species populations in this region and are likely applicable for other invasive species as well. Monitoring and treatment should follow disturbance events to ensure that invasive species populations do not exceed unmanageable levels.

Northeast regional and state trends in anuran occupancy from calling survey data (2001-2011) from the North American Amphibian Monitoring Program

Science.gov (United States)

Weir, Linda A.; Royle, Andy; Gazenski, Kimberly D.; Villena Carpio, Oswaldo

2014-01-01

We present the first regional trends in anuran occupancy from North American Amphibian Monitoring Program (NAAMP) data from 11 northeastern states using an 11 years of data. NAAMP is a long-term monitoring program where observers collect data at assigned random roadside routes using a calling survey technique. We assessed occupancy trends for 17 species. Eight species had statistically significant regional trends, of these seven were negative (Anaxyrus fowleri, Acris crepitans, Pseudacris brachyphona, Pseudacris feriarum-kalmi complex, Lithobates palustris, Lithobates pipiens, and Lithobates sphenocephalus) and one was positive (Hyla versicolor-chrysoscelis complex). We also assessed state level trends for 101 species/state combinations, of these 29 showed a significant decline and nine showed a significant increase in occupancy.

Fossil history of the marsh rats of the genus Holochilus and Lundomys (Cricetidae, Sigmodontinae in southern South America

Directory of Open Access Journals (Sweden)

Teta, P.

2011-06-01

Full Text Available The sister genera Holochilus and Lundomys, plus the extinct forms Carletonomys and Noronhomys and the living Pseudoryzomys, constitute a small clade of amphibious sigmodontine rodents that inhabits in tropical and subtropical environments of the Neotropics. Based on almost all the available fossil evidence recovered in Argentina, Bolivia, southeastern Brazil, and Uruguay we revised the paleontological record of Holochilus and Lundomys in southern South America. Past distributions and chronologies indicate the following occurrences [biochrons] for the study area: Holochilus brasiliensis (Middle Pleistocene-Recent in Argentina, Late Pleistocene-Recent in Brazil, H. chacarius (Late Holocene-Recent in Argentina, Early Holocene-Recent in Bolivia, †H. primigenius (Middle Pleistocene in Bolivia, and Lundomys molitor (Middle Pleistocene-Late Pleistocene in Argentina, Late Pleistocene-Recent in Uruguay. Taking into account the present distributions and environmental requirements of these rodents we hypothesize several expansion/retraction episodes of their populations triggered by the occurrence of moist/dry climatic pulses during Pleistocene-Holocene times.Los géneros hermanos Holochilus y Lundomys, junto con las formas extintas Carletonomys y Noronhomys y la viviente Pseudoryzomys, constituyen un pequeño clado de sigmodontinos de hábitos anfibios, que habitan en ambientes tropicales y subtropicales del Neotrópico. Basándonos en la totalidad de la evidencia fósil disponible para Argentina, Bolivia, sudeste de Brasil y Uruguay se revisó el registro paleontológico de Holochilus y Lundomys de la porción austral de América del Sur. Las distribuciones en el pasado y sus cronologías indican las siguientes ocurrencias para el área de estudio: Holochilus brasiliensis (Pleistoceno Medio-Reciente en Argentina, Pleistoceno Tardío-Reciente en Brasil, H. chacarius (Holoceno Tardío-Reciente en Argentina, Holoceno Temprano-Reciente en Bolivia, †H. primigenius (Pleistoceno Medio en Bolivia y Lundomys molitor (Pleistoceno Medio-Pleistoceno Tardío en Argentina, Pleistoceno Tardío-Reciente en Uruguay. Considerando en conjunto las distribuciones actuales, los requerimientos ambientales de estos taxones y los registros fósiles, se verifican varios episodios de expansión y retracción de sus poblaciones, posiblemente vinculados con pulsos climáticos húmedos y secos alternantes durante el Pleistoceno-Holoceno.

Factors Affecting the Distribution of Wild Rice (Zizania palustris) and the Surrounding Macrophyte Community.

Science.gov (United States)

Pillsbury, R. W.; McGuire, M.

2005-05-01

A recent decline in wild rice wetlands is cause for concern due to its importance as a food source, refuge for wildlife, and cultural significance. Sixty wetlands in Wisconsin and Minnesota (USA) were sampled, with approximately equal numbers displaying dense, moderate and sparse wild rice production. Chemical, physical, and watershed parameters were measured as well as macrophyte densities. Data were analyzed using multivariate statistics (CCA). Moderate levels of phosphorus appear beneficial to the overall success of wild rice, while free-floating macrophytes show an overwhelming positive response to higher levels of P. The distribution of macrophytes bordering wild rice beds is correlated to pH,with Potamogeton robbinsii and filamentous green algae responding most strongly to its increase. Healthy stands of wild rice exhibit a narrow circum-neutral range of pH (6.1-8.0)which is significantly different from the greater range exhibited by sparse wild rice wetlands (6.5-8.5). This pattern was paralleled when considering depth which suggests that deeper wetlands may be more susceptible to wild rice loss. Management of existing wild rice wetlands should focus monitoring on pH, depth, phosphorus concentrations and shore development. We are currently using this data base to locate the best reintroduction sites for wild rice.

Spatial and Temporal Analyses of Environmental Affects on Zizania Palustris and Its Natural Cycles

Science.gov (United States)

Rickman, Douglas L.; Greensky, Wayne; Al-Hamdan, M. Z.; Estes, M. G.; Crosson, W. L.; Estes, Sue M.

2017-01-01

As part of a joint education and research effort funded by NASA, research studies were initiated involving students associated with the Ojibwe and researchers at Marshall Space Flight Center. Topics were chosen that satisfied the nature of the work proposed and were tractable, given the student's constraints (abilities, interests, and time). One of the studies, which spanned two summers, examined some potential environmental effects on northern wild rice in northern Wisconsin. The rice of interest is naturally occurring ('wild' wild rice), as opposed to cultivated wild rice ('paddy' wild rice).

Characterization of the North American beaver (Castor canadensis) papillomavirus genome.

Science.gov (United States)

Rogovskyy, Artem S; Chen, Zigui; Burk, Robert D; Bankhead, Troy

2014-01-10

The papillomaviruses comprise a large group of viruses that cause proliferations of the stratified squamous epithelium of skin and mucosa in a variety of animals. An earlier report identified a novel papillomavirus of the North American beaver, Castor canadensis (CcanPV1) that was associated with cutaneous exophytic lesions. In the current study, we determined the sequence of the complete 7435 basepair genome of CcanPV1. The genome contains an Upstream Regulatory Region located between the end of L1 and the start of E6, and seven canonical papillomavirus open reading frames encoding five early (E6, E7, E1, E2, and E4) and two late (L2 and L1) proteins. No E5 open reading frame was detected. Phylogenetic analysis of the CcanPV1 genome places the virus between the genera Kappapapillomavirus and Mupapillomavirus. Analyses of the papillomavirus genomes detected in different species of the order Rodentia indicate these viruses do not form a monophyletic clade. Copyright © 2013 Elsevier B.V. All rights reserved.

Re-examining the hypothesis of allopatric distribution of Myoprocta acouchy and M. pratti (Mammalia: Dasyproctidae in South America

Directory of Open Access Journals (Sweden)

Héctor E. Ramírez-Chaves

2014-01-01

Full Text Available Currently, two allopatric species of acouchies, genus Myoprocta (Rodentia: Dasyproctidae are recognized. Nevertheless, there is morphological variability in the regions where the species are distributed that suggests either sympatry of two (or more distinct species or else breakdowns in the characters that have been used to diagnose the species. We reviewed specimens of Myoprocta from Colombia and found that both reddish and greenish forms are sympatric in the Amazon basin of the country, including areas adjoining Ecuador and Peru. These records apparently refute the hypothesis of allopatry for these species in South America. However, the results of a principal components analysis showed little or no morphological separation between these two forms. In addition, a review of skulls throughout the geographic range of M. pratti shows high morphological variation. Although sympatry of reddish and greenish acouchies has been suggested for the Amazon region of Ecuador, our review found no evidence of this. In view of our findings, further revisionary work is needed to clarify the status of these forms.

Síndrome pulmonar e cardiovascular por hantavírus Hantavirus pulmonary and cardiovascular syndrome

Directory of Open Access Journals (Sweden)

Mariangela Pimentel Pincelli

2003-10-01

Full Text Available A síndrome pulmonar e cardiovascular por hantavírus é uma doença de conhecimento relativamente recente e freqüentemente fatal, apresentando-se como síndrome do desconforto respiratório agudo. No Brasil, desde o primeiro surto, relatado em novembro/dezembro de 1993, em Juquitiba, 226 casos já foram registrados pela Fundação Nacional da Saúde. A doença afeta indivíduos previamente hígidos, apresentando-se com pródromo febril e sintomas semelhantes aos de um resfriado comum, podendo rapidamente evoluir para edema pulmonar, insuficiência respiratória aguda e choque. A hemoconcentração e a plaquetopenia são comuns da síndrome pulmonar e cardiovascular por hantavírus, e o quadro radiológico típico é de um infiltrado intersticial bilateral difuso, que progride rapidamente para consolidações alveolares, paralelamente à piora do quadro clínico. A mortalidade inicial era em torno de 75% e declinou para aproximadamente 35%, nos últimos anos. Os pacientes que sobrevivem geralmente recuperam-se completamente, cerca de uma semana após o estabelecimento do quadro respiratório. O agente causal, não reconhecido até há pouco, foi identificado como um hantavírus, cujo reservatório natural são animais roedores da família Muridae, subfamília Sigmodontinae. O tratamento específico antiviral ainda não é bem estabelecido, estando em estudo a eficácia de ribavirina. Cuidados de terapia intensiva como ventilação mecânica e monitoramento hemodinâmico invasivo são necessários nas formas mais graves da doença. Essas medidas, se instituídas precocemente, podem melhorar o prognóstico e a sobrevida dos pacientes com síndrome pulmonar e cardiovascular por hantavírus.Hantavirus pulmonary and cardiovascular syndrome is a recently identified and often fatal disease, which presents as acute respiratory distress syndrome (ARDS. Since the first outbreak, in Nov/Dec 1993, in Juquitiba, Brazil, 226 cases have been registered by

Tularemia in Alaska, 1938 - 2010

Directory of Open Access Journals (Sweden)

Hansen Cristina M

2011-11-01

Full Text Available Abstract Tularemia is a serious, potentially life threatening zoonotic disease. The causative agent, Francisella tularensis, is ubiquitous in the Northern hemisphere, including Alaska, where it was first isolated from a rabbit tick (Haemophysalis leporis-palustris in 1938. Since then, F. tularensis has been isolated from wildlife and humans throughout the state. Serologic surveys have found measurable antibodies with prevalence ranging from F. tularensis isolates from Alaska were analyzed using canonical SNPs and a multi-locus variable-number tandem repeats (VNTR analysis (MLVA system. The results show that both F. t. tularensis and F. t. holarctica are present in Alaska and that subtype A.I, the most virulent type, is responsible for most recently reported human clinical cases in the state.

Larval trematode infections in freshwater gastropods from the Albufera Natural Park in Spain.

Science.gov (United States)

Toledo, R; Muñoz-Antolí, C; Pérez, M; Esteban, J G

1998-03-01

Malacological samplings were made from January 1994 to December 1996 in the Albufera Natural Park (Valencia, Spain) to trace the dynamics of molluscan populations and the prevalence and intensity of infection by larval trematodes. A total of 10,533 freshwater gastropods belonging to seven species (Lymnaea auricularia, L. truncatula, L. palustris, L. peregra, Bithynia tentaculata, Physa acuta and Gyraulus chinensis) was examined, and 110 (1.04%) were found to harbour some of the nine distinguishable types of cercariae, namely four echinostome cercariae (Hypoderaeum conoideum, Echinoparyphium recurvatum, Euparyphium albuferensis, and Echinostoma sp.), four furcocercous cercariae, and one xiphidiocercous cercaria. This study shows that the composition of the snail and trematode communities may be determined by the particular environmental conditions present and the human intervention in the area.

Parasite prevalence and community diversity in sympatric and allopatric populations of two woodrat species (Sigmodontinae: Neotoma) in central California.

Science.gov (United States)

Bechtel, Molly J; Teglas, Michael B; Murphy, Peter J; Matocq, Marjorie D

2015-04-01

Patterns of host-parasite association may vary across the landscape in part because of host and parasite diversity, divergence, local ecology, or interactions among these factors. In central coastal California, we quantified parasite prevalence, infection intensity, and diversity in two sister species of woodrats (Neotoma fuscipes and Neotoma macrotis) where the species co-occur (sympatry) and where each species exists alone (allopatry). In feces from 50 adults we identified seven taxa: the protozoans Eimeria, Giardia, and Cryptosporidium, the nematodes Trichuris, Aspicularis, and Eucoleus, and a cestode in the family Anoplocephalidae. Gastrointestinal parasite infection intensity and diversity were higher in males than in females, a difference that was most pronounced in the more aggressive N. fuscipes. Both species had lower infection intensity in sympatry than in allopatry and in sympatry the two species did not differ in infection intensity in total but did maintain distinct parasite communities. Taken together, our findings suggest that host evolutionary differences, including perhaps species-specific patterns of aggressive behavior, as well as local ecology, influence the likelihood of infection by these endoparasite taxa.

Macroscopic description of thoracic member musculature in Cuniculus paca (Linnaeus, 1766 (Rodentia, Cuniculidae

Directory of Open Access Journals (Sweden)

Rodrigo Gomes de Souza

2017-05-01

Full Text Available Cuniculus paca (Mammalia: Cuniculidae, or ‘paca’ is a rodent species in great demand for its meat, which has led to domestication and development of paca farms in the Brazilian Amazon region, as well as in other states. Despite the growing consumption of paca meat, knowledge on muscle anatomy is still scarce. An anatomical description of paca forelimbs will form the basis for future zootechnical and veterinary studies, enabling the development of sustainable production in the Amazon region, as well as the preservation of the species. We studied forelimb anatomy in four (04 adult pacas from the Caboclinho Project of Catuaba Experimental Farm (UFAC under IBAMA authorization n°509309. Specimens were fixed in 10% formalin and thoracic limbs were dissected, after which anatomical descriptions and photographic records were generated. We found that paca forelimb musculature is similar to that of other groups of domestic animals with regard to the origin and muscle insertion.

Macroscopic description of thoracic member musculature in Cuniculus paca (Linnaeus, 1766 (Rodentia, Cuniculidae

Directory of Open Access Journals (Sweden)

Rodrigo Gomes de Souza

2017-05-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2017v30n2p43 Cuniculus paca (Mammalia: Cuniculidae, or ‘paca’ is a rodent species in great demand for its meat, which has led to domestication and development of paca farms in the Brazilian Amazon region, as well as in other states. Despite the growing consumption of paca meat, knowledge on muscle anatomy is still scarce. An anatomical description of paca forelimbs will form the basis for future zootechnical and veterinary studies, enabling the development of sustainable production in the Amazon region, as well as the preservation of the species. We studied forelimb anatomy in four (04 adult pacas from the Caboclinho Project of Catuaba Experimental Farm (UFAC under IBAMA authorization n°509309. Specimens were fixed in 10% formalin and thoracic limbs were dissected, after which anatomical descriptions and photographic records were generated. We found that paca forelimb musculature is similar to that of other groups of domestic animals with regard to the origin and muscle insertion.

Notocotylus loeiensis n. sp. (Trematoda: Notocotylidae) from Rattus losea (Rodentia: Muridae) in Thailand

Czech Academy of Sciences Publication Activity Database

Chaisiri, K.; Morand, S.; Ribas, Alexis

2011-01-01

Roč. 18, č. 1 (2011), s. 35-38 ISSN 1252-607X Institutional research plan: CEZ:AV0Z60930519 Keywords : Trematoda * lesser rice field rat * Thailand Subject RIV: EG - Zoology Impact factor: 1.000, year: 2011

Discongruence of Mhc and cytochrome b phylogeographical patterns in Myodes glareolus (Rodentia: Cricetidae)

Czech Academy of Sciences Publication Activity Database

Malé, P.-J, G.; Martin, J.-F.; Galan, M.; Deffontaine, V.; Bryja, Josef; Cosson, J.-F.; Michaux, J.; Charbonnel, N.

2012-01-01

Roč. 105, č. 4 (2012), s. 881-899 ISSN 0024-4066 EU Projects: European Commission(XE) 10284 - EDEN Source of funding: R - rámcový projekt EK Keywords : balancing selection * bank voles * diversity * immunogenetics * molecular epidemiology * Puumala hantavirus * zoonoses Subject RIV: EG - Zoology Impact factor: 2.413, year: 2012

Mandible shape and dwarfism in squirrels (Mammalia, Rodentia): interaction of allometry and adaptation

Science.gov (United States)

Hautier, Lionel; Fabre, Pierre-Henri; Michaux, Jacques

2009-06-01

Squirrels include several independent lineages of dwarf forms distributed into two ecological groups: the dwarf tree and flying squirrels. The mandible of dwarf tree squirrels share a highly reduced coronoid process and a condylar process drawn backwards. Dwarf flying squirrels on the other hand, have an elongated coronoid process and a well-differentiated condylar process. To interpret such a difference, Elliptic Fourier Transform was used to evaluate how mandible shape varies with dwarfism in sciurids. The results obtained show that this clear-cut difference cannot be explained by a simple allometric relationship in relation with size decrease. We concluded that the retention of anteriorly positioned eye sockets, in relation with distance estimation, allowed the conservation of a well-differentiated coronoid process in all flying species, despite the trend towards its reduction observed among sciurids as their size decreases.

Progonomys Schaub, 1938 and Huerzelerimys gen. nov. (Rodentia) : their evolution in Western Europe

NARCIS (Netherlands)

Mein, P.; Martín Suárez, E.; Agustí, J.

1993-01-01

In this paper the various species and populations attributed to the genus Progonomys Schaub, 1938 are revised. Valerymys Michaux, 1969 is considered to be synonymous with Occitanomys Michaux, 1969, since the type-species V. ellenbergeri (Thaler, 1966) was included in Occitanomys by Aguilar et al.

Chromosome banding pattern in fat dormouse and bank vole (Mammalia: Rodentia) from Turkey

Czech Academy of Sciences Publication Activity Database

Arslan, A.; Zima, Jan; Yorulmaz, T.; Gözütok, S.; Toyran, K.

2013-01-01

Roč. 61, 1-2 (2013), s. 47-51 ISSN 0015-5497 Institutional support: RVO:68081766 Keywords : AgNOR staining * Anatolia * C-banding * Glis glis * Myodes glareorus Subject RIV: EG - Zoology Impact factor: 0.478, year: 2013

Population dynamics of the rat Microryzomys minutus (Rodentia: Muridae in the Venezuelan Andes

Directory of Open Access Journals (Sweden)

Daniel R Cabello

2006-06-01

Full Text Available The population dynamics of the small forest rice rat Microryzomys minutus, a murid rodent that occurs in the high altitudes of the northern and central Andes, was studied in disturbed and primary environments in a cloud forest of the Venezuelan Andes (Juan Pablo Peñaloza National Park, 8º11’N, 71º49’W. We collected 121 animals (66♀♀ and 55♂♂ between 1995 and 1998, using pitfall traps with formalin. Adult males were heavier than adult females. Relative abundance was much greater in the disturbed environments (over 10 individuals in some periods than in the primary cloud forest: 4-8 individuals. In the disturbed environments, the rats were extremely abundant in the first sampling period, and less frequent afterwards. In the cropland, abundance showed some fluctuations during the study and displayed two small abundance peaks in March-June 1997 and 1998. In the mined area, the rats had irregular fluctuations until March-June 1997 and were not recorded in July-October 1997. The occurrence of this rat in both disturbed and natural habitats confirms the wide ecological tolerance of this species. Rev. Biol. Trop. 54(2: 651-. Epub 2006 Jun 01.Se analizó la dinámica poblacional de las pequeñas ratas silvestres del arroz Microryzomys minutus en ambientes alterados y primarios, en un bosque nublado de los Andes venezolanos. El estudio fue basado en 121 animales (66♀♀ y 55♂♂ recolectados entre 1995 y 1998, usando trampas que contenían formalina. Esta especie está presente en ambos hábitats lo que confirma su amplia tolerancia ecológica. La abundancia poblacional fue mayor en ambientes alterados que en los no alterados. M. minutus presenta dimorfismo sexual en el peso: los machos son más pesados que las hembras.

A new species of Calomys Waterhouse (Rodentia, Sigmodontinaefrom the Cerrado of Central Brazil

Directory of Open Access Journals (Sweden)

Cibele R. Bonvicino

2003-06-01

Full Text Available A new Brazilian Calomys Waterhouse, 1837 species is described based on morphologic and karyologic data. This species is endemic to the Cerrado of Central Brazil and allopatric with all other species of the genus Calomys. Its chromosome complement (2n = 46, AN = 66 is different from those described in other Calomys species. Morphometric analysis significantly distinguished this new species from other Calomys of the Brazilian fauna like C. callosus (Renger, 1830, C. expulsus (Lund, 1841 and C. tener (Winge, 1887 and placed it among the large-sized Calomys.

Progonomys Schaub, 1938 and Huerzelerimys gen. nov. (Rodentia) : their evolution in Western Europe

OpenAIRE

Mein, P.; Martín Suárez, E.; Agustí, J.

1993-01-01

In this paper the various species and populations attributed to the genus Progonomys Schaub, 1938 are revised. Valerymys Michaux, 1969 is considered to be synonymous with Occitanomys Michaux, 1969, since the type-species V. ellenbergeri (Thaler, 1966) was included in Occitanomys by Aguilar et al. (1986a). Other species from Western Europe that had been included in Valerymys cannot be transferred to Occitanomys. They are the descendants of Progonomys cathalai, for which we create the new genus...

Aspectos morfológicos da tuba uterina de cutias (Dasyprocta aguti, Mammalia: Rodentia

Directory of Open Access Journals (Sweden)

Eunice Anita de Moura Fortes

2005-04-01

Full Text Available It was analysed the uterine tube structure in Agouti. We have used three adult females, caming from Wild Animals Preservation and Study Nucleous of "Universidade Federal do Piauí". Soon after anaesthesia and euthanasia we got collected uterine tube fragments from cranial, medial and caudal regions. The cuts of 3 to 5m were stained with HE, and analysed and photographed with a light microscope. We could observed that the uterine tubes have three distincts stratums: mucous membrane, muscular and serous with histologicals differences that characterize the infundibulum, ampulla and isthmus regions. The uterine tube light is irregular, on cranial and medium portions. It is bigger and irregular than caudal portion. The mucous membrane is coat with simple columnar epithelium with ciliar and nonciliar cells. The own lamina, formed of slack conjunctive tissue, without glands, on ampulla region, become small and we can observe many cells. On isthmus mucous we observe ephithelial tissue with low cells. The muscular, constituted of smooth fibres, that is observed like a circular and longitudinal stratum, and the serous stratum full of vessels. Histologically, the uterine tube in Agouti is similar to the others domestic and wild animals.

Karyological analysis of Proechimys cuvieri and Proechimys guyannensis (Rodentia, Echimyidae from central Amazon

Directory of Open Access Journals (Sweden)

Carlos Eduardo Faresin e Silva

2012-01-01

Full Text Available The aim was to characterize the karyotype of rodents of the genus Proechimys from three localities in the central Brazilian Amazon, in the search for new markers that might shed light on our understanding of the taxonomy and evolutionary history of this taxon. Two karyotypes were found, viz., 2n = 28, FN = 46 in individuals from the NRSP (Cuieiras River and REMAN (Manaus, and 2n = 46, FN = 50 in individuals from the Balbina Hydroelectric Plant. While individuals with the karyotype with 2n = 28 chromosomes were morphologically associated with Proechimys cuvieri, their karyotype shared similarities with those of the same diploid number in two other regions. Although three karyotypes are described for Proechimys cuvieri, no geographic distribution pattern that defined a cline could be identified. Based on the morphological examination of voucher specimens and additional results from molecular analysis, the karyotype with 2n = 46 and FN = 50 could be associated with P. guyannensis.

Karyological analysis of Proechimys cuvieri and Proechimys guyannensis (Rodentia, Echimyidae) from central Amazon.

Science.gov (United States)

E Silva, Carlos Eduardo Faresin; Eler, Eduardo Schmidt; da Silva, Maria Nazareth F; Feldberg, Eliana

2012-01-01

The aim was to characterize the karyotype of rodents of the genus Proechimys from three localities in the central Brazilian Amazon, in the search for new markers that might shed light on our understanding of the taxonomy and evolutionary history of this taxon. Two karyotypes were found, viz., 2n = 28, FN = 46 in individuals from the NRSP (Cuieiras River) and REMAN (Manaus), and 2n = 46, FN = 50 in individuals from the Balbina Hydroelectric Plant. While individuals with the karyotype with 2n = 28 chromosomes were morphologically associated with Proechimys cuvieri, their karyotype shared similarities with those of the same diploid number in two other regions. Although three karyotypes are described for Proechimys cuvieri, no geographic distribution pattern that defined a cline could be identified. Based on the morphological examination of voucher specimens and additional results from molecular analysis, the karyotype with 2n = 46 and FN = 50 could be associated with P. guyannensis.

An explanation of the relationship between mass, metabolic rate and characteristic length for placental mammals

Directory of Open Access Journals (Sweden)

Charles C. Frasier

2015-09-01

Full Text Available The Mass, Metabolism and Length Explanation (MMLE was advanced in 1984 to explain the relationship between metabolic rate and body mass for birds and mammals. This paper reports on a modernized version of MMLE. MMLE deterministically computes the absolute value of Basal Metabolic Rate (BMR and body mass for individual animals. MMLE is thus distinct from other examinations of these topics that use species-averaged data to estimate the parameters in a statistically best fit power law relationship such as BMR = a(bodymassb. Beginning with the proposition that BMR is proportional to the number of mitochondria in an animal, two primary equations are derived that compute BMR and body mass as functions of an individual animal’s characteristic length and sturdiness factor. The characteristic length is a measureable skeletal length associated with an animal’s means of propulsion. The sturdiness factor expresses how sturdy or gracile an animal is. Eight other parameters occur in the equations that vary little among animals in the same phylogenetic group. The present paper modernizes MMLE by explicitly treating Froude and Strouhal dynamic similarity of mammals’ skeletal musculature, revising the treatment of BMR and using new data to estimate numerical values for the parameters that occur in the equations. A mass and length data set with 575 entries from the orders Rodentia, Chiroptera, Artiodactyla, Carnivora, Perissodactyla and Proboscidea is used. A BMR and mass data set with 436 entries from the orders Rodentia, Chiroptera, Artiodactyla and Carnivora is also used. With the estimated parameter values MMLE can calculate characteristic length and sturdiness factor values so that every BMR and mass datum from the BMR and mass data set can be computed exactly. Furthermore MMLE can calculate characteristic length and sturdiness factor values so that every body mass and length datum from the mass and length data set can be computed exactly. Whether or

Habitat use and relative abundance of the Spotted Paca Cuniculus paca (Linnaeus, 1766 (Rodentia: Cuniculidae and the Red-rumped Agouti Dasyprocta leporina (Linnaeus, 1758 (Rodentia: Dasyproctidae in Guatopo National Park, Venezuela

Directory of Open Access Journals (Sweden)

Elinor Jax

2015-01-01

Full Text Available The Spotted Paca Cuniculus paca and the Red-rumped Agouti Dasyprocta leporina are affected by habitat loss and hunting.  In Venezuela, their conservation status is unknown, even within protected areas.  The objective of this study was to estimate the relative abundance, activity patterns, habitat use, and effect of human activities on these species in Venezuela.  To achieve this, 26 camera-trap stations (20.8km2 were established in Guatopo National Park between February and April 2011, characterization of the habitat was undertaken and occupancy models were created.  The relative abundance of the Spotted Paca was 1.62 captures/100trap-nights, with a fully nocturnal activity pattern.  The relative abundance of the Red-rumped Agouti was 2.32 captures/100trap-nights, with a pronounced diurnal activity pattern. The occupation probability of the Red-rumped Agouti (0.61 SE 0.02 was higher than that of the Spotted Paca (0.27 SE 0.02. Spotted Pacas were mainly found in areas with mature forest and high tree density, whereas the  Red-rumped Agoutis were most frequently found in valleys with little disturbed forest.  A positive correlation was found between illegal hunting activities and areas occupied by the Spotted Paca.  It is important to strengthen the park control measurements to reduce illegal hunting of Spotted Pacas.

Photosynthetic consequences of phenotypic plasticity in response to submergence: Rumex palustris as a case study

NARCIS (Netherlands)

Mommer, L.; Pons, T.L.; Visser, E.J.W.

2006-01-01

Survival and growth of terrestrial plants is negatively affected by complete submergence. This is mainly the result of hampered gas exchange between plants and their environment, since gas diffusion is severely reduced in water compared with air, resulting in O2 deficits which limit aerobic

Resprouting after disturbance in the short-lived herb Rorippa palustris (Brassicaceae): an experiment with juveniles

Czech Academy of Sciences Publication Activity Database

Martínková, Jana; Kočvarová, Marie; Klimešová, Jitka

2004-01-01

Roč. 25, č. 3 (2004), s. 143-150 ISSN 1146-609X R&D Projects: GA AV ČR KSK6005114; GA ČR GD206/03/H034; GA ČR GA206/01/1039 Institutional research plan: CEZ:AV0Z6005908 Keywords : root-sprouting * bud bank * disturbance Subject RIV: EF - Botanics Impact factor: 1.034, year: 2004

The ecological classification of coastal wet longleaf pine (pinus palustris) of Florida from reference conditions

Science.gov (United States)

George L. McCaskill; Jose. Shibu

2012-01-01

Tropical storms, fire, and urbanization have produced a heavily fragmented forested landscape along Florida’s Gulf coast. The longleaf pine forest, one of the most threatened ecosystems in the US, makes up a major part of this fragmented landscape. These three disturbance regimes have produced a mosaic of differently-aged pine patches of single or two cohort structures...

Hantavirus Infections

Directory of Open Access Journals (Sweden)

Camilo Guzmán T

2017-05-01

Full Text Available Hantaviruses are the causative agents of hantavirus pulmonary syndrome in humans in the Americas; The primary reservoirs are in the rodents of the subfamily Sigmodontinae. In South America, cases of hantavirus pulmonary syndrome caused by numerous viral genotypes have been diagnosed. In Colombia, different serological studies have reported the circulation of hantavirus in humans and rodents. These viruses act in an intimate association with a rodent species that serves as a reservoir and have a distribution around the wild rodent, being limited to a specific geographic region. In South America, the first HPS-associated hantavirus was described in 1993 in Brazil and was called Juquitiva and from 1993 to 2012, more than 1400 cases had been identified in Brazil. This syndrome should be suspected in all patients with respiratory distress syndrome of unclear etiology, in areas endemic for the disease, especially if accompanied by fever, marked leukocytosis and thrombocytopenia and bilateral interstitial infiltrates. Hemorrhagic febrile syndrome has not yet been described in the Americas. There are no clinical or laboratory signs that are pathognomonic of hantavirus infection. The treatment is based on adequate hydration, use of antipyretics and anti-inflammatories and patients with signs of severity should establish a more aggressive management. Triage is indispensable, patients with co-morbidities have a higher mortality risk and therefore should be hospitalized. Future research in Colombia should be directed to multidisciplinary studies that include viral isolation, different clinical forms of case presentation, epidemiological differences, risk factors, and taxonomy of viruses and rodents.

Acidobacteria form a coherent but highly diverse group within the bacterial domain: evidence from environmental genomics

DEFF Research Database (Denmark)

Quaiser, Achim; Ochsenreiter, Torsten; Lanz, Christa

2003-01-01

fragments differed between 2.3% and 19.9% and were placed into two different subgroups of Acidobacteria (groups III and V). Although partial co-linearity was found between genomic fragments, the gene content around the rRNA operons was generally not conserved. Phylogenetic reconstructions with orthologues......Acidobacteria have been established as a novel phylum of Bacteria that is consistently detected in many different habitats around the globe by 16S rDNA-based molecular surveys. The phylogenetic diversity, ubiquity and abundance of this group, particularly in soil habitats, suggest an important...... palustris and Bradyrhizobium japonicum, including a conserved two-component system. Phylogenetic analysis of the putative response regulator confirmed that this similarity between Rhizobiales and Acidobacteria might be due to a horizontal gene transfer. In total, our data give first insight into the genome...

Temporal dynamics of milk composition of the precocial caviomorph Octodon degus (Rodentia: Octodontidae Dinámica temporal de la composición de la leche del caviomorfo precocial Octodon degus (Rodentia: Octodentidae

Directory of Open Access Journals (Sweden)

CLAUDIO VELOSO

2005-06-01

Full Text Available During lactation, both the nutritional and energetic requirements of suckling change gradually. These changes normally are accompanied by modifications in chemical composition of the milk. We investigated the temporal course of milk composition during lactation in a precocial caviomorph rodent, the "degu" (Octodon degus under laboratory condition. Female degus were kept in laboratory during gestation and lactation and fed with commercial food pellets. Milk was collected at three stages of lactation: early (days 5-8, n = 12, middle (days 15-21, n = 7 and late (days 26-40, n = 6, and analyzed for protein, carbohydrates, lipids, ash, total solids and energy. On average, carbohydrates decreased from 3.1 ± 0.3 % (early to 1.1 ± 0.3 % (late during lactation; lipids, protein, ash, total solids and energy remained about the same. Lipids, the main component of the milk, were 17.3 % and protein remained near 4.4 %. Over lactation, total energy concentration of milk remained near 4.0 kJ mL-1. The maintenance of milk composition during lactation may be related to the initially high energetic and nutritional requirements associated with a precocial reproductive modeDurante la lactancia, tanto los requerimientos energéticos como nutricionales de las crías cambian gradualmente. Estos cambios normalmente van acompañados por modificaciones en la composición química de la leche. Se investigaron los cambios temporales de la composición de la leche durante la lactancia en el roedor caviomorfo precocial "degu" (Octodon degus bajo condiciones de laboratorio. Las hembras de degu fueron mantenidas en el laboratorio durante preñez y lactancia, y fueron alimentadas con alimento comercial de conejo. La leche fue colectada en tres estados de lactancia: temprana (días 5-8, n = 12, media (días 15-21, n = 7 y tardía (días 26-40, n = 6, y analizadas para proteínas, hidratos de carbono, lípidos, ceniza, sólidos totales y energía. En promedio, los hidratos de carbono disminuyen desde 3,1 ± 0,3 % (temprana hasta 1,1 ± 0,3 % (tardía durante la lactancia; mientras que, los lípidos, las proteínas, la ceniza, los sólidos totales y la energía se mantienen relativamente constantes. Los lípidos, el principal constituyente de la leche fue de 17,3 % y las proteínas correspondieron al 4,4 %. Durante la lactancia, la concentración de energía total de la leche permaneció cerca de los 4,0 kJ mL-1. La mantención de la composición de la leche durante la lactancia puede estar relacionada con los altos requerimientos energéticos y nutricionales asociados al modo reproductivo precocial

Terrestrial mammals in an Atlantic Forest remnant, Paraná, Brazil

Directory of Open Access Journals (Sweden)

Gustavo Borba de Miranda

2013-11-01

Full Text Available The threat degree and the ecological importance of terrestrial mammals make clear the need for constantly conducting researches in order to add information to the current knowledge on this theme. This study aimed to provide a list of terrestrial mammal species in an Atlantic Forest remnant located in the Southwestern Paraná state, Brazil. Species richness and occurrence frequency were studied from April to October 2009 using two methods: direct observation and recording of traces. We registered 20 taxa distributed into 7 orders: Artiodactyla, Carnivora, Didelphimorphia, Lagomorpha, Primates, Rodentia, and Xenarthra. Among these, 4 taxa were registered either by direct observation or by recording of traces and the others were registered only through traces. The most frequently occurring species were Didelphis sp. (30.6% and Cerdocyon thous (25.6%. Out of the 20 registered taxa, Leopardus pardalis, Leopardus tigrinus, and Cuniculus paca are listed as vulnerable in the Red Book of Threatened Fauna in Parana State. Although small, the study area may assist in the availability of food and shelter for the fauna of mammals, representing an important element of the regional landscape.

DNA-based and geometric morphometric analysis to validate species designation: a case study of the subterranean rodent Ctenomys bicolor.

Science.gov (United States)

Stolz, J F B; Gonçalves, G L; Leipnitz, L; Freitas, T R O

2013-10-25

The genus Ctenomys (Rodentia: Ctenomyidae) shows several taxonomic inconsistencies. In this study, we used an integrative approach including DNA sequences, karyotypes, and geometric morphometrics to evaluate the taxonomic validity of a nominal species, Ctenomys bicolor, which was described based on only one specimen in 1912 by Miranda Ribeiro, and since then neglected. We sampled near the type locality assigned to this species and collected 10 specimens. A total of 820 base pairs of the cytochrome b gene were sequenced and analyzed together with nine other species and four morphotypes obtained from GenBank. Bayesian analyses showed that C. bicolor is monophyletic and related to the Bolivian-Matogrossense group, a clade that originated about 3 mya. We compared the cranial shape through morphometric geometrics of C. bicolor, including the specimen originally sampled in 1912, with other species representative of the same phylogenetic group (C. boliviensis and C. steinbachi). C. bicolor shows unique skull traits that distinguish it from all other currently known taxa. Our findings confirm that the specimen collected by Miranda Ribeiro is a valid species, and improve the knowledge about Ctenomys in the Amazon region.

Social structure predicts genital morphology in African mole-rats.

Directory of Open Access Journals (Sweden)

Marianne L Seney

2009-10-01

Full Text Available African mole-rats (Bathyergidae, Rodentia exhibit a wide range of social structures, from solitary to eusocial. We previously found a lack of sex differences in the external genitalia and morphology of the perineal muscles associated with the phallus in the eusocial naked mole-rat. This was quite surprising, as the external genitalia and perineal muscles are sexually dimorphic in all other mammals examined. We hypothesized that the lack of sex differences in naked mole-rats might be related to their unusual social structure.We compared the genitalia and perineal muscles in three African mole-rat species: the naked mole-rat, the solitary silvery mole-rat, and the Damaraland mole-rat, a species considered to be eusocial, but with less reproductive skew than naked mole-rats. Our findings support a relationship between social structure, mating system, and sexual differentiation. Naked mole-rats lack sex differences in genitalia and perineal morphology, silvery mole-rats exhibit sex differences, and Damaraland mole-rats are intermediate.The lack of sex differences in naked mole-rats is not an attribute of all African mole-rats, but appears to have evolved in relation to their unusual social structure and reproductive biology.

Social structure predicts genital morphology in African mole-rats.

Science.gov (United States)

Seney, Marianne L; Kelly, Diane A; Goldman, Bruce D; Sumbera, Radim; Forger, Nancy G

2009-10-15

African mole-rats (Bathyergidae, Rodentia) exhibit a wide range of social structures, from solitary to eusocial. We previously found a lack of sex differences in the external genitalia and morphology of the perineal muscles associated with the phallus in the eusocial naked mole-rat. This was quite surprising, as the external genitalia and perineal muscles are sexually dimorphic in all other mammals examined. We hypothesized that the lack of sex differences in naked mole-rats might be related to their unusual social structure. We compared the genitalia and perineal muscles in three African mole-rat species: the naked mole-rat, the solitary silvery mole-rat, and the Damaraland mole-rat, a species considered to be eusocial, but with less reproductive skew than naked mole-rats. Our findings support a relationship between social structure, mating system, and sexual differentiation. Naked mole-rats lack sex differences in genitalia and perineal morphology, silvery mole-rats exhibit sex differences, and Damaraland mole-rats are intermediate. The lack of sex differences in naked mole-rats is not an attribute of all African mole-rats, but appears to have evolved in relation to their unusual social structure and reproductive biology.

Overview of helminths in small mammals in the Zhiguli State Reserve

Directory of Open Access Journals (Sweden)

Nadezhda Yu. Kirillova

2017-05-01

Full Text Available Helminths from a total of 24 species of small mammals, representing three orders (Insectivora, Chiroptera, Rodentia were examined in Zhiguli State Reserve (Russia. 90 species of helminthes were identified: Trematoda – 24, Cestoidea – 21, Nematoda – 43 and Acanthocephala – 2. For each helminth species the following traits are specified: systematic position, hosts, localization, host specificity, sites of findings and geographical distribution. Rodents, in which 33 helminth species were noted, were proven to have the richest parasite fauna. In chiropterans and insectivores 32 and 28 species of helminths were registered, respectively. Only one parasite species was common for all three orders of mammals – the acanthocephalan Moniliformis moniliformis. 14 species of parasites were discovered in mammals of Russia for the first time: Prosthodendrium hurkovaae, Rodentolepis erinacei, Staphylocystis syrdariensis, Aonchotheca erinacei, Crenosoma striatum, Tricholinstowia linstowi, T. talpae, Molinistrongylus alatus, M. spasskii, M. vespertilionis, Pterothominx neopulchra, Pterygodermatites bovieri, Syphacia nigeriana, Centrorhynchus aluconis, larvae, Moniliformis moniliformis, larvae. 21 species of parasitic worms were found for the first time in mammals of the Volga River basin. Nine helminth species, discovered in small mammals of the Zhiguli State Reserve, are of epidemiological and epizootiological importance.

Characterization of the guinea pig 3beta-hydroxysteroid dehydrogenase/Delta5-Delta4-isomerase expressed in the adrenal gland and gonads.

Science.gov (United States)

Durocher, Francine; Sanchez, Rocio; Ricketts, Marie-Louise; Labrie, Yvan; Laudet, Vincent; Simard, Jacques

2005-11-01

The guinea pig adrenal gland, analogous to the human, possesses the capacity to synthesize C(19) steroids. In order to further understand the control of guinea pig adrenal steroidogenesis we undertook the characterization of the guinea pig 3beta-hydroxysteroid dehydrogenase/Delta(5)-Delta(4)-isomerase (3beta-HSD) expressed in the adrenal gland. A cDNA clone encoding guinea pig 3beta-HSD isolated from a guinea pig adrenal library is predicted to encode a protein of 373 amino acid residues and 41,475Da. Ribonuclease protection assay suggests that this cDNA corresponds to the predominant, if not the sole, mRNA species detectable in total RNA from the guinea pig adrenal gland, ovary and testis. The guinea pig 3beta-HSD shows a similar affinity for both pregnenolone and dehydroepiandrosterone, and in addition, a 17beta-HSD type II-like activity was also observed. A phylogenetical analysis of the 3beta-HSD gene family demonstrates that the guinea pig is in a parallel branch to the myomorpha group supporting the hypothesis that the guinea pig lineage has branched off after the divergence among primates, artiodactyls and rodents, suggesting the paraphyly of the order rodentia.

Checklist of helminths found in Patagonian wild mammals.

Science.gov (United States)

Fugassa, Martin H

2015-09-03

Using available reports, a checklist of the recorded helminth parasites of wild mammals from Patagonia was generated. Records of parasites found in Patagonia were included, together with records from mammals in áreas outside of Patagonia but whose range extends into Patagonia. Information about the host, localities, and references were also included. A total of 1323 records (224 Cestoda, 167 Trematoda, 894 Nematoda, 34 Acanthocephala, and 4 Pentastomida) belonging to 452 helminth species (77 Cestoda, 76 Trematoda, 277 Nematoda, 21 Acanthocephala, and 1 Pentastomida) found in 57 native mammals (22 Rodentia, 4 Didelphimorphia 1 Microbiotheria, 7 Chiroptera, 5 Cingulata, and 13 Carnivora) were listed. However, only 10.6 % of the reports were conducted on samples from Patagonia and corresponded to 25% of mammals in the region. In addition, many studies were made on a few species and, for example, 52% corresponded to studies made on Lama guanicoe. This suggests the need to increase efforts to know the parasitic fauna in a peculiar region as is the Patagonia. This is the first compilation of the helminth parasites of mammals in Argentine Patagonia and is important for parasitological and paleoparasitological studies.

Variación cariológica en diferentes fenotipos de Sciurus granatensis (Rodentia, Sciuridae

Directory of Open Access Journals (Sweden)

Marcos Nicolás Chacón Rojas

2007-01-01

de individuos con genomas diferentes en un población puede originar un proceso de depresión por exogamia o introgresión genética (pérdida de alelos adaptativos locales, procesos nocivos para la población receptora. Se estudiaron siete especímenes (cinco hembras y dos machos de S. granatensis procedentes del tráfico ilegal. Los cariotipos fueron obtenidos a partir de cultivos de linfocitos de sangre periférica. Las metafases con bandas G, R, C, Q y NOR, se analizaron al microscopio y se ordenaron en el programa Lucia Karyotyping®. Los individuos estudiados corresponden a los tres fenotipos reportados por Emmons LH, 1990, pero con una gran variación cariológica. Solo uno de los machos no corresponde a los fenotipos descritos, y además presenta varios rearreglos cromosómicos que lo diferencian notablemente de los demás, por lo cual posiblemente se trate de un híbrido estéril originado de dos poblaciones diferenciadas cariológicamente. El número de cromosomas fue constante (2n=42, con variación en el número fundamental (NF=80; 81, por lo cual se reportan tres cariomorfos para Sciurus granatensis, según NF y los rearreglos cromosómicos encontrados. Se observó variación en los pares 9, 16 y una translocación universal entre autosomas dentro de uno de los ejemplares. El cromosoma X es submetacéntrico mediano. El cromosoma Y es acrocéntrico, coincidente con lo descrito para Sciurus. No se registró una relación cariotipo-fenotipo. Por lo tanto se puede sugerir que Sciurus granatensis, es un complejo de especies con diferencias cariológicas y morfológicas que no ha sido estudiado a profundidad teniendo en cuenta su amplia distribución geográfica.

Karyotypic analysis in species of the genus Dasyprocta (Rodentia: Dasyproctidae found in Brazilian Amazon

Directory of Open Access Journals (Sweden)

ROSEMAR S. L. RAMOS

2003-03-01

Full Text Available A total of 30 animals of the genus Dasyprocta were cytogenetically studied. They belong to the following species: D. prymnolopha (N=20, D. leporina (N=6, D. fuliginosa (N=1 and Dasyprocta sp. (N=3 (Dasyproctidae, Hystricognathi. Cell suspensions were obtained by peripheral blood culture, besides bone marrow and spleen cells, from D. prymnolopha and D. leporina. The diploid number was 64/65 for all samples. The karyotypes showed similarity, and chromosomal polymorphism was not detected by Giemsa conventional staining and G banding. The constitutive heterochromatin distribution at the pericentromeric region of all the chromosomes was similar in all species. D. prymnolopha, D. leporina and Dasyprocta sp. presented variation in the heterochromatical block size at one of the homologues of the A18 pair. D. fuliginosa presented the heterochromatin uniformly distributed in all chromosomes. There was not variation in the NORs pattern in the species studied.Foram estudados citogeneticamente um total de 30 animais das espécies D. prymnolopha (N=20, D. leporina (N=6, D. fuliginosa (N=1 e Dasyprocta sp. (N=3 (Dasyproctidae, Histricognathi. As preparações cromossômicas foram obtidas do cultivo de sangue periférico, além de medula óssea e baço em D. prymnolopha e D. leporina. O número diplóide foi de 64/65 em todos os exemplares. O cariótipo mostrou similaridade, não sendo detectado, através de coloração convencional de giemsa e de banda G, polimorfismo cromossômico em qualquer uma das espécies estudadas. A distribuição da heterocromatina constitutiva na região pericentromérica de todos os cromossomos foi similar nas quatro espécies. D. prymnolopha, D. leporina e Dasyprocta sp. apresentaram variação no tamanho do bloco heterocromático em um dos homólogos do par A18. D. fuliginosa apresentou a heterocromatina uniformemente distribuída em todos os cromossomos. Não houve variação no padrão das RONs entre as esp��cies estudadas.

Morphology of the tongue and characteristics of lingual papillae in Cuniculus paca (Rodentia: Cuniculidae

Directory of Open Access Journals (Sweden)

André Luiz Quagliatto Santos

2013-11-01

Full Text Available This paper describes the morphology of the tongue, its extrinsic muscles, and the characteristics of lingual papillae in Cuniculus paca. We used fifteen specimens from the Wild Animals Sector of Universidade Estadual Paulista (UNESP. In this species, the tongue is divided into three regions: root, body, and apex. The latter is delimited by the lingual frenum, which has the aspect of fibrous membrane. We also identified a median groove and a prominence on its dorsal surface. The extrinsic tongue muscles are the styloglossus, hyoglossus, genioglossus, geniohyoid, and milohyoid, the latter two are inserted into the hyoid apparatus. As for the presence of lingual papillae, we observed five papillae types in all specimens: filiform, fungiform, vallate, foliate, and conic. The filiform papillae are distributed throughout the apex surface and tongue body. They are caudally inclined throughout the body, until they are modified in the root region and form the conic papillae. The fungiform papillae are distributed in a large amount on the lingual apex, between the filiform papillae. This papilla type has a mushroom-like shape. Only two vallate papillae are located in the caudal portion of the lingual root, and they have an oval shape and are surrounded by a deep groove. The foliate papillae are observed in parallel grooves or slots located in the lateral portion of the tongue, between the vallate papillae and half of the intermolar prominence. In the tongue root, body, and apex we observed keratinized squamous stratified epithelium lining both the lingual papillae and the surface between them.

A new form of rodent placentation in the relict species, Laonastes aenigmamus (Rodentia Diatomyidae)

DEFF Research Database (Denmark)

Carter, Anthony Michael; Enders, A C; Jones, C J P

2013-01-01

INTRODUCTION: The Laotian rock rat is a relict species in a sister group relationship to hystricognath rodents (Hystricognathi). We asked whether there were similarities in placentation that might reflect this relationship or differences that might cast light on the evolution of Hystricognathi....... METHODS: We examined the reproductive tract of nonpregnant (n = 5), early (n = 3) and mid to late gestation (n = 2) females. Selected characters were mapped to a phylogenetic tree to examine their evolution in rodents. RESULTS: The chorionic placenta was discoid and labyrinthine with a spongy zone...

Genetic variation in house mice (Mus, Muridae, Rodentia) from the Czech and Slovak Republics

Czech Academy of Sciences Publication Activity Database

Šugerková, Monika; Munclinger, P.; Božíková, E.; Piálek, Jaroslav; Macholán, Miloš

2002-01-01

Roč. 51, č. 2 (2002), s. 81-92 ISSN 0139-7893 R&D Projects: GA AV ČR IAA6045601; GA AV ČR IAA6045902; GA ČR GA206/01/0989; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z5045916 Keywords : house mouse * genetic variation * allozymes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/2/081-092.pdf

[Reproduction of European bank vole (Myodes glareolus, Rodentia) under conditions of natural geochemical anomalies].

Science.gov (United States)

Baĭtimirova, E A; Mamina, V P; Zhigal'skiĭ, O A

2010-01-01

Estimates of abundance, morpho-functional state of ovaries, potential and actual fecundity of European bank vole, Myodes glareolus, inhabiting the territories of natural geochemical anomalies that are situated over ultra-basic rock and have an excess content of chrome, nickel, and cobaltare obtained. The population adaptive response to extreme geochemical conditions that facilitates the species survival under unfavorable environmental conditions and is manifested through an increase in potential and actual fecundity, decline of pre-implantation mortality, and decrease in proportion of females with pre-implantation losses is revealed. It is shown that in anomalous areas the intensity of folliculogenesis in mature voles is independent of the population cycle phase. As for immature animals residing within geochemical anomalies, an increase in size and numbers of follicles in ovaries is observed which is indicative of maturation fastening. An increase in potential and actual fecundity, as well as changes in morpho-functional state of ovaries, can be interpreted as means of birth rate accelerating which is supposed to compensate high postnatal mortality and maintain population abundance.

A new chromosomal race (2n=44) of Nannospalax xanthodon from Turkey (Mammalia: Rodentia)

Czech Academy of Sciences Publication Activity Database

Kankilic, T.; Arslan, A.; Seker, P. S.; Kankilic, T.; Toyran, K.; Zima, Jan

2017-01-01

Roč. 63, č. 3 (2017), s. 181-188 ISSN 0939-7140 Institutional support: RVO:68081766 Keywords : Nannospalax * Pülümür race * karyotype * C-bands * Ag-NORs Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.525, year: 2016

Death of Boa constrictor amarali (serpentes, boidae after ingestion of a tree porcupine (rodentia

Directory of Open Access Journals (Sweden)

A. L. Cherubini

2003-01-01

Full Text Available The objective of this paper is to report the death of a Boa constrictor amarali after ingestion of a tree porcupine. The animal was donated to the Center for the Study of Venoms and Venomous Animals (CEVAP/UNESP - and died in captivity. At necropsy, spine-like structures were observed in the stomach serosa and vicinity, and the stomach mucosa showed an intense reddish area, suggesting inflammation. The analysis of the spine-like structure revealed that they were tree porcupine spines. The feeding habits and inexperience of this Boa constrictor amarali in selecting its prey may have been be responsible for its death.

The lumbosacral plexus of the red-rumped agouti (Dasyprocta leporina Linnaeus, 1758 (Rodentia: Caviidae

Directory of Open Access Journals (Sweden)

Gleidson Benevides de Oliveira

2016-12-01

Full Text Available The red-rumped agouti is a small-sized wild rodent, belonging to the Dasyproctidae family, with great zootechnical potential, and it adapts well to captivity. In order to contribute to the species biology, this study describes the origin of the nerves forming the lumbosacral plexus. Twelve animals (six males and six females were used, from previous experiments. The animals were fixed in a 10% formaldehyde aqueous solution and eviscerated after 72 hours. Then, the major and minor psoas muscles were retracted, exposing the nerves forming the plexus. Cotton soaked with 20-volume hydrogen peroxide was placed on these nerves, remaining for 12 hours straight for bleaching and subsequent dissection. The topographical relations of the lumbosacral plexus were grouped into tables and arranged in terms of simple percentage. In 7 cases (58.34%, the lumbosacral plexus in the red-rumped agouti stemmed from the ventral roots of the last 4 lumbar nerves and the first 3 sacral nerves (Type I – L4-S3, in 4 animals (33.33% it stemmed from L5-S3 (Type II, and in 1 case (8.33% it stemmed from L5-S4 (Type III. The nerves participating of the lumbosacral plexus in the red-rumped agouti were: lateral femoral cutaneous, genitofemoral, femoral, obturator, sciatic, cranial gluteal, caudal gluteal, and pudendal nerve. The origin of the lumbosacral plexus and the spinal nerves making up this plexus in red-rumped agoutis were similar to that described in other rodents, such as rock cavy, lowland paca and spix's yellow-toothed cavy.

Ear Structures of the Naked Mole-Rat, Heterocephalus glaber, and Its Relatives (Rodentia: Bathyergidae.

Directory of Open Access Journals (Sweden)

Matthew J Mason

Full Text Available Although increasingly popular as a laboratory species, very little is known about the peripheral auditory system of the naked mole-rat, Heterocephalus glaber. In this study, middle and inner ears of naked mole-rats of a range of ages were examined using micro-computed tomography and dissection. The ears of five other bathyergid species (Bathyergus suillus, Cryptomys hottentotus, Fukomys micklemi, Georychus capensis and Heliophobius argenteocinereus were examined for comparative purposes. The middle ears of bathyergids show features commonly found in other members of the Ctenohystrica rodent clade, including a fused malleus and incus, a synovial stapedio-vestibular articulation and the loss of the stapedius muscle. Heterocephalus deviates morphologically from the other bathyergids examined in that it has a more complex mastoid cavity structure, poorly-ossified processes of the malleus and incus, a 'columelliform' stapes and fewer cochlear turns. Bathyergids have semicircular canals with unusually wide diameters relative to their radii of curvature. How the lateral semicircular canal reaches the vestibule differs between species. Heterocephalus has much more limited high-frequency hearing than would be predicted from its small ear structures. The spongy bone forming its ossicular processes, the weak incudo-stapedial articulation, the columelliform stapes and (compared to other bathyergids reduced cochlear coiling are all potentially degenerate features which might reflect a lack of selective pressure on its peripheral auditory system. Substantial intraspecific differences were found in certain middle and inner ear structures, which might also result from relaxed selective pressures. However, such interpretations must be treated with caution in the absence of experimental evidence.

Ear Structures of the Naked Mole-Rat, Heterocephalus glaber, and Its Relatives (Rodentia: Bathyergidae).

Science.gov (United States)

Mason, Matthew J; Cornwall, Hannah L; Smith, Ewan St J

2016-01-01

Although increasingly popular as a laboratory species, very little is known about the peripheral auditory system of the naked mole-rat, Heterocephalus glaber. In this study, middle and inner ears of naked mole-rats of a range of ages were examined using micro-computed tomography and dissection. The ears of five other bathyergid species (Bathyergus suillus, Cryptomys hottentotus, Fukomys micklemi, Georychus capensis and Heliophobius argenteocinereus) were examined for comparative purposes. The middle ears of bathyergids show features commonly found in other members of the Ctenohystrica rodent clade, including a fused malleus and incus, a synovial stapedio-vestibular articulation and the loss of the stapedius muscle. Heterocephalus deviates morphologically from the other bathyergids examined in that it has a more complex mastoid cavity structure, poorly-ossified processes of the malleus and incus, a 'columelliform' stapes and fewer cochlear turns. Bathyergids have semicircular canals with unusually wide diameters relative to their radii of curvature. How the lateral semicircular canal reaches the vestibule differs between species. Heterocephalus has much more limited high-frequency hearing than would be predicted from its small ear structures. The spongy bone forming its ossicular processes, the weak incudo-stapedial articulation, the columelliform stapes and (compared to other bathyergids) reduced cochlear coiling are all potentially degenerate features which might reflect a lack of selective pressure on its peripheral auditory system. Substantial intraspecific differences were found in certain middle and inner ear structures, which might also result from relaxed selective pressures. However, such interpretations must be treated with caution in the absence of experimental evidence.

A model to optimize trap systems used for small mammal (Rodentia, Insectivora density estimates

Directory of Open Access Journals (Sweden)

Damiano Preatoni

1997-12-01

Full Text Available Abstract The environment found in the upper and lower Padane Plain and the adjoining hills isn't very homogeneous. In fact it is impossible to find biotopes extended enough to satisfy the necessary criteria for density estimate of small mammals based on the Removal method. This limitation has been partially overcome by adopting a reduced grid, counting 39 traps whose spacing depends on the studied species. Aim of this work was to verify - and eventually measure - the efficiency of a sampling method based on a "reduced" number of catch points. The efficiency of 18 trapping cycles, realized from 1991 to 1993, was evaluated as percent bias. For each of the trapping cycles, 100 computer simulations were performed, so obtaining a Monte-Carlo estimate of bias in density values. Then later, the efficiency of different trap arrangements was examined by varying the criteria. The numbers of traps ranged from 9 to 49, with trap spacing varying from 5 to 15 m and a trapping period duration from 5 to 9 nights. In this way an optimal grid system was found both for dimensions and time duration. The simulation processes involved, as a whole, 1511 different grid types, for 11347 virtual trapping cycles. Our results indicate that density estimates based on "reduced" grids are affected by an average -16% bias, that is an underestimate, and that an optimally sized grid must consist of 6x6 traps square, with about 8.7 m spacing. and be in operation for 7 nights.

Observations on the Reproductive Biology of Gerbillus dasyurus (Wagner, 1842) (Mammalia: Rodentia) in Turkey

OpenAIRE

ÇOLAK, Ercüment; SÖZEN, Mustafa; YİĞİT, Nuri

1999-01-01

The reproductive data along with some ecological observations of Gerbillus dasyurus are reported based on field studies and investigations in captivity. The findings indicate that the favorable habitat of G. dasyurus is rocky areas with sparse vegetated soil and that the reproduction period extends from January to September. According to the reproductive data, the average weight at birth is 2.22 g., litter size ranges from 3 to 9, with an average of 5.66, a female gives three litters during a...

Albinismo parcial em cutia Dasyprocta azarae (Lichtenstein, 1823 (Rodentia, Dasyproctidae, no sul do Brasil

Directory of Open Access Journals (Sweden)

Stefan Vilges de Oliveira

2009-06-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n4p243 O presente trabalho registra um caso de albinismo parcial em cutia, Dasyprocta azarae, observado no município de Caçapava do Sul, RS.

Rattus norvegicus (Rodentia: Muridae Infected by Leishmania (Leishmania infantum (syn. Le. chagasi in Brazil

Directory of Open Access Journals (Sweden)

Fabiana de Oliveira Lara-Silva

2014-01-01

Full Text Available In the present study we surveyed the fauna of phlebotomine sand flies and small mammals in peridomestic areas from a Brazilian municipality where the American cutaneous leishmaniasis (ACL is endemic. A total of 608 female phlebotomine sand flies were captured during nine months in 2009 and 2010. Seven different species were represented with 60% of them being Lutzomyia intermedia and Lu. whitmani, both incriminated vectors of ACL. Lu. longipalpis, a proven vector of visceral leishmaniasis (VL was also captured at high proportion (12.8%. Genomic DNA analysis of 136 species-specific pools of female sand flies followed by molecular genotyping showed the presence of Leishmania infantum DNA in two pools of Lu. longipalpis. The same Leishmania species was found in one blood sample from Rattus norvegicus among 119 blood and tissue samples analysed. This is the first report of Le. infantum in R. norvegicus in the Americas and suggests a possible role for this rodent species in the zoonotic cycle of VL. Our study coincided with the reemergence of VL in Governador Valadares.

Evolutionary systematics and biogeography of endemic gerbils (Rodentia, Muridae) from Morocco: an integrative approach

Czech Academy of Sciences Publication Activity Database

Ndiaye, A.; Ba, K.; Aniskin, V. M.; Benazzou, T.; Chevret, P.; Konečný, Adam; Sembene, M.; Tatard, C.; Kergoat, G. J.; Granjon, L.

2012-01-01

Roč. 41, č. 1 (2012), s. 11-28 ISSN 0300-3256 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : geometric morphometrics * Middle Pleistocene * African gerbils * West Africa * taxonomy Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012

OSMUNDACEAE EN ARGENTINA, PARAGUAY Y URUGUAY

Directory of Open Access Journals (Sweden)

Marcelo D. Arana

2015-01-01

Full Text Available En este estudio se actualiza la taxonomía y distribución de las Osmundaceae, familia de helechos que habitan bosques y humedales subtropicales de la Argentina, Paraguay y Uruguay. Actualmente la familia comprende cuatro géneros, dos de ellos, con una especie cada uno, estan presentes en la región estudiada. Se acepta Osmunda spectabilis como una especie válida, diferente de O. regalis , la que no se encuentra presente en el área de estudio. Se reconoce a nivel de género a Osmundastrum con una única especie O. cinnamomeum var. cinnamomeum . Se incluyen una clave para los géneros, descripciones, la sinonimia relevante para América del Sur, distribuciones e ilustraciones de las especies. Se lectotipifica a Osmunda imbricata, Osmunda palustris y Osmunda spectabilis var. brasiliensis .

Macrozoobenthic recolonization of the littoral and the soft bottom after an oil spill

International Nuclear Information System (INIS)

Lax, H.J.; Vainio, T.

1988-01-01

Two years after the Eira oil spill the oil concentration in the water had returned to its background level (0.5 ug/l) in the open sea areas. On the polluted shores (depth 0.1- 0.5 m) higher concentrations (2.3 ug/l) occurred occasionaly. No clear effects related to the oil spill were noticed on the dominating soft bottom species (Macoma baltica, Pontoporeia affinis). Among the other soft bottom species the crustacean Corophium volutator showed its lowest density immediately after the spill, becoming more and more abundant during the following two years. The effect of the oil spill on the littoral fauna could still be noticed two years after the spill. The crustacean Gammarus duebeni avoided its natural habitat (uppermost littoral zone). Lymnaea palustris showed and increased mortality immediately after the oil spill but recolonized the polluted shores a normal distribution

Scaling of phloem structure and optimality of photoassimilate transport in conifer needles

DEFF Research Database (Denmark)

Ronellenfitsch, Henrik; Liesche, Johannes; Jensen, Kaare Hartvig

2015-01-01

The phloem vascular system facilitates transport of energy-rich sugar and signalling molecules in plants, thus permitting long-range communication within the organism and growth of non-photosynthesizing organs such as roots and fruits. The flow is driven by osmotic pressure, generated...... by differences in sugar concentration between distal parts of the plant. The phloem is an intricate distribution system, and many questions about its regulation and structural diversity remain unanswered. Here, we investigate the phloem structure in the simplest possible geometry: a linear leaf, found......, for example, in the needles of conifer trees. We measure the phloem structure in four tree species representing a diverse set of habitats and needle sizes, from 1 (Picea omorika) to 35 cm (Pinus palustris). We show that the phloem shares common traits across these four species and find that the size of its...

Time series analysis of forest carbon dynamics: recovery of Pinus palustris physiology following a prescribed fire

Science.gov (United States)

G. Starr; C. L. Staudhammer; H. W. Loescher; R. Mitchell; A. Whelan; J. K. Hiers; J. J. O’Brien

2015-01-01

Frequency and intensity of fire determines the structure and regulates the function of savanna ecosystems worldwide, yet our understanding of prescribed fire impacts on carbon in these systems is rudimentary. We combined eddy covariance (EC) techniques and fuel consumption plots to examine the short-term response of longleaf pine forest carbon dynamics to one...

Imputation of individual longleaf pine (Pinus palustris Mill.) tree attributes from field and LiDAR data

Science.gov (United States)

Carlos A. Silva; Andrew T. Hudak; Lee A. Vierling; E. Louise Loudermilk; Joseph J. O' Brien; J. Kevin Hiers; Steve B. Jack; Carlos Gonzalez-Benecke; Heezin Lee; Michael J. Falkowski; Anahita Khosravipour

2016-01-01

Light Detection and Ranging (LiDAR) has demonstrated potential for forest inventory at the individual-tree level. The aim in this study was to predict individual-tree height (Ht; m), basal area (BA; m2), and stem volume (V; m3...

Moulting and wintering grounds of Marsh Warblers Acrocephalus palustris: evidence from stable isotopes and ring recoveries

Czech Academy of Sciences Publication Activity Database

Procházka, Petr; Kralj, J.; Pearson, D. J.; Yohannes, E.

2014-01-01

Roč. 49, č. 2 (2014), s. 193-200 ISSN 0001-6454 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : bird migration * feather stable isotopes * ring recoveries * stopover * migratory connectivity * δ13C * δ15N Subject RIV: EG - Zoology Impact factor: 0.745, year: 2014

Spatial patterns of longleaf pine (Pinus palustris) seedling eastablishment on the croatan national forest, North Carolina

Science.gov (United States)

Chadwick R. Avery; Susan Cohen; Kathleen C. Parker; John S. Kush

2004-01-01

Ecological research aimed at determining optimal conditions for longleaf pine regeneration has become increasingly important in efforts @ restore the longleaf pine ecosystem. Numerous authors have concluded that a negative relationship exists between the occurrence of seedlings and the occurrence of mature trees; however, observed field conditions in several North...

Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica

OpenAIRE

Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

2016-01-01

Background and Aims In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats.

A survey of recent mammal collections in italy

Directory of Open Access Journals (Sweden)

Anna Maria De Marinis

2008-02-01

Full Text Available Abstract A survey was designed to assess the status of the collections of recent mammals in Italy through 79 questionnaires mailed to the main University institutions, municipal, provincial or regional museums and other institutions (including some private collections. We received 58 questionnaires (return rate of 73%. The minimum number of specimens in recent mammal collections in Italy is 161,268 (70% are in Italian collections and 30% in exotic ones. Most of these specimens are concentrated in a quarter of the collections. Taxidermy is the main preservation technique, above all in exotic collections (84%. 82% of the exotic collections date back to the 19th century, while specimens collected after 1950 form 91% of the Italian ones. During the 20th century the Italian collections progressively increased in number and spread through the peninsula and in Sicily. Insectivora, Rodentia, Carnivora, Lagomorpha, Artiodactyla and Primates are represented in more than 80% of the collections. Research results the primary goal both in Italian (70% and exotic (57% collections.

Appendix
This paper contains an appendix, available in electronic format only.
Click here to download supplementary files.
Riassunto Le collezioni di mammiferi attuali in Italia. Per delineare lo status delle collezioni museali di mammiferi attuali in Italia è stata condotta un’indagine mediante 79 questionari inviati a istituzioni universitarie, musei civici, provinciali e regionali ed altre istituzioni (comprese alcune collezioni private. Abbiamo ricevuto 58 questionari (73%. In Italia il numero minimo di esemplari di mammiferi attuali presenti nelle collezioni è risultato 161.268 (il 70% in collezioni italiane, il rimanente 30% in collezioni esotiche. La maggior parte degli

Articoli teriologici nelle principali riviste pubblicate in Italia (1980-2003: analisi e tendenze

Directory of Open Access Journals (Sweden)

Luca Canova

2004-06-01

Full Text Available Abstract Papers on mammalogy published on the main Italian journals from 1980 to 2003: trends and analysis We analysed articles on mammalogy published from 1980 to 2003 in the main journals published in Italy: Italian Journal of Zoology (IJZ, Ethology Ecology & Evolution (EEE and Hystrix. The number of articles increased throughout the study period as well as the average number of authors. The observed frequency of paper on Carnivora Rodentia and Arctiodactyla is higher than expected on the basis of their richness, here assumed as a index of their availability for researchers. This data could be interpreted as the effect of an increased availability of funds provided by Local Administration for game management (Arctiodactyla, the attractiveness of predators and the possibility to do research at community level with small grants (Rodentia. The hypothesis is supported by a very low research effort devoted to Cetacea and Chiroptera. We observed a decreasing trend in frequency of paper concerning "traditional" approaches, a stabilisation of paper concerning mammal zoogeography and eco-ethology and a linear increase in emerging subject such as game management, conservation biology and ecotoxicology. From a quantitative point of view, Hystrix is comparable to IJZ and EEE; however, printing punctuality must be considerably improved. Riassunto È stata analizzata, sotto il profilo quali-quantitativo, la produzione di articoli teriologici pubblicata su Italian Journal of Zoology, Ethology Ecology & Evolution e Hystrix fra il 1980 e il 2003. La quantità di articoli tende ad aumentare nel tempo, al pari del numero medio di autori per articolo. La frequenza di articoli inerenti Carnivori, Roditori e Artiodattili è maggiore di quanto atteso sulla base della ricchezza di specie in Italia, assunta come indice della disponibilità di specie nella

Atropelamentos de vertebrados na Floresta Nacional de Carajás, Pará, Brasil Roadkills of vertebrates in Carajas National Forest, Para, Brazil

Directory of Open Access Journals (Sweden)

Fabiano Gumier-Costa

2009-01-01

Full Text Available Vários pesquisadores têm avaliado impactos de estradas. Estes podem envolver aspectos paisagísticos, degradação do solo, poluição do ar e impactos sobre a fauna, como atropelamentos. Na estrada Raimundo Mascarenhas, que atravessa a Floresta Nacional de Carajás (ca. 400 mil hectares, há intenso tráfego de veículos automotores. O objetivo deste trabalho foi testar se há diferenças entre trechos da estrada, em três escalas espaciais; se há alteração ao longo dos anos; se alguns táxons são mais freqüentemente atropelados, e se a freqüência de atropelamentos aumenta com a precipitação mensal. Analisamos a freqüência de atropelamentos de vertebrados de abril/2003 até outubro/2006 ao longo dos 25 km iniciais da estrada. Registramos 155 atropelamentos. O número de atropelamentos diminui ao longo dos anos (P=0,01, e com a distância do início da estrada (P=0,0002. Serpentes (Ophidia e gambás Didelphis marsupialis foram mais atropelados (7,5/ano, seguidos de aves, raposas Cerdocyon thous, quatis Nasua nasua, roedores (Rodentia, e não identificados (4,9/ano; cuíca Marmosops sp., tapeti Sylvilagus brasiliensis, guariba Alouatta sp., irara Eira barbara, jabuti Geochelone sp., lagartos (Lacertilia e macaco prego Cebus apella (1/ano. Não houve relação significativa entre o número mensal de atropelamentos e a precipitação mensal.Several researchers have evaluated impacts of highways. These can involve landscape aspects, soil degradation, air pollution, and impacts upon wildlife, such as roadkills. At the Raimundo Mascarenhas highway, that crosses the Carajás National Forest (ca. 400.000 ha, there is intense traffic of automotive vehicles. The aim of this work was to test if there were differences among higway sections on three spatial scales; if there was alteration along the years; if some taxa suffered more frequently roadkills; and if roadkill frequency increased with monthly precipitation. We analysed roadkill

Check-list of the pentastomid parasites crocodilians and freshwater chelonians.

Science.gov (United States)

Junker, K; Boomker, J

2006-03-01

Based on published records and own data a summary is given of the geographical distribution of the currently known species of pentastomid parasites infecting crocodiles and alligators, as well as freshwater chelonians. A brief generic diagnosis is provided for each genus. Fourteen out of the currently 23 living crocodilian species have been recorded as being host to one or more pentastomes. Out of the 32 pentastome species six are considered species inquirendae. Presently, six genera of crocodilian pentastomes, Agema, Alofia, Leiperia, Sebekia, Selfia and Subtriquetra are recognized. African crocodiles harbour eight pentastome species, six of which have been recorded from the Nile crocodile, Crocodylus niloticus. Three species belong to the genus Sebekia, Alofia being represented by two and Leiperia by only one species. Two species, Alofia parva and Agema silvae-palustris, occur in the dwarf crocodile, Osteolaemus tetraspis, and the slender-snouted crocodile, Crocodylus cataphractus, exclusively, but a single Sebekia species is shared with the Nile crocodile. The genus Agema is endemic to the African region. Infective stages of the pentastome Subtriquetra rileyi, thought to utilize Nile crocodiles as final hosts, have been recovered only from fishes. The largest number of pentastome species is found in the Australasian region. Of these, the Indo-Pacific crocodile, Crocodylus porosus, harbours seven, representing the genera Alofia, Sebekia, Leiperia and Selfia. Selfia is exclusive to the latter host. The genus Subtriquetra has been reported from "Indian crocodiles", a term possibly referring to either Crocodylus palustris, Crocodylus porosus or Gavialis gangeticus. Ten species of pentastomes parasitizing the crocodilian genera Alligator, Caiman, Crocodylus and Melanosuchus have been recorded from the Neotropical region including the southern states of the North American continent. The two most wide-spread pentastome genera, Alofia and Sebekia, have been recorded

Rice field flora and vegetation in the provinces of Valencia and Tarragona

Directory of Open Access Journals (Sweden)

Carretero, J. L.

1988-01-01

Full Text Available Twenty nine emergent and twenty floating or submerged taxa , were found in the rice fields in Valencia and Tarragona provinces. Eleven of the se taxa, all them emergent, are alien Of introduced ones. Echinochloa oryzoides and E. oryzicola are the most important in both areas, together with Cyperus difformis and Echinochloa hispidula in Valencia. The remaining thirty eight taxa belong to the native flora. There are predominantly the emergent Scirpus maritimus, Alisma plantago-aquatica. Echinochloa crus-galli and Paspalum distichum; the floating Lemna minor and L. gibba; the submersed Potamogeton nodosus; Zannichellia palustris and Najas minor; and the macroscopical algae Chara vulgaris, Cladophora glomerata, Oedogonium capilliforme, Spirogyra spp., Pithophora oedogania and Hydrodictyon reticulatum. The flora evolution during the last years is analyzed and the present weed communities are studied. The contribution of the different phytosociological classes to the rice field weed flora is presented.

De los 49 táxones registrados (29 emergentes y 20 flotantes o sumergidos 11 son exóticos introducidos, de los cuales los más importantes son Echinochloa oryzoides y E. oryzicolaen ambas zonas, además de Cyperus difformis y Echinochloa hispidula en Valencia, y el resto propios de la flora autóctona, predominando Scirpus maritimus, Alisma plantago-aquatica. Echinochloa crus-galli y Paspalum distichum como emergentes, Lemna minor y L. gibba como flotantes, Potamogeton nodosus, Zannichellia palustris y Najas minor como sumergidos y Chara vulgaris, Cladophora glomerata, Oedogonium capilliforme. Spirogyra spp., Pirhophora oedogonia e Hydrodictyon reticulatum como algas macroscópicas. Se analiza la evolución experimentada por la flora en los últimos años, además de estudiar las

Development of the inverted visceral yolk sac in three species of caviids (Rodentia, Caviomorpha, Caviidae).

Science.gov (United States)

Miglino, M A; Franciolli, A L R; de Oliveira, M F; Ambrósio, C E; Bonatelli, M; Machado, M R F; Mess, A

2008-08-01

Guinea pig related rodents possess numerous derived placental characters. We attempt to identify diversity within the visceral yolk sac and its association with the chorioallantoic placenta in three species of caviids, two of them possessing a capsule formed by the decidua that covers the chorioallantoic placenta. The results verify that in early pregnancy all three species have an inverted yolk sac placenta. In advanced pregnancy the species differ: Galea spixii, as representative without a capsule, bear a yolk sac in apposition to the chorioallantoic placenta with signs of exchange activity until term. Galea is similar to other caviomorphs in this respect. In Dasyprocta leporina and Cuniculus paca, the representatives possessing a capsule, the yolk sac endoderm lacks signs of substance exchange. Evidently, the presence of a capsule prevents such an interaction. The variations established here must be considered if animal models for human placentation are required which have restricted access to the chorioallantoic placenta from the outside.

Systematic relationships within the Microtus arvalis (Rodentia: Cricetidae) group in Iran, inferred from cytogenetic analyses

Czech Academy of Sciences Publication Activity Database

Mahmoudi, A.; Zima, Jan; Kryštufek, B.; Darvish, J.; Aliabadian, M.; Arslan, A.

2018-01-01

Roč. 64, č. 1 (2018), s. 1-8 ISSN 0939-7140 Institutional support: RVO:68081766 Keywords : chromosome C-banding * karyotype * NORs * taxonomy Subject RIV: EG - Zoology Impact factor: 0.525, year: 2016

Cytogenetic damage and postradiation restoration of eye cornea epithelium of Rodentia characterizing by different radiosensitivity

International Nuclear Information System (INIS)

Popova, M.F.; Bulyakova, N.V.

1983-01-01

Intensity of beam damage and reparation of eye cornea epithelium of animals inhabiting under different conditions and differing by radiosensitivity has been studied. Mice differing by high radiosensitivity have the hardest cytogenetic damage. Cornea epithelium of bank voles is more radiostable than that of mice. The most negligible damages of cornea epithelium is observed in Mongolian sandwort despite the fact that their total radiation stability is lower than that of bank voles. High protective-restoring properties of eye cornea epithelium of Mongolian sandwort are explained by the structure of epithelium cells diffe-- ring by a large number of cytoplasm

Habitats, population densities, and social structure of capybaras (Hydrochaeris Hydrochaeris, Rodentia in the Pantanal, Brazil

Directory of Open Access Journals (Sweden)

Cleber J.R. Alho

1987-01-01

Full Text Available (1 The Pantanal is the central portion of a sunken flat plain bordering the upper Paraguay river, with an area of 140,000 km². Seasonal floods begin in January and end in April. From May to October the land dries out and campos (grassland formations and scattered pools appear. (2 Typical capybara habitat in the Pantanal is composed of three components: the water, a patch of forest, and a grass field for foraging. Highest densities of capybaras (14 individuals/km² were found during the rainy season when the available space for capybaras was reduced due to the flooding. Areas without ponds or creeks presented low densities (from 0.38 to 0.84 capybaras/km². Group sizes ranged from 2 to 49 individuals (x = 9.48. (3 Reproduction occurred year-round and young of different ages were seen throughout the year. However, the principal recruitment of young to the population was observed in July-August. While the females took turns in caring for young of different ages, probably the offspring of mothers who are sisters in the same social groups, the males competed intensively with each other for access to breeding females. The male's reproductive success appears to be limited to the number of breeding females that males have access to in the social group.

Hypsodont Myomiminae (Gliridae, Rodentia) from the Miocene and the Oligocene-Miocene boundary interval of Spain

NARCIS (Netherlands)

Daams, R.

1990-01-01

Fifty-one localities from the Oligocene-Miocene boundary interval and the Miocene of Spain have yielded nearly 4000 teeth of hypsodont Gliridae (Armantomys and Praearmantomys). The phylogeny and palaeoecology are discussed. Two new species of Armantomys (A. parsani sp. nov. from Ramblar 1 and A.

Digital dissection of the masticatory muscles of the naked mole-rat, Heterocephalus glaber (Mammalia, Rodentia

Directory of Open Access Journals (Sweden)

Philip G. Cox

2014-06-01

Full Text Available The naked mole-rat, Heterocephalus glaber, of the family Bathyergidae is a subterranean rodent that feeds on underground roots and tubers and digs extensive tunnel systems with its incisors. It is a highly unusual mammal with regard to its social structure, longevity, pain insensitivity and cancer resistance, all of which have made it the subject of a great deal of research in recent years. Yet, much of the basic anatomy of this species remains undocumented. In this paper, we describe the morphology of the jaw-closing musculature of the naked mole-rat, as revealed by contrast-enhanced micro-computed tomography. This technique uses an iodine stain to enable the imaging of soft tissues with microCT. The iodine-enhanced scans were used to create 3D reconstructions of the naked mole-rat masticatory muscles from which muscle masses were calculated. The jaw-closing musculature of Heterocephalus glaber is relatively very large compared to other rodents and is dominated by the superficial masseter, the deep masseter and the temporalis. The temporalis in particular is large for a rodent, covering the entirety of the braincase and much of the rear part of the orbit. The morphology of the masseter complex described here differs from two other published descriptions of bathyergid masticatory muscles, but is more similar to the arrangement seen in other rodent families. The zygomaticomandibularis (ZM muscle does not protrude through the infraorbital foramen on to the rostrum and thus the naked mole-rat should be considered protrogomorphous rather than hystricomorphous, and the morphology is consistent with secondarily lost hystricomorphy as has been previously suggested for Bathyergidae. Overall, the morphology of the masticatory musculature indicates a species with a high bite force and a wide gape–both important adaptations for a life dominated by digging with the incisors.

Are ribosomal DNA clusters rearrangement hotspots? A case study in the genus Mus (Rodentia, Muridae

Directory of Open Access Journals (Sweden)

Douzery Emmanuel JP

2011-05-01

Full Text Available Abstract Background Recent advances in comparative genomics have considerably improved our knowledge of the evolution of mammalian karyotype architecture. One of the breakthroughs was the preferential localization of evolutionary breakpoints in regions enriched in repetitive sequences (segmental duplications, telomeres and centromeres. In this context, we investigated the contribution of ribosomal genes to genome reshuffling since they are generally located in pericentromeric or subtelomeric regions, and form repeat clusters on different chromosomes. The target model was the genus Mus which exhibits a high rate of karyotypic change, a large fraction of which involves centromeres. Results The chromosomal distribution of rDNA clusters was determined by in situ hybridization of mouse probes in 19 species. Using a molecular-based reference tree, the phylogenetic distribution of clusters within the genus was reconstructed, and the temporal association between rDNA clusters, breakpoints and centromeres was tested by maximum likelihood analyses. Our results highlighted the following features of rDNA cluster dynamics in the genus Mus: i rDNA clusters showed extensive diversity in number between species and an almost exclusive pericentromeric location, ii a strong association between rDNA sites and centromeres was retrieved which may be related to their shared constraint of concerted evolution, iii 24% of the observed breakpoints mapped near an rDNA cluster, and iv a substantial rate of rDNA cluster change (insertion, deletion also occurred in the absence of chromosomal rearrangements. Conclusions This study on the dynamics of rDNA clusters within the genus Mus has revealed a strong evolutionary relationship between rDNA clusters and centromeres. Both of these genomic structures coincide with breakpoints in the genus Mus, suggesting that the accumulation of a large number of repeats in the centromeric region may contribute to the high level of chromosome repatterning observed in this group. However, the elevated rate of rDNA change observed in the chromosomally invariant clade indicates that the presence of these sequences is insufficient to lead to genome instability. In agreement with recent studies, these results suggest that additional factors such as modifications of the epigenetic state of DNA may be required to trigger evolutionary plasticity.

A new karyotype for the genus Cavia from a southern island of Brazil (Rodentia - Caviidae

Directory of Open Access Journals (Sweden)

A. Gava

1998-03-01

Full Text Available Intraspecific karyotype variation in mammal species is very common and often caused by centromeric fusion of acrocentric chromosomes. We describe here a new karyotype 2n = 62 (FN = 112 for the genus Cavia from the Moleques do Sul Islands, of the southern coast of Brazil. We analyzed two male and four female karyotypes that had twenty-four biarmed pairs and six pairs of acrocentric chromosomes. The sexual pair consisted of a metacentric X-chromosome and a large acrocentric Y. C-bands were found in the centromeric and pericentromeric regions of almost all chromosomes, except for some small biarmed and acrocentric ones. Nucleolus organizer regions appeared in two biarmed chromosomes, and G-banding patterns were also seen.RESUMO A variação cariotípica nas espécies de mamíferos é bastante comum e geralmente causada pela fusão de cromossomos acrocêntricos. Foi descrito neste trabalho um novo cariótipo, com 2n = 62 e FN = 112, para o gênero Cavia proveniente das ilhas Moleques do Sul, da costa sul do Brasil. Foram analisados os cariótipos de dois machos e quatro fêmeas que possuiam 24 pares de cromossomos com dois braços e seis pares de acrocêntricos. O par sexual era constituído por um cromossomo X metacêntrico grande e um Y acrocêntrico. As bandas C estavam localizadas nas regiões centroméricas e pericentroméricas da maioria dos cromossomos, com exceção de alguns acrocêntricos e os cromossomos de dois braços menores. As regiões organizadoras de nucléolo ocorreram em dois cromossomos com dois braços e o padrão de bandamento G foi também apresentado.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, Caviidae) in Colombia.

Science.gov (United States)

Burgos-Paz, William; Cerón-Muñoz, Mario; Solarte-Portilla, Carlos

2011-10-01

The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho) from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Genetic diversity and population structure of the Guinea pig (Cavia porcellus, Rodentia, caviidae in Colombia

Directory of Open Access Journals (Sweden)

William Burgos-Paz

2011-01-01

Full Text Available The aim was to establish the genetic diversity and population structure of three guinea pig lines, from seven production zones located in Nariño, southwest Colombia. A total of 384 individuals were genotyped with six microsatellite markers. The measurement of intrapopulation diversity revealed allelic richness ranging from 3.0 to 6.56, and observed heterozygosity (Ho from 0.33 to 0.60, with a deficit in heterozygous individuals. Although statistically significant (p < 0.05, genetic differentiation between population pairs was found to be low. Genetic distance, as well as clustering of guinea-pig lines and populations, coincided with the historical and geographical distribution of the populations. Likewise, high genetic identity between improved and native lines was established. An analysis of group probabilistic assignment revealed that each line should not be considered as a genetically homogeneous group. The findings corroborate the absorption of native genetic material into the improved line introduced into Colombia from Peru. It is necessary to establish conservation programs for native-line individuals in Nariño, and control genealogical and production records in order to reduce the inbreeding values in the populations.

Taxonomic, biogeographic, and taphonomic reassessment of a large extinct species of paca from the Quaternary of Brazil

Directory of Open Access Journals (Sweden)

Elver Luiz Mayer

2016-12-01

Full Text Available The taxonomy of extinct species of Cuniculus (Caviomorpha, Rodentia, Mammalia is confusing and poorly studied. Here we provide a taxonomic review of extinct cuniculids, and discuss the taxonomic, biogeographic, taphonomic and chronologic aspects of new remains of an extinct large cuniculid from Brazilian Quaternary Gruta Cuvieri cave deposits. Our taxonomic review suggests that Cuniculus rugiceps (Lund, 1837 is the valid taxon to include all available occurrences of extinct cuniculids. The most evident features of this taxon are its larger size and the stronger and more densely distributed rugosities on the skull external surface when compared to the extant species. At present, the distribution of C. rugiceps is restricted to the tropical region of Brazil. Regarding the new remains, taphonomic analysis of the specimens from Cuvieri Cave suggests our sample is represented by at least seven individuals that accumulated within the cave deposit by pitfall entrapment. The biostratinomy of the specimens was characterized by prolonged surface exposure inside the pit with fragmentation and displacement caused mostly by falling and subsequent trampling by individuals of the same and/or other species. The stratigraphically controlled excavations and chronological data allowed the establishment of a Late Pleistocene minimum age for these specimens.

Fluctuating Asymmetry of Craniological Features of Small Mammals as a Reflection of Heterogeneity of Natural Populations

Directory of Open Access Journals (Sweden)

Elena Shadrina

2016-11-01

Full Text Available Fluctuating asymmetry (FA in nine species of small mammals (Insectivora and Rodentia was estimated using 10 cranial features (foramina for nerves and blood vessels. The main criterion was the occurrence of the fluctuating asymmetry manifestations (OFAM. A total of 2300 skulls collected in the taiga and forest-tundra of Yakutia (Northeast Asia were examined. The examined species are characterized by comparable OFAM values in the vast territories of the taiga zone; on the ecological periphery of the range an increased FA level is registered. Asymmetric manifestations in analyzed features are equally likely to occur in males and females. OFAM values in juveniles are higher than in adults; this difference is more pronounced on the periphery of the geographic range. Among juveniles, lower FA levels are observed in individuals that have bred. It can be surmised that the risk of elimination of individuals with high FA levels increases in stressful periods (active reproduction and winter. In conditions that are close to optimal, populations demonstrate relatively homogeneous FA levels, while on the periphery of the area an increase in occurrence of disturbances in developmental stability is observed, which leads, on one hand, to higher average FA for the population and, on the other hand, to heterogeneity of the population in this parameter.

Revision of fleas of the genus Plocopsylla belonging to the 'angusticeps-lewisi' complex in the Andean biogeographic region, with the description of a new species.

Science.gov (United States)

Sanchez, J; Beaucournu, J-C; Lareschi, M

2015-06-01

In Argentina, the Andean biogeographic region accommodates the most diverse population of fleas in the country. The Craneopsyllinae (Siphonaptera: Stephanocircidae) represent one of the most commonly found subfamilies in this region and show some endemism and high diversity. Plocopsylla is the most diverse genus of Craneopsyllinae; it includes 10 species mainly distributed in the Patagonian subregion, which parasitize sigmodontine rodents (Rodentia: Cricetidae). We describe and illustrate the morphology of the aedeagus in species of Plocopsylla that belong to the 'angusticeps-lewisi' complex. This character is of diagnostic value in differentiating among species. A new species of this complex, Plocopsylla (Plocopsylla) linardii sp. n., is described and identified by the shape and chaetotaxy of the distal arm of sternite IX, as well as by the shape of the median dorsal lobe of the aedeagus. New host associations for this complex and range extensions for most of its species are reported. Plocopsylla (P.) silewi is recorded for the first time in Argentina. The southern limits of the distributions of Plocopsylla (P.) lewisi and Plocopsylla (P.) wilesi are extended to Santa Cruz Province. The angusticeps-lewisi complex is found for the first time in San Juan Province. The information may be useful in epidemiological studies of flea-borne diseases. © 2015 The Royal Entomological Society.

Physiologic Reference Ranges for Captive Black-Tailed Prairie Dogs (Cynomys ludovicianus)

Science.gov (United States)

Keckler, M Shannon; Gallardo-Romero, Nadia F; Langham, Gregory L; Damon, Inger K; Karem, Kevin L; Carroll, Darin S

2010-01-01

The black-tailed prairie dog (Cynomys ludovicianus) is a member of the order Rodentia and the family Sciuridae. Ecologically, prairie dogs are a keystone species in prairie ecology. This species is used as an animal model for human gallbladder disease and diseases caused by infection with Clostridium difficile, Yersinia pestis, Francisella tularensis, and most recently, Orthopoxvirus. Despite increasing numbers of prairie dogs used in research and kept as pets, few data are available on their baseline physiology in animal facility housing conditions. To establish baseline physiologic reference ranges, we designed a study using 18 wild-caught black-tailed prairie dogs. Telemetry data were analyzed to establish circadian rhythms for activity and temperature. In addition, hematologic and serum chemistry analyses were performed. Baseline measurements were used to establish the mean for each animal, which then were compiled and analyzed to determine the reference ranges. Here we present physiologic data on serum chemistry and hematology profiles, as well as weight, core body temperature, and daily activity patterns for black-tailed prairie dogs. These results reflect the use of multiple measurements from species- and age-matched prairie dogs and likely will be useful to ecologists, scientists interested in using this animal model in research, and veterinarians caring for pet prairie dogs. PMID:20587156

Terrestrial mammal fauna and habitat in environmental assessment reports of thermal and nuclear power stations

Energy Technology Data Exchange (ETDEWEB)

Yatake, Hatsuho; Nashimoto, Makoto; Chiba, Shinji [Central Research Inst. of Electric Power Industry, Abiko, Chiba (Japan). Abiko Research Lab

2000-04-01

We analyzed the geological distribution of mammals, relationships between ecological distribution of mammals and land use, and vegetation type in the 49 environmental assessment reports of thermal and nuclear power stations in the coastal area of Japan. Seven orders and 17 families of 66 terrestrial mammal species including subspecies were listed from the reports. This is about 40% of the total species of terrestrial mammals observed in Japan. Mammals were divided into 3 groups: distributed in the nationwide, in limited districts, and in limited area. The geological distributions of Insectivora, Rodentia, Chiroptera and naturalized mammals, of which have not been well known, were arranged in a topographic map at the scale of 1:50,000 in this survey. The characteristics of power station sites were classified into 4 categories as follows: Industrial site, Industrial-agricultural mixed site, Industrial-agricultural-forest mixed site, and forest site. The relationships between site categories and species compositions were analyzed. The listed species were fifteen species in the industrial site, however, there were thirty six species in the forest site. The mammal species were classified into six groups by vegetation types of habitat; forest-dwelling, grassland-dwelling, farmland and orchard-dwelling, wide-dwelling except residential area, wide-dwelling mammals including residential area, and residential area-dwelling mammals. (author)

Skeletal injuries in small mammals: a multispecies assessment of prevalence and location

Science.gov (United States)

Stephens, Ryan B.; Burke, Christopher B.; Woodman, Neal; Poland, Lily B.; Rowe, Rebecca J.

2018-01-01

Wild mammals are known to survive injuries that result in skeletal abnormalities. Quantifying and comparing skeletal injuries among species can provide insight into the factors that cause skeletal injuries and enable survival following an injury. We documented the prevalence and location of structural bone abnormalities in a community of 7 small mammal species inhabiting the White Mountains of New Hampshire. These species differ in locomotion type and levels of intraspecific aggression. Overall, the majority of injuries were to the ribs or caudal vertebrae. Incidence of skeletal injuries was highest in older animals, indicating that injuries accumulate over a lifetime. Compared to species with ambulatory locomotion, those with more specialized (semi-fossorial, saltatorial, and scansorial) locomotion exhibited fewer skeletal abnormalities in the arms and legs, which we hypothesize is a result of a lesser ability to survive limb injuries. Patterns of skeletal injuries in shrews (Soricidae) were consistent with intraspecific aggression, particularly in males, whereas skeletal injuries in rodents (Rodentia) were more likely accidental or resulting from interactions with predators. Our results demonstrate that both the incidence and pattern of skeletal injuries vary by species and suggest that the ability of an individual to survive a specific skeletal injury depends on its severity and location as well as the locomotor mode of the species involved.