WorldWideScience

Sample records for organochlorine insecticide residues

  1. Determination of the organochlorine insecticide residues in Lonicera japonica Thunb. By gas chromatography%气相色谱法测定金银花中有机氯杀虫剂残留量

    Institute of Scientific and Technical Information of China (English)

    向增旭; 赵维佳; 高山林

    2005-01-01

    Using gas chromatography (GC), the organochlorine insecticide residues were determined in Lonicera japonica Thunb. flowers. The results showed that the amount of organochlorine insecticide in L. japonica flowers collected from Fengqiu in He' nan Province, Pingyi in Shandong Province was less than 0.01 mg·kg-1. The average recoveries added in samples were 93.54% -98.85%, RSD≤6.8%. It shows that the amount of organochlorine insecticide in L. japonica flowers accords with the demands of traditional Chinese medicine production.

  2. Pollution Of Insecticide Residues In PPTN Pasar Jumat Area

    International Nuclear Information System (INIS)

    Syahrir, Ulfa T.; Chairul, Sofnie M.

    2000-01-01

    Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level

  3. Analysis the organochlorine insecticide residual quantity in traditional Chinese herbs and soil around Nanjing%南京周边地区中药材及土壤有机氯杀虫剂残留分析

    Institute of Scientific and Technical Information of China (English)

    张良; 王韶阳

    2004-01-01

    Using gas chromatography, the organochlorine insecticide residual quantity was determined in some traditional Chinese medicinal herbs and soil samples gathered from three plantations in Qixia, Jiangning and Jurong around Nanjing City of Jiangsu Province. The results show that the amount of organochlorine insecticide in all soil samples is less than 0.5mg·kg-1, and that in crude drugs of Scrophularia ningpoensis Hemsl., Isatis indigotica Fort. and Platycodon grandiflorus (Jacq.) A. DC. is less than 0.1mg·kg-1. The soil condition reached the second standard of GB 15618—1995. It suggests that Yuanxiang town in Jurong is more suitable for planting traditional Chinese medicinal herbs.

  4. Organochlorine insecticides DDT and chlordane in relation to survival following breast cancer.

    Science.gov (United States)

    Parada, Humberto; Wolff, Mary S; Engel, Lawrence S; White, Alexandra J; Eng, Sybil M; Cleveland, Rebecca J; Khankari, Nikhil K; Teitelbaum, Susan L; Neugut, Alfred I; Gammon, Marilie D

    2016-02-01

    Organochlorine insecticides have been studied extensively in relation to breast cancer incidence, and results from two meta-analyses have been null for late-life residues, possibly due to measurement error. Whether these compounds influence survival remains to be fully explored. We examined associations between organochlorine insecticides [p,p'-DDT (dichlorodiphenyltrichloroethane), its primary metabolite, p,p'-DDE, and chlordane] assessed shortly after diagnosis and survival among women with breast cancer. A population-based sample of women diagnosed with a first primary invasive or in situ breast cancer in 1996-1997 and with available organochlorine blood measures (n = 633) were followed for vital status through 2011. After follow-up of 5 and 15 years, we identified 55 and 189 deaths, of which 36 and 74, respectively, were breast cancer-related. Using Cox regression models, we estimated the multivariable-adjusted hazard ratios (HRs) and 95% confidence intervals (CIs) for lipid-adjusted organochlorine concentrations with all-cause and breast cancer-specific mortality. At 5 years after diagnosis, the highest tertile of DDT concentration was associated with all-cause (HR = 2.19; 95% CI: 1.02, 4.67) and breast cancer-specific (HR = 2.72; 95% CI: 1.04, 7.13) mortality. At 15 years, middle tertile concentrations of DDT (HR = 1.42; 95% CI 0.99, 2.06) and chlordane (HR = 1.42; 95% CI: 0.94, 2.12) were modestly associated with all-cause and breast cancer-specific mortality. Third tertile DDE concentrations were inversely associated with 15-year all-cause mortality (HR = 0.66; 95% CI: 0.44, 0.99). This is the first population-based study in the United States to show that DDT may adversely impact survival following breast cancer diagnosis. Further studies are warranted given the high breast cancer burden and the ubiquity of these chemicals. © 2015 UICC.

  5. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  6. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    OpenAIRE

    D.C. Pathak

    2011-01-01

    Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei) in Chakrashila Wildlife Sanctuary (CWS) in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pu...

  7. Organochlorine residues in bat guano from nine Mexican caves, 1991

    Science.gov (United States)

    Clark, D.R.; Moreno-Valdez, A.; Mora, M.A.

    1995-01-01

    Samples of bat guano, primarily from Mexican free-tailed bats (Tadarida brasiliensis), were collected at nine bat roosts in caves in northern and eastern Mexico and analysed for organochlorine residues. DDE, the most abundant residue found in each cave, was highest (0.99 p.p.m. dry weight) at Ojuela Cave, Durango. Other studies of DDE in bat guano indicate that this concentration is too low to reflect harmful concentrations in the bats themselves. The DDE at Ojuela may represent either lingering residues from use of DDT years ago in the Ojuela area of perhaps depuration loss from migrant bats with summer maternity roost(s) in a DDE-contaminated area such as Carlsbad Cavern, New Mexico. Presence of o,p-DDT at Tio Bartolo Cave, Nuevo Leon, indicates recent use of DDT, but the concentration of this contaminant was low. Possible impacts on bat colonies of the organophosphorus and carbamate insecticides now in extensive use are unknown.

  8. Distribution of 19 organochlorinated pesticides residues in ginseng ...

    African Journals Online (AJOL)

    The organochlorinated pesticides widely applied and still remains in soils, has become toxic to ginseng production in Jilin Province. In this study, 19 trace organochlorinated pesticide residues in five types of ginseng products and soil samples from four ginseng production areas were analyzed using a gas ...

  9. Bioaccumulation and distribution of organochlorine residues across ...

    African Journals Online (AJOL)

    Eighteen organochlorine pesticide (OCP) residues were measured in the water, sediment, plankton, benthic invertebrates and fish in various sections of the Lagos Lagoon in 2014 to investigate their bioaccumulation and distribution in the food web. The analysis was done using gas chromatography with an electron capture ...

  10. Organochlorine pesticide residues in the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Shailaja, M.S.; Sarkar, A.

    periodic monitoring of the levels of the major pollutants. One on-going exercise has been to evaluate, qualitatively and quantitatively, the persistent organochlorine pesticide residues in the Northern Indian Ocean. The baseline levels of some...

  11. Study of Organochlorinated Pesticide Residues and Polychlorinated Biphenyls in Soil Samples

    Directory of Open Access Journals (Sweden)

    MSc. Vlora Gashi

    2013-12-01

    Full Text Available This paper presents and discusses the data obtained for organochlorinated pesticides and their residues in the soil samples of agricultural areas. Soil contamination is one of most important factors influencing the quality of agricultural products. Usage of heavy farm equipment, the land drainage, an exces­sive application of agrochemicals, emissions originating from mining, metallurgical, and chemical and coal power plants and transport, all generate a number of undesired substances (nitric and sulphur oxides, PAHs, heavy metals, pesticides, which after deposition in soil may influence crop quality. Thus, input of these contaminants into the environment should be carefully monitored. Levels of organochlorinated pesticides contamination were evaluated in agriculture areas that are in use. 10 soil samples were taken in agricultural areas  Plane of  Dugagjini , Kosovo. Representa­tive soil samples were collected from 0-30 cm top layer of the soil. In the analytical method we combined ultrasonic bath extraction and a Florisil column for samples clean-up. The analysis of the organochlorinated pesticides in soil samples was performed by gas chromatography technique using electron capture detector (GC/ECD. Optima-5 (low/mid polarity, 5% phenyl methyl siloxane 60 m x 0.33 mm x 0.25μm film capillary column was used for isolation and determination of organochlorinated pesticides. Low concentrations of organochlorinated pesticide and their metabolites were found in the studied samples. The presence of organochlorinated pesticides and their residues is probably resulting of their previous uses for agricultural purposes.

  12. Levels of organochlorine pesticide residue in grasscutter (Thryonomys swinderianus) tissues

    International Nuclear Information System (INIS)

    Blankson-Arthur, S.

    2009-06-01

    Organochlorine pesticide residues have been determined in the muscle, liver and kidney tissues from a total of 45 grasscutter (Thryonomys swinderianus) meat samples obtained from the Gomoa district, a vegetable farming area in the Central Region of Ghana. All samples were analyzed for their residue content of the following organochlorine pesticides; DDT, DDE, hexachlorocyclohexane isomers, lindane (γ-HCH) and δ-HCH, dieldrin, aldrin, endrin, endrin aldehyde, endrin ketone, alpha endosulfan, endosulfan sulfate, chlordane, heptachlor and methoxychlor. The results indicated that all the analyzed samples were contaminated with the studied organochlorine pesticides. Aldrin and heptachlor were the principal contaminants in all the samples. The muscle had the highest pollutant load. All organochlorine pesticides investigated were detected in the muscle tissues of the grasscutter at the following mean concentrations; aldrin 1.833μg /kg, heptachlor 0.695μg /kg, γ-HCH 0.283μg /kg, δ-HCH 0.108μg /kg, dieldrin 0.040 μg /kg, p,p'-DDT 0.019μg /kg. p,p'-DDE 0.014μg /kg, endrin 0.018μg /kg, endrin aldehyde 0.090μg /kg, endrin ketone 0.340μg /kg, α-endosulfan 0.162μg /kg, endosulfan sulfate 0.183μg /kg, gamma-chlordane 0.174μg /kg and methoxychlor 0.101μg /kg wet weight. The organochlorine pesticide residues were detected in the liver tissues at the following mean concentrations; aldrin 1.315μg /kg, heptachlor 0.530μg /kg, dieldrin 0.050μg /kg, γ-HCH 0.233μg /kg, δ-HCH 0.070μg /kg, p,p'-DDT 0.123μg /kg. p,p'-DDE 0.043μg /kg endrin aldehyde 0.110μg /kg, endrin ketone 0.115μg /kg, gamma-chlordane 0.093μg /kg and methoxychlor 0.128μg /kg wet weight. No endrin was however detected in the liver. The highest concentrations of γ-HCH, δ-HCH, endrin ketone and endrin aldehyde were measured in the kidney. The mean concentrations of γ-HCH and δ-HCH in the kidney were 0.435μg /kg and 0.107μg /kg respectively. Endrin aldehyde was detected at 0.135μg /kg in

  13. Persistent organochlorine pesticides in blood serum and whole blood

    Energy Technology Data Exchange (ETDEWEB)

    Waliszewski, S.M. (Univ. of Veracruz, (Mexico)); Szymczynski, G.A. (Medical Academy, Bydgoszcz (Poland))

    1991-06-01

    Since organochlorine pesticides were introduced for plant protection and sanitation, they have been of great benefit in the control of pest populations and in combating the spread of infectious diseases. Unfortunately, they accumulate in the environment and this has resulted in a ban on their use. Nevertheless, they are still widely used in tropical countries as the insecticides of choice. An analytical procedure was elaborated to find out the extent of contamination of the human body by persistent residues of organochlorine pesticides and to determine the gradient between adipose tissue and biological fluids, which correlates with bioaccumulation and dissipation processes. The method has two important advantages: it is a simple, low-cost semi-micro, and it makes it possible to determine free and bound pesticides.

  14. Residues of organochlorine pesticides in surface soil and raw foods from rural areas of the Republic of Tajikistan

    Science.gov (United States)

    The central Asian Republic of Tajikistan has been an area of extensive historical agricultural pesticide use as well as large scale burials of obsolete banned chlorinated insecticides. The current investigation was a four year study of legacy organochlorine pesticides in surface ...

  15. Influence of organic acids and organochlorinated insecticides on metabolism of Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Pejin Dušanka J.

    2005-01-01

    Full Text Available Saccharomyces cerevisiae is exposed to different stress factors during the production: osmotic, temperature, oxidative. The response to these stresses is the adaptive mechanism of cells. The raw materials Saccharomyces cerevisiae is produced from, contain metabolism products of present microorganisms and protective agents used during the growth of sugar beet for example the influence of acetic and butyric acid and organochlorinated insecticides, lindan and heptachlor, on the metabolism of Saccharomyces cerevisiae was investigated and presented in this work. The mentioned compounds affect negatively the specific growth rate, yield, content of proteins, phosphorus, total ribonucleic acids. These compounds influence the increase of trechalose and glycogen content in the Saccharomyces cerevisiae cells.

  16. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  17. Assessment of organochlorine pesticide residues in Atlantic Rain Forest fragments, Rio de Janeiro, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Soares Quinete, Natalia, E-mail: nataliaquinete@yahoo.com.br [Instituto Nacional de Tecnologia, Departamento de Quimica Analitica, Laboratorio de Quimica Analitica e Metrologia em Quimica, Av. Venezuela, 82 - Rio de Janeiro, RJ 20081-312 (Brazil); Santos de Oliveira, Elba dos [Instituto Nacional de Tecnologia, Departamento de Energia, Av. Venezuela, 82 - Rio de Janeiro, RJ 20081-312 (Brazil); Fernandes, Daniella R. [Universidade Federal do Rio de Janeiro, Instituto de Quimica, Departamento de Quimica Analitica, CT - Bloco A, Cidade Universitaria, 21941-909 - Rio de Janeiro (Brazil); Souza Avelar, Andre de [Universidade Federal do Rio de Janeiro, Departamento de Geografia, Instituto de Geociencias, CCMN, Bloco F, Cidade Universitaria, 21941-919 - Rio de Janeiro (Brazil); Erthal Santelli, Ricardo [Universidade Federal do Rio de Janeiro, Instituto de Quimica, Departamento de Quimica Analitica, CT - Bloco A, Cidade Universitaria, 21941-909 - Rio de Janeiro (Brazil)

    2011-12-15

    A superficial water quality survey in a watershed of the Paraiba do Sul River, the main water supply for the most populated cities of southeastern Brazil, was held in order to assess the impact of the expansion of agricultural activity in the near border of the Atlantic Rain Forest. The aim of this study was to investigate the presence of priority organochlorine pollutants in soils and superficial waters of Atlantic rainforest fragments in Teresopolis, Rio de Janeiro State. Soil sample preparations were compared by using ultrasound, microwave assisted extraction and Soxhlet extraction. Recoveries of matrix spiked samples ranged from 70 to 130%. Analysis of a certified soil material showed recoveries ranging from 71 to 234%. Although low concentrations of organochlorine residues were found in water and soil samples, this area is of environmental importance and concern, thus demanding a monitoring program of its compartments. - Highlights: > The organochlorine pollutants occurrence in the Atlantic Rain Forest was investigated. > PARNASO was considered a control area of environmental quality. > Extractions methods were compared for typical C-rich soils samples from Brazil. > Low concentrations of organochlorine residues were found in water and soil samples. > A monitoring program is demanded due to the environmental importance of the area. - The occurrence of organochlorine pollutants in soils of the Atlantic rainforest fragments in Rio de Janeiro, Brazil demands a monitoring program of its compartments.

  18. Residues levels of organochlorine pesticide in cow's milk from industrial farms in Hidalgo, Mexico.

    Science.gov (United States)

    Gutierrez, Rey; Ortiz, Rutilio; Vega, Salvador; Schettino, Beatriz; Ramirez, Maria L; Perez, Jose J

    2013-01-01

    A survey was carried out from 2008 to 2010 to determine the concentrations of 16 organochlorine pesticide residues (OPRs) from Tizayuca, Hidalgo, Mexico. Organochlorine residue determinations were made from milk fat, using chromatographic cleanup and analysis by gas chromatography with an electron capture detector. The OPR concentrations found were from below the detection limit (DL) to 0.91 ng g(-1) in 2008, DL to 0.38 ng g(-1) in 2009 and DL to 0.59 ng g(-1) in 2010. In general concentrations of organochlorine pesticides were higher in the wet season (3.37 ng g(-1) and 4.79 ng g(-1)) than the dry season (1.92 ng g(-1) and 2.71 ng g(-1)) for 2009 and 2010, due to control of pests in the pasture and sheds. According to Codex Alimentarius regulations, individual pesticides did not exceed the permissible limits, which for example were 10 μg kg(-)1 for alpha hexachlorocyclohexane (HCH) and endosulfan I, 20 μg kg(-1) for p,p'-DDT, and 6 μg kg(-1) for dieldrin, endrin and heptachlor. A reduction of organochlorine pesticide concentrations in cow's milk was noted, indicating that the Mexican government has achieved reduction or elimination of some organochlorine pesticides in response to global agreements on persistent organic pollutants.

  19. Assessment of organochlorine pesticide residues in Atlantic Rain Forest fragments, Rio de Janeiro, Brazil

    International Nuclear Information System (INIS)

    Soares Quinete, Natalia; Santos de Oliveira, Elba dos; Fernandes, Daniella R.; Souza Avelar, Andre de; Erthal Santelli, Ricardo

    2011-01-01

    A superficial water quality survey in a watershed of the Paraiba do Sul River, the main water supply for the most populated cities of southeastern Brazil, was held in order to assess the impact of the expansion of agricultural activity in the near border of the Atlantic Rain Forest. The aim of this study was to investigate the presence of priority organochlorine pollutants in soils and superficial waters of Atlantic rainforest fragments in Teresopolis, Rio de Janeiro State. Soil sample preparations were compared by using ultrasound, microwave assisted extraction and Soxhlet extraction. Recoveries of matrix spiked samples ranged from 70 to 130%. Analysis of a certified soil material showed recoveries ranging from 71 to 234%. Although low concentrations of organochlorine residues were found in water and soil samples, this area is of environmental importance and concern, thus demanding a monitoring program of its compartments. - Highlights: → The organochlorine pollutants occurrence in the Atlantic Rain Forest was investigated. → PARNASO was considered a control area of environmental quality. → Extractions methods were compared for typical C-rich soils samples from Brazil. → Low concentrations of organochlorine residues were found in water and soil samples. → A monitoring program is demanded due to the environmental importance of the area. - The occurrence of organochlorine pollutants in soils of the Atlantic rainforest fragments in Rio de Janeiro, Brazil demands a monitoring program of its compartments.

  20. Identification of insecticide residues with a conducting-polymer electronic nose

    Science.gov (United States)

    A.D. Wilson

    2014-01-01

    The identification of insecticide residues on crop foliage is needed to make periodic pest management decisions. Electronic-nose (e-nose) methods were developed and tested as a means of acquiring rapid identifications of insecticide residue types at relatively low cost by detection of headspace volatiles released from inert surfaces in vitro. Detection methods were...

  1. Dermal insecticide residues from birds inhabiting an orchard

    Science.gov (United States)

    Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.

    2007-01-01

    The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.

  2. Organochlorine Pesticides Residues in Human Breast Milk from the Middle Governorates in Jordan in 2013/2014.

    Science.gov (United States)

    Al Antary, Tawfiq M; Alawi, Mahmoud A; Estityah, Hussein; Haddad, Nizar

    2017-07-01

    One hundred samples of mother breast milk were gathered from six middle governorates and districts in Jordan in 2013/2014 to monitor Organochlorine pesticides pollutants. The results showed clearly that banned organochlorine pesticides are still detected in the monitored samples in low concentration despite banning of these persistent pollutants in Jordan since 36 years ago. However, the results indicated that 1% of the contaminated samples contained β-HCH, 5% γ-HCH, 3% p,p'-DDD, 2% heptachlor, 45% p,p'-DDE and 3% p,p'-DDT. In addition, these monitored samples had no residues of aldrin, dieldrin, α-endosulfan, β-endosulfan, HCB, o,p'-DD, o,p'-DDT and o,p'-DDE. In conclusion, there was a decline in the residues of Organochlorine pesticides, particularly DDT group members.

  3. Screening of organochlorine insecticides (DDT and heptachlor in dry fish available in Bangladesh

    Directory of Open Access Journals (Sweden)

    Md. Nurul Huda Bhuiyan

    2008-06-01

    Full Text Available The concentrations of organochlorine insecticides DDT and heptachlor were investigated to estimate the current status of insecticides used in dry fish. The most popular dry fish– ribbon fish (Chhuri, shrimp (Chingri and bombay duck (Loittya were selected for this study and these dry fishes were collected from different markets of Dhaka and Chittagong. The range of DDT used in all the samples was 3.038 ppb to 874.966 ppb. The range of DDT in ribbon fish 131.611 ppb to 149.430 ppb, in shrimp 3.038 ppb to 318.206 ppb and in bombay duck 61.918 ppb to 874.966 ppb was found. The range of heptachlor used in all the samples was 0.682 ppb to 5.464 ppb. The range of heptachlor in ribbon fish 1.710 ppb to 2.306 ppb, in shrimp 0.682 ppb to 3.806 ppb and in bombay duck 1.762 ppb to 5.464 ppb was found. The heptachlor was not found in ribbon fish (CTG-2, shrimp (DHK-2 and CTG-1 and bombay duck (DHK-1. The concentration of heptachlor in dry fish compare to DDT was found too much less.

  4. Organochlorine insecticides (DDT and heptachlor in dry fish: Traditional washing and cooking effect on dietary intake

    Directory of Open Access Journals (Sweden)

    Matiur Rahim

    2009-06-01

    Full Text Available The concentrations of organochlorine insecticides (DDT and heptachlor were investigated to estimate the effect of various washing and boiling/cooking to elucidate the concentration level we intake actually. For this study five most popular dry fish samples namely bombay duck (loittya, ribbon fish (chhuri, shrimp (chingri, chinese pomfret (rupchanda and Indian salmon (lakhua were analyzed. The highest concentrations of DDT and heptachlor were found 737.238 ppb (Indian salmon, normal and 44.806 ppb (shrimp, normal respectively; after boiling treatment a big amount was washed out and remained only 135.516 ppb and 16.868 ppb respectively. Boiling treatment was found more effective than the others.

  5. Organochlorine insecticides (DDT and heptachlor in dry fish: traditional washing and cooking effect on dietary intake

    Directory of Open Access Journals (Sweden)

    MD. Nurul Huda Bhuiyan

    2009-03-01

    Full Text Available The concentrations of organochlorine insecticides (DDT and heptachlor were investigated to estimate the effect of various washing and boiling/cooking to elucidate the concentration level we intake actually. For this study five most popular dry fish samples namely bombay duck (loittya, ribbon fish (chhuri, shrimp (chingri, chinese pomfret (rupchanda and Indian salmon (lakhua were analyzed. The highest concentrations of DDT and heptachlor were found 737.238 ppb (Indian salmon, normal and 44.806 ppb (shrimp, normal respectively; after boiling treatment a big amount was washed out and remained only 135.516 ppb and 16.868 ppb respectively. Boiling treatment was found more effective than the others.

  6. Preliminary studies on the effect of organochlorine pesticides on birds in Tanzania

    International Nuclear Information System (INIS)

    Ijani, A.S.M.; Katondo, J.M.; Malulu, J.M.

    1997-01-01

    Preliminary studies to investigate the effects of organochlorine pesticides on birds was conducted in Lower Moshi, NAFCO West Kilimanjaro, Arusha seed farm, Tropical Pesticides Research Institute (TPRI) farms, Manyara ranch and areas around Lake Victoria as well as in the TPRI laboratory in Tanzania. Large quantities of the pesticides particularly DDT, endosulfan, dieldrin, lindane and toxaphene are still being applied against pests of cotton, coffee, maize, beans and other crops as well as disease vectors in the country. Several groups of birds including waterbirds, African Fish Eagles, Marabou storks, Oxpecker, ducks, etc. were found feeding, roosting and swimming in the water and exposed to other substances that were contaminated with organochlorine pesticides and were presumably at risk. Analytical results from the tissues of the African Fish Eagles collected from Lake Victoria areas showed that the kidneys were contaminated with p,p' DDE and o,p' DDE at levels of 0.4 ng g -1 and 1.45 ng g -1 respectively. These organochlorine insecticides as well as β-HCH were also present in the brain and liver tissues. The levels of the organochlorine residues were well below the lethal and sublethal levels for bird raptors reported in the literature. (author). 7 refs, 2 tabs

  7. Identification and level of organochlorine insecticide contamination in groundwater and iridology analysis for people in Upper Citarum cascade

    Science.gov (United States)

    Oginawati, K.; Pratama, M. A.

    2016-03-01

    Organochlorines are the main pollutants in the class of persistent organic pollutants which are types of pollutants that are being questioned worldwide due to chronic persistence, toxicity and bioaccumulation. Human around the Citarum River are still using groundwater as a drinking source. It is very risky for people health that consume groundwater because in 2009 the application of organochlorine still found in the Upper Citarum watershed rice field and had potential to contaminate groundwater. Groundwater was analyzed with nine species belonging to the organochlorine pollutants Organic Peristent types. 7 types of organochlorinesAldrin was detected with an average concentration of 0.09 ppb, dieldrin with an average concentration of 24 ppb, heptaklor with an average concentration of 0.51 ppb, with concentrations of endosulfan on average 0.73 ppb, DDT with average concentration of 0.13 ppb, Lindan with an average concentration of 1.2 ppb, endrin with an average concentration of 0.03 ppb. Types with the highest concentration of organochlorine a lindan and endosulfan. Residues of aldrin, dieldrin and heptaklor in groundwater already exceeds the quality standards for drinking water Permenkes 492/2010. Based on the iridology analysis obtained several systems are expected to nervous, immune and reproductive system disorders and toxin deposits under the skin.

  8. Identification and level of organochlorine insecticide contamination in groundwater and iridology analysis for people in Upper Citarum cascade

    International Nuclear Information System (INIS)

    Oginawati, K; Pratama, M A

    2016-01-01

    Organochlorines are the main pollutants in the class of persistent organic pollutants which are types of pollutants that are being questioned worldwide due to chronic persistence, toxicity and bioaccumulation. Human around the Citarum River are still using groundwater as a drinking source. It is very risky for people health that consume groundwater because in 2009 the application of organochlorine still found in the Upper Citarum watershed rice field and had potential to contaminate groundwater. Groundwater was analyzed with nine species belonging to the organochlorine pollutants Organic Peristent types. 7 types of organochlorinesAldrin was detected with an average concentration of 0.09 ppb, dieldrin with an average concentration of 24 ppb, heptaklor with an average concentration of 0.51 ppb, with concentrations of endosulfan on average 0.73 ppb, DDT with average concentration of 0.13 ppb, Lindan with an average concentration of 1.2 ppb, endrin with an average concentration of 0.03 ppb. Types with the highest concentration of organochlorine a lindan and endosulfan. Residues of aldrin, dieldrin and heptaklor in groundwater already exceeds the quality standards for drinking water Permenkes 492/2010. Based on the iridology analysis obtained several systems are expected to nervous, immune and reproductive system disorders and toxin deposits under the skin. (paper)

  9. Insecticide residue monitoring in sediments water fish and mangroves at the Cimanuk Delta

    International Nuclear Information System (INIS)

    Sumatra, Made

    1982-01-01

    The water and sediments from the upper stream of Cimanuk river carry insecticide residues especially during the rainy season. The insecticides are deposited in the estuary of Cimanuk river and along the coast of Cimanuk delta. The insecticide residues found at the delta were diazinon thiodan DDE o p-DDT and p p-DDT. Those insecticides are found in most of the water sediments and mangrove leaves samples and some of fishes samples. The samples were taken from the river the estuary the sea, the tambaks, the coast line, and from paddy field. No insecticide residue is found in the water samples taken in the dry season but they are found in the sediment samples taken in both the dry and rainy season. Generally the diazinon residues are higher at the surface than at 0.5m depth in compact sediment but they are higher at 0.5m depth than at the surface of the mud from the coast line. Diazinon and thiodan are found only in three fish samples out of twenty samples analyzed but thiodan is found in almost all of the sediment and mangrove leaves samples. DDT is found in almost all of the samples analyzed. (author)

  10. Persistent Organochlorine Pesticide Residues in Some Selected Cocoa Beverages in Nigeria

    Directory of Open Access Journals (Sweden)

    Olayinka A. Ibigbami

    2017-12-01

    Full Text Available This study evaluates the quality of the cocoa beverages produced in Nigeria with respect to the occurrence and levels of organochlorine pesticides OCPs residues in order to ascertain the potential health risks to the general public. Seven cocoa-based beverages were analysed for 17 OCP residues using gas chromatography coupled with an Electron Captured Detector (GC-ECD after extraction and silica-gel clean-up. The study reveals the presence of ten OCP residues in the cocoa beverages, with a concentration range from not detected ND—0.256 mg/kg, while α-BHC, β-BHC, methoxychlor, p,p′-DDE, dieldrin, endrin aldehyde, and endosulfan sulphate were not detected in any of the analysed samples. The contamination pattern of OCPs in the beverages was in the following order: Ovaltine > Milo > Cadbury-choco > Bournvita > Cowbell-coffee > Richoco > Oluji, with p,p′-DDT being the most frequently found pesticide. Heptachlor and endosulfan II showeda residual level above the European Union (EU Maximum Residual Limits (MRLs in only one sample.

  11. Control of Malaria Vector Mosquitoes by Insecticide-Treated Combinations of Window Screens and Eave Baffles.

    Science.gov (United States)

    Killeen, Gerry F; Masalu, John P; Chinula, Dingani; Fotakis, Emmanouil A; Kavishe, Deogratius R; Malone, David; Okumu, Fredros

    2017-05-01

    We assessed window screens and eave baffles (WSEBs), which enable mosquitoes to enter but not exit houses, as an alternative to indoor residual spraying (IRS) for malaria vector control. WSEBs treated with water, the pyrethroid lambda-cyhalothrin, or the organophosphate pirimiphos-methyl, with and without a binding agent for increasing insecticide persistence on netting, were compared with IRS in experimental huts. Compared with IRS containing the same insecticide, WSEBs killed similar proportions of Anopheles funestus mosquitoes that were resistant to pyrethroids, carbamates and organochlorines and greater proportions of pyrethroid-resistant, early exiting An. arabiensis mosquitoes. WSEBs with pirimiphos-methyl killed greater proportions of both vectors than lambda-cyhalothrin or lambda-cyhalothrin plus pirimiphos-methyl and were equally efficacious when combined with binding agent. WSEBs required far less insecticide than IRS, and binding agents might enhance durability. WSEBs might enable affordable deployment of insecticide combinations to mitigate against physiologic insecticide resistance and improve control of behaviorally resistant, early exiting vectors.

  12. EFEKTIVITAS INSEKTISIDA ORGANOCHLORIN OMS-1558 DALAM PENGENDALIAN VEKTOR MALARIA ANOPHELES ACONITUS DONITZ YANG SUDAH KEBAL TERHADAP DDT

    Directory of Open Access Journals (Sweden)

    Barodji Barodji

    2012-09-01

    Full Text Available A village-scale trial of organochlorin compound OMS-1558 as an 70% water-dispersible powder (wdp and applied as an indoor residual spray at 2 gr/m2, was carried out against the DDT—resistant malaria vector Anopheles aconitus near Semarang, Central Java. Result of this trial, as evaluated by human-vector contact rates, resting densities and parous rate showed effectiveness against the vector populations for only about one week or less. In contact bioassay tests mortalities of 50% or greater for one week, while mortalities from air-borne bioassay tests were negligible. It was concluded that DDT—resistant malaria vector can not be controlled by this insecticide. The result of susceptibility tests showed there is cross resistance between DDT and new organochlorin OMS-1558.

  13. Influence of γ-Ray on Residues Dimethoate Insecticides in Tomato (Lycopersicum Esculentum Mill.)

    International Nuclear Information System (INIS)

    Sofnie M Chairul; Elida Djabir; I Wayan Reja; Yusleha Yusuf

    2004-01-01

    The investigation of γ-ray influence on residues dimethoate insecticides in tomato, was carried out. Tomatoes were soaked into solution of dimethoate insecticides, at concentration of 100; 200; 300; and 400 ppm for 3 minutes. Then the tomatoes were dried at room temperature, after, drying the tomatoes were packed using aluminium foil, and kept for 1 week. Pack, of tomatoes the irradiated with γ-ray at 0; 0.5; 1.0; and 1.5 kGy dose. The residues of insecticide dimethoate was determined by extracting of tomatoes using ethyl acetate solvent and analyzed by Chromatography Gas using Flame Photo Detector. The result showed that dimethoate insecticide residues decreased from 9.74 ppm - 30.56 ppm ranges to become 0.0096 ppm-0.0294 ppm at irradiation of 0.5 kGy dose; 0.0049 ppm - 0.0202 ppm at irradiation of 1.0 kGy; 0.0072 ppm - 0.0152 ppm at irradiation of 1.5 kGy dose, while due a 7 days storage a decrease of only 8.24 ppm - 24.19 ppm occurred. (author)

  14. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  15. Residues of organochlorine pesticides in fish, crab and sediment from El Temsah Lake, Suez Canal, Egypt and their effect on mitochondrial ATPase of the New Zealand white rabbit.

    Science.gov (United States)

    Ahmed, M T; Ismail, S M

    1991-01-01

    Residues of organochlorine pesticides were monitored in the muscles of Bolti fish Tilapia zillii, the crab Lupa pelagicus and sediment samples collected from El Temsah lake around Ismailia using gas liquid chromatography. The beta isomer of hexachlorocyclohexane (beta.HCH) was the most dominant compound detected in all samples, followed by P, P-DDE and P, P-DDT. Results showed the crab to contain higher concentrations of organochlorine in comparison to concentrations detected in fish muscles. The In-vitro effect of the residues extracted from fish, and crab on the mitochondrial brain and liver ATPase of the New Zealand white rabbit Orcytolagus cuniculus was also studied. Residues of organochlorine pesticides have induced activation in the ATPase enzyme system of both brain and liver. The mixtures of organochlorine residues of both fish and crab were able to activate liver ATPase more than brain ATPase. The present study was conducted to extrapolate possible effects incurred on man if consumed such food.

  16. Environmental insecticide residues from tsetse fly control measures in Uganda

    International Nuclear Information System (INIS)

    Sserunjoji-Sebalija, J.

    1976-01-01

    Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)

  17. Determination of insecticides malathion and lambda-cyhalothrin residues in zucchini by gas chromatography

    OpenAIRE

    Lofty, Hayam M.; Abd El-Aleem, Abd El-Aziz A.; Monir, Hany H.

    2013-01-01

    A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin) insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticide...

  18. Organic amendments for risk mitigation of organochlorine pesticide residues in old orchard soils

    International Nuclear Information System (INIS)

    Centofanti, Tiziana; McConnell, Laura L.; Chaney, Rufus L.; Beyer, W. Nelson; Andrade, Natasha A.; Hapeman, Cathleen J.; Torrents, Alba; Nguyen, Anh; Anderson, Marya O.; Novak, Jeffrey M.

    2016-01-01

    Performance of compost and biochar amendments for in situ risk mitigation of aged DDT, DDE and dieldrin residues in an old orchard soil was examined. The change in bioavailability of pesticide residues to Lumbricus terrestris L. relative to the unamended control soil was assessed using 4-L soil microcosms with and without plant cover in a 48-day experiment. The use of aged dairy manure compost and biosolids compost was found to be effective, especially in the planted treatments, at lowering the bioavailability factor (BAF) by 18–39%; however, BAF results for DDT in the unplanted soil treatments were unaffected or increased. The pine chip biochar utilized in this experiment was ineffective at lower the BAF of pesticides in the soil. The US EPA Soil Screening Level approach was used with our measured values. Addition of 10% of the aged dairy manure compost reduced the average hazard quotient values to below 1.0 for DDT + DDE and dieldrin. Results indicate this sustainable approach is appropriate to minimize risks to wildlife in areas of marginal organochlorine pesticide contamination. Application of this remediation approach has potential for use internationally in areas where historical pesticide contamination of soils remains a threat to wildlife populations. - Highlights: • Historical applications of organochlorine pesticides are a risk to local ecosystems. • Low cost and sustainable mitigation measures are needed to reduce risks. • Organic matter rich amendments were added to contaminated soil. • Earthworms microcosms were used to measure bioaccumulation factors. • Aged composts were most effective at mitigating risks to ecosystems. - Incorporation of aged dairy manure and biosolids compost amendments is an effective, low cost approach to mitigate risks to terrestrial wildlife from organochlorine pesticides in soils.

  19. Relative toxicity and residual activity of insecticides used in blueberry pest management: mortality of natural enemies.

    Science.gov (United States)

    Roubos, Craig R; Rodriguez-Saona, Cesar; Holdcraft, Robert; Mason, Keith S; Isaacs, Rufus

    2014-02-01

    A series of bioassays were conducted to determine the relative toxicities and residual activities of insecticides labeled for use in blueberry (Vaccinium corymbosum L.) on natural enemies, to identify products with low toxicity or short duration effects on biological control agents. In total, 14 insecticides were evaluated using treated petri dishes and four commercially available natural enemies (Aphidius colemani Viereck, Orius insidiosus [Say], Chrysoperla rufilabris [Burmeister], and Hippodamia convergens [Guérin-Menéville]). Dishes were aged under greenhouse conditions for 0, 3, 7, or 14 d before introducing insects to test residual activity. Acute effects (combined mortality and knockdown) varied by insecticide, residue age, and natural enemy species. Broad-spectrum insecticides caused high mortality to all biocontrol agents, whereas products approved for use in organic agriculture had little effect. The reduced-risk insecticide acetamiprid consistently caused significant acute effects, even after aging for 14 d. Methoxyfenozide, novaluron, and chlorantraniliprole, which also are classified as reduced-risk insecticides, had low toxicity, and along with the organic products could be compatible with biological control. This study provides information to guide blueberry growers in their selection of insecticides. Further research will be needed to determine whether adoption of a pest management program based on the use of more selective insecticides will result in higher levels of biological control in blueberry.

  20. Determination of insecticides malathion and lambda-cyhalothrin residues in zucchini by gas chromatography

    Directory of Open Access Journals (Sweden)

    Hayam M. Lofty

    2013-12-01

    Full Text Available A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticides. The method was applied to determine residues and the rate of disappearance of malathion and λ-cyhalothrin from fruits of zucchini (open field treatment, 50 cc of Malason/Cormandel 57% EC (emulsifiable concentrate for 100 L of water, 20 cc of LAMBDA SUPER FOG 5% liquid for 100 L of water. The insecticide incorporated into the plants decreased rapidly with a half-life time around 0.77 day (18.5h for malathion and 4 days for λ-cyhalothrin. It is not recommended to use zucchini before 12 h of malathion application. For λ-cyhalothrin, the preharvest interval is 5 days. Four market samples were chosen from different regions from A.R.E. and all of them showed no residues of malathion or λ-cyhalothrin.

  1. Pesticide residues and microbial contamination of water resources in the MUDA rice agroecosystem

    International Nuclear Information System (INIS)

    Cheah Uan Boh; Lum Keng Yeang

    2002-01-01

    Studies on the water resources of the Muda rice growing areas revealed evidence of pesticide residues in the agroecosystem. While the cyclodiene endosulfan was found as a ubiquitous contaminant, the occurrence of other organochlorine insecticides was sporadic. The presence of 2,4-D, paraquat and molinate residues was also evident but the occurrence of these herbicides was seasonal. Residue levels of molinate were generally higher than those from the other herbicides. The problem of thiobencarb and carbofuran residues was not encountered. Analyses for microbial contamination revealed that the water resources were unfit for drinking; coliform counts were higher during certain periods of the year than others. (Author)

  2. Levels of organochlorine pesticides residues in human adipose tissue, data from Tabasco, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Rodríguez Díaz, S S; Saldarriaga-Noreña, H; Meza, E; Zepeda, R; Infanzón, R

    2012-11-01

    The objective of this study was to determine the levels of organochlorine pesticides HCB, α-β-γ-HCH, p,p'-DDE, o,p'-DDT and p,p'-DDT in 150 adipose tissue of inhabitants of Tabasco, Mexico. The following pesticides were detected: p,p'-DDE in 100% of samples at mean 1.034 mg/kg; p,p'-DDT in 96.7% at mean 0.116 mg/kg; o,p'-DDT in 78.7% at mean 0.022 mg/kg and β-HCH in 58.0% at mean 0.049 mg/kg. The pooled sample was divided according to sex of donors (75 female and 75 male). Significantly higher levels of all organochlorine pesticides in females were found. The sample was divided into three age's ranges (15-28, 29-45 and 46-84 years). The mean and median levels of β-HCH, p,p'-DDE and Σ-DDT increase significantly (p pesticide residues in Tabasco inhabitants is still observed, indicating sources of exposure to the pesticides.

  3. Studies on organochlorine pesticide residues in human breast milk of primparae mothers from selected areas in the Greater Accra Region

    International Nuclear Information System (INIS)

    Osei Tutu, A.

    2009-06-01

    A study was conducted to determine the types and levels of organochlorine pesticide residuals in the human milk samples of 42 nursing mothers from Ada and Accra. The milk samples were analyzed for 14 different organochlorine pesticides residue (Aldrin, Dieldrin, p,p'-DDT, p,p'-DDE, Endrin, Endrin Aldehyde, Endrin Ketone, Endosulphan sulfate,' Alpha Endosulphan, Gamma-HCH, Delta-HCH, Gamma Chlordane, Heptachlor and Methoxychlor) using Gas chromatography with electron capture detector. The mean concentrations for the organochlorine pesticide residues detected in the human milk samples from Accra are; Gamma-HCH (4.207µg/kg fat), Delta-HCH (13.855µg/kg fat), Heptachlor (11.791µg/kg fat), Aldrin (2.962µg/kg fat), Gamma- Chlordane (1.839µg/kg fat), Alpha-Endosulfan (4.740µg/kg fat), p,p'-DDE (23.367µg/kg fat), Dieldrin (2.407µg/kg fat), p,p'-DDT (3.085µg/kg fat), Endrin (7.669µg/kg fat), Endrin Aldehyde (7.769µg/kg fat), Endosulfan-Sulphate (99.052µg/kg fat), Endrin Ketone (63.846µg/kg fat), and Methoxychlor (20.116µg/kg fat). The mean concentrations of the various organochlorine pesticide residues detected in the human milk samples from Ada are; Gamma-HCH (5.438µg/kg fat), DeIta-HCH (6.728µg/kg fat), Heptachlor (0.682µg/kg fat), Aldrin (2.38µg/kg fat), Gamma- Chlordane (1.304µg/kg fat), Alpha-Endosulfan (2.588µg/kg fat), p,p'-DDE (24.165µg/kg fat), Dieldrin (2.222µg/kg fat), p,p'-DDT (3.468µg/kg fat), Endrin (6.339 µg/kg fat), Endosulfan-Sulphate (63.803)µg/kg fat), Endrin Ketone (11.167)µg/kg fat), and Methoxychlor (0.703µg/kg fat). The mean concentration of Endosulfan Sulfate was (99.052Iµ g/kg fat) was highest for the milk samples from Accra. Gamma chlordane recorded the least mean concentration (1.839 µg/kg fat) in the milk samples from Accra. The mean concentration of Endosulfan sulfate (63.803 µg/kg fat) was still the highest as compared to the other organochlorines analyzed for in the milk samples from Ada. Endrin Aldehyde was not

  4. Tracking residual organochlorine pesticides (OCPs) in green, herbal, and black tea leaves and infusions of commercially available tea products marketed in Poland.

    Science.gov (United States)

    Witczak, Agata; Abdel-Gawad, Hassan; Zalesak, Michal; Pohoryło, Anna

    2018-03-01

    The content of residual organochlorine pesticides (OCPs) was examined in green, herbal, and black tea leaves as well as in their infusions prepared from tea products marketed in the main supermarkets in Poland. It was found that the detected mean levels of organochlorine residues in tea leaves ranged from tea occurred in the highest concentrations. Among dichlorodiphenyltrichloroethane (DDT) metabolites the highest level of p,p'DDT (1.96 ng g -1 dw) was in green tea samples. The transfer of OCPs from tea leaves to brew was investigated. The present study revealed that during the infusion process, a significant percentage of the residues, particularly pesticides with high water solubility, were transferred to the infusions. The obtained results show that the percentage transfer of each pesticides from tea to the tea infusions ranged from 6.74% (heptachlor) to 86.6% (endrin). The detected residues were below current MRLs for these pesticides.

  5. Serum organochlorine pesticide residues and risk of testicular germ cell carcinoma: a population-based case-control study.

    Science.gov (United States)

    Biggs, Mary L; Davis, Mark D; Eaton, David L; Weiss, Noel S; Barr, Dana B; Doody, David R; Fish, Sherianne; Needham, Larry L; Chen, Chu; Schwartz, Stephen M

    2008-08-01

    Testicular germ cell carcinoma (TGCC) is the most common malignancy among men ages 20 to 34 years. Although the pathogenesis of TGCC is poorly understood, suboptimal androgen levels or impaired androgen signaling may play a role. Some persistent organochlorine pesticides commonly found in human tissue possess antiandrogenic properties. We examined whether the risk of TGCC is associated with serum levels of 11 organochlorine pesticides, including p,p'-DDE, and whether the p,p'-DDE-TGCC association is modified by CAG or GGN repeat polymorphisms in the androgen receptor gene. We conducted a population-based case-control study among 18- to 44-year-old male residents of three Washington State counties. Cases (n = 246) were diagnosed during 1999 to 2003 with a first, primary TGCC. Controls (n = 630) were men of similar age with no history of TGCC from the same population identified through random-digit telephone dialing. Questionnaires elicited information on demographic, medical, and lifestyle factors. A blood specimen provided serum for gas chromatography-high-resolution mass spectrometry analysis of organochlorine pesticide residues and DNA for genotyping. We observed no clear patterns between TGCC risk and concentrations of any of the organochlorines measured, nor did we observe that the risk associated with p,p'-DDE was modified by androgen receptor CAG ( or =23 repeats) or GGN ( or =17 repeats) genotype. This study does not provide support for the hypothesis that adult exposure to organochlorine pesticides is associated with risk of TGCC. Due to uncertainty regarding how well organochlorine levels measured in adulthood reflect exposures during early life, further research is needed using exposure measurements collected in utero or during infancy.

  6. Efficacy of insecticides in fruit borer control and residues on sugar apple fruit

    Directory of Open Access Journals (Sweden)

    Alessandro da Silva Oliveira

    Full Text Available ABSTRACT Bahia is the Brazilian state with the largest production of sugar apple fruits (Annona squamosa L., and fruit borer (Cerconota anonella, Sepp. 1830 is a key crop pest. Insecticides are the main strategy for pest control even though there are no pesticides registered for this crop. This study aimed to assess the efficacy of insecticides to control fruit borer and determine the levels of insecticide residues in sugar apple fruits aiming at requesting the extension of authorization to use insecticide products in this crop. The experiment was conducted in an eight-year-old irrigated orchard (2 × 4 m located in Anagé, Bahia, Brazil. The experimental design was a randomized block design with 10 treatments (three insecticides with three doses and a control with water and 5 replications. Each plot was composed of four plants but only the two central ones were assessed. Insecticides and doses (g a.i. 100 L−1 water were Bacillus thuringiensis: 0.8, 1.7, and 2.5; triflumuron: 2.4, 3.6, and 4.8; and imidacloprid: 4.0, 10.0, and 16.0. Nine sprayings were carried out at fortnightly intervals with a costal sprayer with constant pressure, JA-2 nozzle, and with jet directed to the fruits. Ten assessments were performed in order to observe fruit borer presence in 30 previously marked fruits per plot. Imidacloprid, at the highest studied dose, was the only effective treatment. Analyses of imidacloprid residues, at 21 and 30 days after the highest dose application, indicated levels higher than the maximum limit allowed. Insecticides under the conditions tested do not meet the norms for requesting the extension of authorization to use insecticides for citrus in sugar apple fruits.

  7. Residue age and tree attractiveness influence efficacy of insecticide treatments against ambrosia beetles (Coleoptera: Curculionidae)

    Science.gov (United States)

    Management of ambrosia beetles in ornamental nurseries relies, in part, on treatments of insecticides to prevent beetles from boring into trees emitting stress-induced ethanol. However, data on residual efficacy of commonly used pyrethroid insecticides is warranted to gauge the duration that trees ...

  8. Investigation of organochlorine pesticide residues in samples of 40 nursing mothers residing in Tehran

    Directory of Open Access Journals (Sweden)

    Afshar M

    1997-09-01

    Full Text Available Organochlorine pesticides are a group of persistant compounds which have been used for a long time. Due to their stability, some of them such as DDT, BHC and their derivatives are still used in the areas with malaria epidemic condition, hence the chance of food contamination always exists. The present survey demonstrated that human milk is one of the best indicator substances in monitoring the environment and human body contamination by organochlorine compounds. We studied the level of residues in the milk of nursing mothers who could be exposed to these compounds through food chain in their contaminated environment. In this investigation, we collected 40 samples from the nursing mothers of two hospitals located in the north and south of Tehran. Detection was carried out by Gas chromatography (GC with 3% OV17 column and Ni63 ECD (Electron Capture Detector. Reference substances were obtained from WHO. Results are discussed in the text.

  9. Penetrative and dislodgeable residue characteristics of 14C-insecticides in apple fruit.

    Science.gov (United States)

    Mota-Sanchez, David; Cregg, Bert; Hoffmann, Eric; Flore, James; Wise, John C

    2012-03-28

    Infinite- and finite-dose laboratory experiments were used to study the penetrative and dislodgeable residue characteristics of (14)C-insecticides in apple fruit. The differences in dislodgeable and penetrated residues of three radiolabeled insecticides ((14)C-thiamethoxam, (14)C-thiacloprid, and (14)C-indoxacarb), applied in aqueous solution with commercial formulations, were determined after water and methanol wash extractions. The rate of sorption and extent of penetration into the fruit cuticles and hypanthium of two apple cultivars were measured after 1, 6, and 24 h of treatment exposure, using radioactivity quantification methods. For all three compounds, 97% or more of the treatment solutions were found on the fruit surface as some form of non-sorbed residues. For indoxacarb, sorption into the epicuticle was rapid but desorption into the fruit hypanthium was delayed, indicative of a lipophilic penetration pathway. For the neonicotinoids, initial cuticular penetration was slower but with no such delay in desorption into the hypanthium.

  10. Residues of Organochlorine Pesticides in Lake Mariut

    International Nuclear Information System (INIS)

    Saad, M.A.H.; Abu-Elamayem, M.M.; El-Sebae, A.B.; Sharaf, I.P.

    1981-01-01

    Lake Mariut, a brackish water lake adjoining the Mediterranean Coast of Egypt, has suffered much from intensive pollution in recent years due to the successive increase of human population and industry around it (Saad, 1980). The occurrence and distribution of organochlorine pesticides in the water of Lake Mariut during a period of one year were studied. This study represents an essential part of a pilot project on pollution of Lake Mariut supported by IAEA. The major organochlorine pesticides detected in the water of Lake Mariut were Lindane, p, p'-DDE, o,p'-DDT and p, p'-DDT. The mean concentrations of these pesticides were 2.091, 4.493, 0.009 and 0.134 ppb, respectively. The mean concentration of the calculated total DDT (Σ DDT) was 5.1 PPb

  11. Persistent organochlorine pesticide residues in freshwater systems ...

    African Journals Online (AJOL)

    DRINIE

    determined in water and sediment samples of freshwater systems in the Eastern Cape Province of South Africa that ... The organochlorine pesticides (OCPs) in water and sediments ...... Test Methods For Evaluating Solid Waste (3rd edn.) ...

  12. Efficacy, persistence and vector susceptibility to pirimiphos-methyl (Actellic 300CS) insecticide for indoor residual spraying in Zanzibar.

    Science.gov (United States)

    Haji, Khamis A; Thawer, Narjis G; Khatib, Bakari O; Mcha, Juma H; Rashid, Abdallah; Ali, Abdullah S; Jones, Christopher; Bagi, Judit; Magesa, Stephen M; Ramsan, Mahdi M; Garimo, Issa; Greer, George; Reithinger, Richard; Ngondi, Jeremiah M

    2015-12-09

    Indoor residual spraying (IRS) of households with insecticide is a principal malaria vector control intervention in Zanzibar. In 2006, IRS using the pyrethroid lambda-cyhalothrine was introduced in Zanzibar. Following detection of pyrethroid resistance in 2010, an insecticide resistance management plan was proposed, and IRS using bendiocarb was started in 2011. In 2014, bendiocarb was replaced by pirimiphos methyl. This study investigated the residual efficacy of pirimiphos methyl (Actellic 300CS) sprayed on common surfaces of human dwellings in Zanzibar. The residual activity of Actellic 300CS was determined over 9 months through bioassay tests that measured the mortality of female Anopheles mosquitoes, exposed to sprayed surfaces under a WHO cone. The wall surfaces included; mud wall, oil or water painted walls, lime washed wall, un-plastered cement block wall and stone blocks. Insecticide susceptibility testing was done to investigate the resistance status of local malaria vectors against Actellic 300CS using WHO protocols; Anopheline species were identified using PCR methods. Baseline tests conducted one-day post-IRS revealed 100% mortality on all sprayed surfaces. The residual efficacy of Actellic 300CS was maintained on all sprayed surfaces up to 8 months post-IRS. However, the bioassay test conducted 9 months post-IRS showed the 24 h mortality rate to be ≤80% for lime wash, mud wall, water paint and stone block surfaces. Only oil paint surface retained the recommended residual efficacy beyond 9 months post-IRS, with mortality maintained at ≥97 %. Results of susceptibility tests showed that malaria vectors in Zanzibar were fully (100%) susceptible to Actellic 300CS. The predominant mosquito vector species was An. arabiensis (76.0%) in Pemba and An. gambiae (83.5%) in Unguja. The microencapsulated formulation of pirimiphos methyl (Actellic 300CS) is a highly effective and appropriate insecticide for IRS use in Zanzibar as it showed a relatively prolonged

  13. Efficacy of insecticide residues on adult Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) mortality and injury in apple and peach orchards.

    Science.gov (United States)

    Leskey, Tracy C; Short, Brent D; Lee, Doo-Hyung

    2014-07-01

    The primary threat from Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) originates from populations continuously dispersing from and among wild and cultivated hosts, so many individuals may not be directly sprayed with insecticides. Limited information exists regarding field-based residual activity of insecticides for management of H. halys in tree fruit. Thus, we conducted field-based bioassays in apple and peach orchards to evaluate residual activity of insecticides commonly applied against H. halys. Adults used in these trials were collected from wild and cultivated hosts less than one week prior to testing to more accurately reflect the susceptibility of wild H. halys populations in the field throughout the season. Significantly higher mortality rates of Halyomorpha halys were observed early in the growing season, when overwintered adults were prevalent, compared with populations present later in the growing season that included new generation adults. Significantly higher mortality was recorded for adults exposed to fresh insecticide applications compared with three- and seven-day old residues. Typically, the addition of an adjuvant did not enhance efficacy or residual activity of insecticides. Significantly fewer injury sites were recorded on apples treated with dinotefuran and fenpropathrin compared with the untreated apples for all residue ages. Overwintered Halyomorpha halys populations are easier to kill with insecticide applications than the first and second generation which are present in the field during the mid- to late-season. Residual activity of nearly all insecticides decreased significantly three days after application and adjuvants generally did not increase residual activity. These factors should be considered in developing season-long programs for management of this invasive species in tree fruit. © 2013 Society of Chemical Industry.

  14. Multi-country assessment of residual bio-efficacy of insecticides used for indoor residual spraying in malaria control on different surface types: results from program monitoring in 17 PMI/USAID-supported IRS countries.

    Science.gov (United States)

    Dengela, Dereje; Seyoum, Aklilu; Lucas, Bradford; Johns, Benjamin; George, Kristen; Belemvire, Allison; Caranci, Angela; Norris, Laura C; Fornadel, Christen M

    2018-01-30

    Indoor residual spraying (IRS) is the application of insecticide to the interior walls of household structures that often serve as resting sites for mosquito vectors of malaria. Human exposure to malaria vectors is reduced when IRS involves proper application of pre-determined concentrations of the active ingredient specific to the insecticide formulation of choice. The impact of IRS can be affected by the dosage of insecticide, spray coverage, vector behavior, vector susceptibility to insecticides, and the residual efficacy of the insecticide applied. This report compiles data on the residual efficacy of insecticides used in IRS campaigns implemented by the United States President's Malaria Initiative (PMI)/United States Agency for International Development (USAID) in 17 African countries and compares observed length of efficacy to ranges proposed in World Health Organization (WHO) guidelines. Additionally, this study provides initial analysis on variation of mosquito mortality depending on the surface material of sprayed structures, country spray program, year of implementation, source of tested mosquitoes, and type of insecticide. Residual efficacy of the insecticides used for PMI/USAID-supported IRS campaigns was measured in Benin, Burkina Faso, Ethiopia, Ghana, Kenya, Liberia, Madagascar, Malawi, Mali, Mozambique, Nigeria, Rwanda, Senegal, Tanzania, Uganda, Zambia and Zimbabwe. The WHO cone bioassay tests were used to assess the mortality rate of mosquitoes exposed to insecticide-treated mud, wood, cement, and other commonly used housing materials. Baseline tests were performed within weeks of IRS application and follow-up tests were continued until the mortality of exposed mosquitoes dropped below 80% or the program monitoring period ended. Residual efficacy in months was then evaluated with respect to WHO guidelines that provide suggested ranges of residual efficacy for insecticide formulations recommended for use in IRS. Where the data allowed, direct

  15. Residues of organochlorine pesticides in soils from the southern Sonora, Mexico.

    Science.gov (United States)

    Cantu-Soto, E U; Meza-Montenegro, Maria Mercedes; Valenzuela-Quintanar, A I; Félix-Fuentes, A; Grajeda-Cota, P; Balderas-Cortes, J J; Osorio-Rosas, C L; Acuña-García, G; Aguilar-Apodaca, M G

    2011-11-01

    Although, the Yaqui and Mayo valleys are the most important agricultural areas in Sonora, there is only limited data of the pesticides residue in soils in these valleys. This study measured the organochlorine pesticides (OCPs) in 234 soil samples (residential and agricultural) from 24 communities. The global results (mean, range) indicated that benzene hexachloride (19.2, ND-938.5 μg g(-1)), endrin (6.6, ND-377.3 μg g(-1)) and DDTs (36.45, ND-679.7 μg g(-1)) were the dominant contaminants. Soil is one of the most important routes of exposure to OCPs in the population of southern Sonora and this study can be used to establish background levels of OCPs.

  16. Effect of repeated pesticide applications on soil properties in cotton fields: II. Insecticide residues and impact on dehydrogenase and arginine deaminase activities

    International Nuclear Information System (INIS)

    Vig, K.; Singh, D.K.; Agarwal, H.C.; Dhawan, A.K.; Dureja, P.

    2001-01-01

    Insecticides were applied sequentially at recommended dosages post crop emergence in cotton fields and soil was sampled at regular intervals after each treatment. Soil was analysed for insecticide residues and activity of the enzymes dehydrogenase and arginine deaminase. Insecticide residues detected in the soil were in small quantities and they did not persist for long. Only endosulfan leached below 15 cm. Insecticides had only temporary effects on enzyme activities which disappeared either before the next insecticide treatment or by the end of the experimental period. (author)

  17. ORGANOCHLORINE CONTAMINANTS IN SEA TURTLES FROM THE EASTERN PACIFIC

    Science.gov (United States)

    We measured organochlorine residues in three species of sea turtles from the Baja California peninsula, Mexico. Seventeen of 21 organochlorine pesticides analyzed were detected, with heptachlor epoxide and y-hexachlorocyclohexane the most prevalent in 14 (40%) and 11 (31%) of th...

  18. Sorption and desorption of insecticides in Brazilian soils

    International Nuclear Information System (INIS)

    Luchini, L.C.; Lord, K.A.; Ruegg, E.F.

    1980-01-01

    The sorption from aqueous solution of ten Brazilian soil types of four organochlorine, two organophosphorus and one carbamate insecticide was determined in the laboratory using gas chromatographic and radiometric techniques. Measurements showed that soils richest in organic matter, sorbed all substances except aldrin more strongly than the other soils. DDT was the most and aldrin the least sorbed organochlorine pesticide, being dieldrin sorbed two to four times more strongly than aldrin. Sorption of lindane varied in different soils. The organophosphate insecticides malathion and parathion were strongly sorbed in the soils richest in organic matter and weakly sorbed in the poorest soils heing moderately sorbed by the other soils. Sorption of carbaryl by all soils is small. Lindane was desorbed from the soil richest in organic matter and the extent of desorption was dependent on the sorption time. (Author) [pt

  19. Organochlorine and organophosphorus pesticide residues in fodder and milk samples along Musi river belt, India

    Directory of Open Access Journals (Sweden)

    Korrapati Kotinagu

    2015-04-01

    Full Text Available Aim: The present study was conducted to find the organochlorine pesticide (OCP and organophosphorus pesticide (OPP residues in fodder and milk samples along Musi river belt, India. Materials and Methods: Fodder and milk samples collected from the six zones of Musi river belt, Hyderabad India were analyzed by gas chromatography with electron capture detector for OCP residues and pulsated flame photometric detector for the presence of OPP residues. Results: The gas chromatographic analysis of fodder samples of Zone 5 of Musi river showed the residues of dicofol at concentration of 0.07±0.0007 (0.071-0.077. Among organophosphorus compounds, dimetheoate was present in milk samples collected from Zone 6 at a level of 0.13±0.006 (0.111-0.167. The residues of OCPs, OPPs and cyclodies were below the detection limit in the remaining fodder and milk samples collected from Musi river belt in the present study. Conclusion: The results indicate that the pesticide residues in fodder and milk samples were well below the maximum residue level (MRL values, whereas dicofol in fodder and dimethoate in milk were slightly above the MRL values specified by EU and CODEX.

  20. Organochlorine and organophosphorus pesticide residues in fodder and milk samples along Musi river belt, India.

    Science.gov (United States)

    Kotinagu, Korrapati; Krishnaiah, Nelapati

    2015-04-01

    The present study was conducted to find the organochlorine pesticide (OCP) and organophosphorus pesticide (OPP) residues in fodder and milk samples along Musi river belt, India. Fodder and milk samples collected from the six zones of Musi river belt, Hyderabad India were analyzed by gas chromatography with electron capture detector for OCP residues and pulsated flame photometric detector for the presence of OPP residues. The gas chromatographic analysis of fodder samples of Zone 5 of Musi river showed the residues of dicofol at concentration of 0.07±0.0007 (0.071-0.077). Among organophosphorus compounds, dimetheoate was present in milk samples collected from Zone 6 at a level of 0.13±0.006 (0.111-0.167). The residues of OCPs, OPPs and cyclodies were below the detection limit in the remaining fodder and milk samples collected from Musi river belt in the present study. The results indicate that the pesticide residues in fodder and milk samples were well below the maximum residue level (MRL) values, whereas dicofol in fodder and dimethoate in milk were slightly above the MRL values specified by EU and CODEX.

  1. Residues, Sources and Potential Biological Risk of Organochlorine Pesticides in Surface Sediments of Qiandao Lake, China.

    Science.gov (United States)

    Yang, Huayun; Zhou, Shanshan; Li, Weidong; Liu, Qi; Tu, Yunjie

    2015-10-01

    Sediment samples were analyzed to comprehensively characterize the concentrations, distribution, possible sources and potential biological risk of organochlorine pesticides in Qiandao Lake, China. Concentrations of sumHCH and sumDDT in sediments ranged from 0.03 to 5.75 ng/g dry weight and not detected to 14.39 ng/g dry weight. The predominant β-HCH and the α-HCH/γ-HCH ratios indicated that the residues of HCHs were derived not only from historical technical HCH use but also from additional usage of lindane. Ratios of o,p'-DDT/p,p'-DDT and DDD/DDE suggested that both dicofol-type DDT and technical DDT applications may be present in most study areas. Additionally, based on two sediment quality guidelines, γ-HCH, o,p'-DDT and p,p'-DDT could be the main organochlorine pesticides species of ecotoxicological concern in Qiandao Lake.

  2. Presence of pesticide residues in water, sediment and biological samples taken from aquatic environments in Honduras

    International Nuclear Information System (INIS)

    Meyer, D.E.

    1999-01-01

    The objective of this study was to detect the presence of persistent pesticides in water, sediment and biological samples taken from aquatic environments in Honduras during the period 1995-98. Additionally, the LC 50 for 2 fungicides and 2 insecticides on post-larval Penaeus vannamei was determined in static water bioassays. A total of 80 water samples, 16 sediment samples and 7 biological samples (fish muscle tissue) were analyzed for detection of organochlorine and organophosphate pesticide residues. The results of sample analyses indicate a widespread contamination of Honduran continental and coastal waters with organochlorine pesticides. Most detections were of low ( 50 values and were therefore found to be much more toxic to the post-larval shrimp than the fungicides tridemorph and propiconazole. (author)

  3. Characterization of population exposure to organochlorines: A cluster analysis application

    NARCIS (Netherlands)

    R.M. Guimarães (Raphael Mendonça); S. Asmus (Sven); A. Burdorf (Alex)

    2013-01-01

    textabstractThis study aimed to show the results from a cluster analysis application in the characterization of population exposure to organochlorines through variables related to time and exposure dose. Characteristics of 354 subjects in a population exposed to organochlorine pesticides residues

  4. Organochlorine pesticide residues in strawberries from integrated pest management and organic farming.

    Science.gov (United States)

    Fernandes, Virginia C; Domingues, Valentina F; Mateus, Nuno; Delerue-Matos, Cristina

    2011-07-27

    A rapid, specific, and sensitive method based on the Quick Easy Cheap Effective Rugged and Safe (QuEChERS) method and a cleanup using dispersive solid-phase extraction with MgSO(4), PSA, and C18 sorbents has been developed for the routine analysis of 14 pesticides in strawberries. The analyses were performed by three different analytical methodologies: gas chromatography (GC) with electron capture detection (ECD), mass spectrometry (MS), and tandem mass spectrometry (MS/MS). The recoveries for all the pesticides studied were from 46 to 128%, with relative standard deviation of residue limits (MRL) accepted in Portugal for organochlorine pesticides (OCP). A survey study of strawberries produced in Portugal in the years 2009-2010 obtained from organic farming (OF) and integrated pest management (IPM) was developed. Lindane and β-endosulfan were detected above the MRL in OF and IPM. Other OCP (aldrin, o,p'-DDT and their metabolites, and methoxychlor) were found below the MRL. The OCP residues detected decreased from 2009 to 2010. The QuEChERS method was successfully applied to the analysis of strawberry samples.

  5. LC-MS/MS analysis of neonicotinoid insecticides: Residue findings in chilean honeys

    Directory of Open Access Journals (Sweden)

    Raquel Bridi

    Full Text Available ABSTRACT Neonicotinoids are a relatively new generation of insecticides that have been used for control of pests such as aphids, leafhoppers and whiteflies. This paper presents for the first time a determination of residues of four neonicotinoid insecticides (acetamiprid, thiamethoxam, thiacloprid and imidacloprid in Chilean honey using QuEChERS extraction and UHPLC-MS/MS analysis. The limits of detection and quantification found for all analytes ranging from 0.34 to 1.43 μg kg-1 and from 0.30 to 4.76 μg kg-1, respectively. The extraction using QuEChERS method provided recoveries over 79% and the precision showed coefficient of variation lower than 20%. These data are in agreement with the international criteria that recommend general recovery limits of 70 - 120%. Of the 16 samples analyzed, in three honey samples neonicotinoids pesticides were detected. These three samples were collected from the same geographical area (Rengo. Fruit and grain production characterize the province of Rengo. The analysis of the botanical origin of these honeys showed the absence of pollen grains of crops and the majority presence of pollen grains of weeds such as Medicago sativa, Galega officinalis and Brassica rapa, which could be associated with crops. Although the residue levels found were low, the results also confirm the actual occurrence of a transfer of neonicotinoid insecticides from exposed honeybees into honey.

  6. Residual insecticides, inert dusts and botanicals for the protection of durable stored products against pest infestation in developing countries

    Directory of Open Access Journals (Sweden)

    Obeng-Ofori, D.

    2010-09-01

    Full Text Available Insect pests associated with durable grains and processed food cause considerable quantitative and qualitative losses throughout the world. Insect infestation can occur just prior to harvest, during storage in traditional storage structures, cribs, metal or concrete bins, and in warehouses, food handling facilities, retail grocery stores as well as in-transit. Many tools are available for managing insects associated with grains and processed food. Although pest management strategies are changing to meet consumer’s demand for food free of insecticide residues, address concerns about safety of insecticides to humans, delay insecticide resistance development in insects and comply with stricter insecticide regulations, the use of synthetic residual insecticides will continue to be a major component of stored-product pest management programmes. Selective use of residual insecticides requires a through understanding and evaluation of risks, costs and benefits. The use of plant and inert materials may be a safe, cost-effective and environmentally friendly method of grain preservation against pest infestation among low-resource poor farmers who store small amounts of grains. There is a dearth of information on the use of plant materials by rural farmers in Africa for stored-product protection. The most promising candidate plant materials for future utilization as grain protectants are Azadirachta, Acorus, Chenopodium, Eucalyptus, Mentha, Ocimum, Piper and Tetradenia together with vegetable oils from various sources. Neem is the only plant from which several commercial products have been developed worldwide. However, unlike synthetic insecticides these alternatives often do not provide effective or rapid suppression of pest populations and may not be effective against all species of pests. These alternatives are also more expensive than synthetic insecticides, and have not been tested extensively under field conditions in the tropics. This paper

  7. HCH and DDT residues in human placentas in Murcia (Spain)

    International Nuclear Information System (INIS)

    Falcon, M.; Oliva, J.; Osuna, E.; Barba, A.; Luna, A.

    2004-01-01

    Organochlorinated insecticides are ubiquitous toxicants that are transplacentally transferred from mother to fetus and are reported to produce adverse health effects in pregnant woman and neonates. To investigate hexachlorocyclohexane (HCH) and 1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) exposure in pregnant woman, a total of 102 placentas were analyzed by a gas chromatograph equipped with electron capture detector. Organochlorine residues were found in 69.6% of the samples. Lindane was detected in 24.5%, α-HCH in 2.9%, β-HCH in 6.9%, p,p'-DDE in 44.1%, p,p'-DDT in 14.7% and p,p'-DDD in 10.8% of the samples. The pattern of dispersal by these substances in Murcia is similar to that described by different authors in other countries. Therefore, the past use of DDT and the present employment of lindane seem to be reflected in body tissues of the residents of this area

  8. Toxicity and Residual Activity of Insecticides Against Tamarixia triozae (Hymenoptera: Eulophidae), a Parasitoid of Bactericera cockerelli (Hemiptera: Triozidae).

    Science.gov (United States)

    Luna-Cruz, Alfonso; Rodríguez-Leyva, Esteban; Lomeli-Flores, J Refugio; Ortega-Arenas, Laura D; Bautista-Martínez, Néstor; Pineda, Samuel

    2015-10-01

    Bactericera cockerelli (Sulc) (Hemiptera: Triozidae) is one of the most economically important pests of potato, tomato, and peppers in Central America, Mexico, the United States, and New Zealand. Its control is based on the use of insecticides; however, recently, the potential of the eulophid parasitoid Tamarixia triozae (Burks) (Hymenoptera: Eulophidae) for population regulation has been studied. Because T. triozae is likely to be exposed to insecticides on crops, the objective of this study was to explore the compatibility of eight insecticides with this parasitoid. The toxicity and residual activity (persistence) of spirotetramat, spiromesifen, beta-cyfluthrin, pymetrozine, azadirachtin, imidacloprid, abamectin, and spinosad against T. triozae adults were assessed using a method based on the residual contact activity of each insecticide on tomato leaf discs collected from treated plants growing under greenhouse conditions. All eight insecticides were toxic to T. triozae. Following the classification of the International Organization of Biological Control, the most toxic were abamectin and spinosad, which could be placed in toxicity categories 3 and 4, respectively. The least toxic were azadirachtin, pymetrozine, spirotetramat, spiromesifen, imidacloprid, and beta-cyfluthrin, which could be placed in toxicity category 2. In terms of persistence, by day 5, 6, 9, 11, 13, 24, and 41 after application, spirotetramat, azadirachtin, spiromesifen, pymetrozine, imidacloprid, beta-cyfluthrin, abamectin, and spinosad could be considered harmless, that is, placed in toxicity category 1 (<25% mortality of adults). The toxicity and residual activity of some of these insecticides allow them to be considered within integrated pest management programs that include T. triozae. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Assessment of organochlorine pesticides and atrazine residues in Maize Produced in Ghana using GC-ECD/ GC-MS

    International Nuclear Information System (INIS)

    Miensah, E.D.

    2015-07-01

    Maize is consumed by over 95% of the Ghanaian populace and the practice of using atrazine, lindane and other organochlorine pesticides in its production has raised concerns about potential adverse effects on human health and the environment. A field survey was conducted in this study to assess farmers’ knowledge of safe handling and use of these chemicals as well as toxicity awareness and symptoms among farmers and traders. Residues of the pesticides in maize samples as well as the potential health risk associated with exposure to them were also evaluated. Data obtained from the field survey indicate that a large proportion of farmers are at risk of pesticide poisoning through occupational exposure. Over 80 % of applicators do not apply safety precautions during pesticide mixing and application; resulting in considerable prevalence of pesticide related illnesses in the study area. Residues of lindane and atrazine were below detection limits of 0.005 mg/kg and 0.010 mg/kg respectively of the GC-ECD/MS used for the analysis; except in the Ashanti region where atrazine was 0.05 mg/kg which is within the EU-MRL of 0.1 mg/kg. However, minute concentrations of other organochlorines (endrin- 0.007 mg/kg; heptachlor- 0.023 mg/kg; alpha-endosulfan- 0.013 mg/kg) were found in maize samples from Brong Ahafo, Eastern, Central and Upper west regions. Though endrin and alpha-endosulfan were below the EU-MRL of 0.01 mg/kg and 0.10 mg/kg respectively, heptachlor was slightly above the EU-MRL of 0.01 mg/kg. The estimated doses for all these other organochlorines pesticides do not pose direct hazard to human health because their estimated dose values were lower than toxic thresholds and reference doses. However, due to the unsafe application practices by applicators, there exists a potential risk for systemic and carcinogenic health effects by these chemicals in the study area. (au)

  10. Organochlorine Pesticides in the Environment

    Science.gov (United States)

    Stickel, L.F.

    1968-01-01

    Each year for nearly 20 years, thousands of pounds of persistent organochlorine pesticides have been applied to outdoor areas in many countries. These compounds may last for a very long time in the environment, and be carried by wind, water, and animals to places far distant from where they are used. As a result, most living organisms now contain organochlorine residues. This paper constitutes a selective review of the literature concerning the occurrence, distribution, and effects of organochlorines in the environment. Highest concentrations generally occur in carnivorous species. Thus predatory and fish-eating birds ordinarily have higher residues than do herbivores; quantities are similar in birds of similar habits in different countries. Any segment of the ecosystem - marshland, pond, forest, or field - receives various amounts and kinds of pesticides at irregular intervals. The different animals absorb, detoxify, store, and excrete pesticides at different rates. Different degrees of magnification of pesticide residues by living organisms in an environment are the practical result of many interactions that are far more complex than implied by the statement of magnification up the food chain. These magnifications may be millions of times from water to mud or only a few times from food to first consumer. Direct mortality of wild animals as an aftermath of recommended pesticide treatments has been recorded in the literature of numerous countries. However, accidents and carelessness also accompany pesticide use on a percentage basis and are a part of the problem. More subtle effects on the size and species composition of populations are more difficult to perceive in time to effect remedies. The possibility of ecological effects being mediated through changes in physiology and behavior has received some attention and has resulted in some disquieting findings. These include discovery of the activity of organochlorines in stimulating the breakdown of hormones or in

  11. Influence of gamma rays irradiation to chlorphyriphos insecticides residues in grapes (vitis vinifera L.)

    International Nuclear Information System (INIS)

    Chairul, S.M.

    2012-01-01

    Simulation methods to determination of chlorphyriphos insecticides residue in grapes cause effect gamma rays, was done. Fruits of grapes soaked with chlorpyriphos insecticide solution high level concentrated (100 ppm; 200 ppm; and 300 ppm) for 3 (three minutes). The treatment of the sample was direct of extraction after soaks; extract after storage for one week after soak, and extract after soak after storage for one week after irradiation at 0.5 kGy; 1.0 kGy; and 1.5 kGy dose. Extraction methods using ethyl acetate solvent, and using sodium sulphate as to dryed water level in grapes, and then extractan was injected to chromatography gas use electron capture detector. The result indicated that occur of descent of chlorpyrifos residues from eachs soaked consequence at storage for one week was amount 7,55; 8,42; and 18,88% respectively, while of consequence irradiation of gamma ray at 0,5 kGy doses, will be descent of chlorpyrifos residues in amount 13,90; 19,16; and 52,79% respectively, and at 1,0 kGy doses irradiation will be descent in amount 34,45; 36,15 and 49,79%, respectively. (author)

  12. Organochlorine pesticides residues in bottled drinking water from Mexico City.

    Science.gov (United States)

    Díaz, Gilberto; Ortiz, Rutilio; Schettino, Beatriz; Vega, Salvador; Gutiérrez, Rey

    2009-06-01

    This work describes concentrations of organochlorine pesticides in bottled drinking water (BDW) in Mexico City. The results of 36 samples (1.5 and 19 L presentations, 18 samples, respectively) showed the presence of seven pesticides (HCH isomers, heptachlor, aldrin, and p,p'-DDE) in bottled water compared with the drinking water standards set by NOM-127-SSA1-1994, EPA, and World Health Organization. The concentrations of the majority of organochlorine pesticides were within drinking water standards (0.01 ng/mL) except for beta-HCH of BW 3, 5, and 6 samples with values of 0.121, 0.136, and 0.192 ng/mL, respectively. It is important monitoring drinking bottled water for protecting human health.

  13. Organochlorine and mercury residues in eggs of the lesser kestrel (Falco naumanni) from a long term study in the eastern Mediterranean

    International Nuclear Information System (INIS)

    Goutner, Vassilis; Bakaloudis, Dimitrios E.; Papakosta, Malamati A.; Vlachos, Christos G.; Mattig, Frank R.; Pijanowska, Ursula; Becker, Peter H.

    2015-01-01

    Organochlorine and mercury residues were analyzed in unhatched eggs of the lesser kestrel (Falco naumanni) (2002–2012) in central Greece. Concentrations graded as ∑DDTs > ∑PCBs > HCB > ∑HCHs > ∑Chlordanes. Temporal declines were found in the concentrations of ∑DDTs, ∑HCHs and ∑Chlordanes but not in Hg, HCB and ∑PCBs. TEQs of PCBs and their degree of metabolisation showed no time trend. The reproductive parameters showed neither a temporal trend nor a significant year effect. No relationships occurred between the reproductive parameters per year and nest type (natural, artificial) with any of the contaminants analyzed except HCB influenced by year and clutch size. Low pollutant concentrations suggest that either lesser kestrels ranged across the year in unpolluted areas or may be caused by their short food chain. The low concentrations seem improbable to have affected the reproduction of these birds, although critical levels are still to be defined. - Highlights: • Persistent organochlorine and mercury residues were detected in lesser kestrel's eggs. • ∑DDTs, ∑HCHs and ∑Chlordanes showed temporal declining trend; Hg, HCB and ∑PCBs did not. • HCB residue concentrations increased with larger clutch sizes. • Low concentrations of pollutants did not seem to affect reproduction. - Low concentrations of pollutants may not affect lesser kestrel's reproduction.

  14. Indoor residual spraying with a mixture of clothianidin (a neonicotinoid insecticide) and deltamethrin provides improved control and long residual activity against pyrethroid resistant Anopheles gambiae sl in Southern Benin.

    OpenAIRE

    Ngufor, C; Fongnikin, A; Rowland, M; N'Guessan, R

    2017-01-01

    There is an urgent need for new insecticides for indoor residual spraying (IRS) which can provide improved and prolonged control of malaria vectors that have developed resistance to existing insecticides. The neonicotinoid, clothianidin represents a class of chemistry new to public health. Clothianidin acts as an agonist on nicotinic acetyl choline receptors. IRS with a mixture of Clothianidin and another WHO approved insecticide such as deltamethrin could provide improved control of insectic...

  15. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  16. Insecticide residues in stored grains in Sonora, Mexico: quantification and toxicity testing.

    Science.gov (United States)

    Aldana-Madrid, M L; Valdez-Hurtado, S; Vargas-Valdez, N D; Salazar-Lopez, N J; Silveira-Gramont, M I; Loarca-Piña, F G; Rodríguez-Olibarria, G; Wong-Corral, F J; Borboa-Flores, J; Burgos-Hernández, A

    2008-02-01

    Food safety has acquired great attention by food importer and exporters. Food rejection or acceptance across international borders is based on the compliance with international food regulations. Due to the lack of recent data on pesticide residues in Mexican grains, this study focused on detecting and quantifying insecticide residues in stored wheat, corn, chickpeas, and beans, as well as to determine their mutagenic potential. Grains were sampled from primary storage sites in Sonora, Mexico. Malathion, chlorpyrifos, deltamethrin, cypermethrin, 4,4-DDE, 4,4-DDD and 4,4-DDT were analyzed in 135 samples. Grain samples were not mutagenic and most pesticide levels were within regulation limits.

  17. Determination of soil content in chlordecone (organochlorine pesticide) using near infrared reflectance spectroscopy (NIRS)

    International Nuclear Information System (INIS)

    Brunet, Didier; Woignier, Thierry; Lesueur-Jannoyer, Magalie; Achard, Raphael; Rangon, Luc; Barthes, Bernard G.

    2009-01-01

    Chlordecone is a toxic organochlorine insecticide that was used in banana plantations until 1993 in the French West Indies. This study aimed at assessing the potential of near infrared reflectance spectroscopy (NIRS) for determining chlordecone content in Andosols, Nitisols and Ferralsols from Martinique. Using partial least square regression, chlordecone content conventionally determined through gas chromatography-mass spectrometry could be correctly predicted by NIRS (Q 2 = 0.75, R 2 = 0.82 for the total set), especially for samples with chlordecone content -1 or when the sample set was rather homogeneous (Q 2 = 0.91, R 2 = 0.82 for the Andosols). Conventional measures and NIRS predictions were poorly correlated for chlordecone content >12 mg kg -1 , nevertheless ca. 80% samples were correctly predicted when the set was divided into three or four classes of chlordecone content. Thus NIRS could be considered a time- and cost-effective method for characterising soil contamination by chlordecone. - Soil content in chlordecone, an organochlorine insecticide, can be determined time- and cost-effectively using near infrared reflectance spectroscopy (NIRS).

  18. Determination of soil content in chlordecone (organochlorine pesticide) using near infrared reflectance spectroscopy (NIRS)

    Energy Technology Data Exchange (ETDEWEB)

    Brunet, Didier, E-mail: didier.brunet@ird.f [IRD - Institut de Recherche pour le Developpement, UMR Eco and Sols (Ecologie Fonctionnelle et Biogeochimie des Sols), Montpellier SupAgro, Batiment 12, 2 place Viala, 34060 Montpellier Cedex 1 (France); Woignier, Thierry [IRD, UMR Eco and Sols, PRAM (Pole de Recherche Agronomique de la Martinique), BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); CNRS - Centre National de la Recherche Scientifique, Universite Montpellier 2, place Eugene Bataillon, 34095 Montpellier Cedex 5 (France); Lesueur-Jannoyer, Magalie; Achard, Raphael [CIRAD (Centre de Cooperation Internationale en Recherche Agronomique pour le Developpement), PRAM, BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); Rangon, Luc [IRD, UMR Eco and Sols, PRAM (Pole de Recherche Agronomique de la Martinique), BP 213, Petit Morne, 97232 Le Lamentin, Martinique (French West Indies) (France); Barthes, Bernard G. [IRD - Institut de Recherche pour le Developpement, UMR Eco and Sols (Ecologie Fonctionnelle et Biogeochimie des Sols), Montpellier SupAgro, Batiment 12, 2 place Viala, 34060 Montpellier Cedex 1 (France)

    2009-11-15

    Chlordecone is a toxic organochlorine insecticide that was used in banana plantations until 1993 in the French West Indies. This study aimed at assessing the potential of near infrared reflectance spectroscopy (NIRS) for determining chlordecone content in Andosols, Nitisols and Ferralsols from Martinique. Using partial least square regression, chlordecone content conventionally determined through gas chromatography-mass spectrometry could be correctly predicted by NIRS (Q{sup 2} = 0.75, R{sup 2} = 0.82 for the total set), especially for samples with chlordecone content <12 mg kg{sup -1} or when the sample set was rather homogeneous (Q{sup 2} = 0.91, R{sup 2} = 0.82 for the Andosols). Conventional measures and NIRS predictions were poorly correlated for chlordecone content >12 mg kg{sup -1}, nevertheless ca. 80% samples were correctly predicted when the set was divided into three or four classes of chlordecone content. Thus NIRS could be considered a time- and cost-effective method for characterising soil contamination by chlordecone. - Soil content in chlordecone, an organochlorine insecticide, can be determined time- and cost-effectively using near infrared reflectance spectroscopy (NIRS).

  19. Organochlorine pesticide residue levels in blood serum of inhabitants from Veracruz, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Herrero-Mercado, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Martínez-Valenzuela, C; Gómez Arroyo, S; Villalobos Pietrini, R

    2012-09-01

    The objective of the present study was to monitor the levels of organochlorine pesticides HCB; α-, β-, γ-HCH; pp'DDE; op'DDT; and pp'DDT in blood serum of Veracruz, Mexico inhabitants. Organochlorine pesticides were analyzed in 150 blood serum samples that constituted that which remained after clinical analyses, using gas chromatography-electron-capture detection (GC-ECD). The results were expressed as milligrams per kilogram on fat basis and micrograms per liter on wet weight. Only the following pesticides were detected: p,p'-DDE was the major organochlorine component, detected in 100% of samples at mean 15.8 mg/kg and 8.4 μg/L; p,p'-DDT was presented in 41.3.% of monitored samples at mean 3.1 mg/kg and 1.4 μg/L; β-HCH was found in 48.6% of the samples at mean 4.9 mg/kg and 2.7 μg/L; op'DDT was determined to be in only 3.3% of monitored samples at mean 2.7 mg/kg and 1.4 μg/L. The pooled samples divided according to sex showed significant differences of β-HCH and pp'DDE concentrations in females. The samples grouped according to age presented the third tertile as more contaminated in both sexes, indicating age as a positively associated factor with serum organochlorine pesticide levels in Veracruz inhabitants.

  20. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  1. Organochlorine pesticide residues in sardinella aurita from the coastal waters of Accra-Tema, Ghana and their potential health risks

    International Nuclear Information System (INIS)

    Nyarko, E.; Botwe, B.O.; Bampoe, A.A.; Addo, S.; Armah, A.K.; Ntow, W.J.; Kelderman, P.

    2011-01-01

    Sardinella aurita and seawater samples from the Accra-Tema coast of Ghana were analysed for organochlorine (OC) pesticides using gas chromatography (GC) with electron capture detection (ECD). Residues of DDTs (p,p'-DDT, p'p'-DDE,p,p'-DDD), hexachlorocyclohexane (HCHs - α-HCH, β-HCH and γ-HCH), endosulfan (α-endosulfan, β-endosulfan, endosulfan sulphate) and heptachlor were detected in fish at average concentrations ranging from 3.0 to 1235.0 μg/kg wet wt. These residues were, however, below the detection limit in seawater samples. Significant differences (p < 0.05) in residue levels were also observed across sites, decreasing from Chorkor to Kpone for seven (7) of the residues that were detected in S. aurita. Evaluation of hazard ratios (HRs) and the health risk associated with OC exposure from consumption of sardinellas revealed a probability of adverse health effect due to p,p'-DDT, γ-HCH and heptachlor. Hence, p,p'-DDT, γ-HCH and heptachlor may be of particular health concern. (au)

  2. Monitoring of organochlorine pesticide residue levels in adipose tissue of Veracruz, Mexico inhabitants.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Herrero-Mercado, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Martínez-Valenzuela, C; Infanzon, R; Hernández-Chalate, F

    2011-11-01

    The objective of the present study was to monitor the levels of organochlorine pesticides HCB, α-β-γ-HCH, pp'DDE, op'DDT and pp'DDT in 150 adipose tissue samples of Veracruz, Mexico inhabitants. In analyzed samples, the following pesticides were detected: p,p'-DDE in 100% of the samples at mean 1.643 mg/kg; p,p'-DDT in 99.3.% of the samples at mean 0.227 mg/kg; β-HCH in 97.3% of the samples at mean 0.063 mg/kg; and op'DDT in 93.3% of the samples at mean 0.022 mg/kg. Comparing mean, median and geometric mean concentrations of organochlorine pesticides shows a decrease in values from mean to median and to geometric mean which points out a prevalence of lower concentrations among the total samples and the existence of occasional cases of extreme exposure expressed in range values. The pooled samples divided according to sex, showed only significant differences of pp'DDE median concentrations between sexes. The other organochlorine pesticides indicated no statistical differences between sexes, including the pp'DDE/pp'DDT ratio. The samples grouped according to age, showed that the third tertile was more contaminated for both sexes, indicating age as a positively associated factor with organochlorine pesticide levels in adipose tissue of Veracruz inhabitants. Comparing organochlorine pesticide levels between 2008 and 2010 years, a decreased tendency for β-HCH, pp'DDE, Σ-DDT and pp'DDE/pp'DDT ratio levels was observed.

  3. Organochlorine residues and shell thicknesses in eggs of the clapper rail, common gallinule, purple gallinule, and limpkin (class Aves), eastern and southern United States, 1972-74.

    Science.gov (United States)

    Klaas, E E; Ohlendorf, H M; Cromartie, E

    1980-12-01

    Organochlorine residues and shell thicknesses were surveyed in eggs of the clapper rail (Rallus longirostris), purple gallinule (Porphyrula martinica), common gallinule (Gallinula chloropas), and limpkin (Aramus guarauna) from the eastern and southern United States. Clapper rail eggs were collected during 1972-73 in New Jersey, Virginia, and South Carolina. During 1973-74, gallinule eggs were collected in Florida, South Carolina, and Louisiana, and limpkin eggs were collected in Florida. Egg contents were analyzed for residues of organochlorine pesticides, including DDT, TDE, DDE, dieldrin, mirex, heptachlor epoxide, oxychlordane, cis-chlordane (and/or trans-nonachlor), cis-nonachlor, hexachlorobenzene (HCB), toxaphene, and endrin, and for polychlorinated biphenyls (PCBs). Shell thicknesses of recent eggs of these species were compared with archival eggs that had been collected before 1947. With the exception of the limpkin, the majority of eggs analyzed contained residues of p,p'-DDE and PCBs. Geometric means ranged from 0.10 ppm to 1.3 ppm. Small amounts (less than 1.0 ppm) of mirex, dieldrin, cis-chlordane (and/or trans-nonachlor), TDE, and DDT were detected in a few eggs. No evidence of eggshell thinning was found for any of the species studied. DDE residues in clapper rail eggs were higher in New Jersey and Virginia than in South Carolina.

  4. Organochlorine residues and shell thickness in eggs of the clapper rail, common gallinule, purple gallinule, and limpkin (Class Aves), eastern and southern United States, 1972-74

    Science.gov (United States)

    Klaas, E.E.; Ohlendorf, H.M.; Cromartie, E.

    1980-01-01

    Organochlorine residues and shell thicknesses were surveyed in eggs of the clapper rail (Rallus longirostris), purple gallinule (Porphyrula martinica), common gallinule (Gallinula chloropas), and limpkin (Aramus guarauna) from the eastern and southern United States. Clapper rail eggs were collected during 1972-73 in New Jersey, Virginia, and South Carolina. During 1973-74, gallinule eggs were collected in Florida, South Carolina, and Louisiana, and limpkin eggs were collected in Florida. Egg contents were analyzed for residues of organochlorine pesticides, including DDT, TDE, DDE, dieldrin, mirex, heptachlor epoxide, oxychlordane, cis-chlordane (and/or trans-nonachlor), cis-nonachlor, hexachlorobenzene (HCB), toxaphene, and endrin, and for polychlorinated biphenyls (PCBs). Shell thicknesses of recent eggs of these species were compared with archival eggs that had been collected before 1947. With the exception of the limpkin, the majority of eggs analyzed contained residues of p,p'-DDE and PCBs. Geometric means ranged from 0.10 ppm to 1.3 ppm. Small amounts (less than 1.0 ppm) of mirex, dieldrin, cis-chlordane (and/or trans-nonachlor), TDE, and DDT were detected in a few eggs. No evidence of eggshell thinning was found for any of the species studied. DDE residues in clapper rail eggs were higher in New Jersey and Virginia than in South Carolina.

  5. Organic amendments for risk mitigation of organochlorine pesticide residues in old orchard soils

    Science.gov (United States)

    Centofantia, Tiziana; McConnell, Laura L.; Chaney, Rufus L.; Beyer, W. Nelson; Andradea, Natasha A.; Hapeman, Cathleen J.; Torrents, Alba; Nguyen, Anh; Anderson, Marya O.; Novak, J. M.; Jackson, Dana

    2015-01-01

    Performance of compost and biochar amendments for in situ risk mitigation of aged DDT, DDE and dieldrin residues in an old orchard soil was examined. The change in bioavailability of pesticide residues to Lumbricus terrestris L. relative to the unamended control soil was assessed using 4-L soil microcosms with and without plant cover in a 48-day experiment. The use of aged dairy manure compost and biosolids compost was found to be effective, especially in the planted treatments, at lowering the bioavailability factor (BAF) by 18–39%; however, BAF results for DDT in the unplanted soil treatments were unaffected or increased. The pine chip biochar utilized in this experiment was ineffective at lower the BAF of pesticides in the soil. The US EPA Soil Screening Level approach was used with our measured values. Addition of 10% of the aged dairy manure compost reduced the average hazard quotient values to below 1.0 for DDT + DDE and dieldrin. Results indicate this sustainable approach is appropriate to minimize risks to wildlife in areas of marginal organochlorine pesticide contamination. Application of this remediation approach has potential for use internationally in areas where historical pesticide contamination of soils remains a threat to wildlife populations.

  6. Organochlorine residues in tissues of marine fauna along the coast ...

    African Journals Online (AJOL)

    These findings highlight evidence of pollution of marine fauna at the Kenyan coastal sites. It is necessary to have thorough waste management programs as a strategy to minimize marine pollution. KEY WORDS: Environmental samples; Marine samples; Kenya-Mombasa coastline; Marine fauna, Organochlorine, Pesticides.

  7. Indoor residual spraying with a mixture of clothianidin (a neonicotinoid insecticide and deltamethrin provides improved control and long residual activity against pyrethroid resistant Anopheles gambiae sl in Southern Benin.

    Directory of Open Access Journals (Sweden)

    Corine Ngufor

    Full Text Available There is an urgent need for new insecticides for indoor residual spraying (IRS which can provide improved and prolonged control of malaria vectors that have developed resistance to existing insecticides. The neonicotinoid, clothianidin represents a class of chemistry new to public health. Clothianidin acts as an agonist on nicotinic acetyl choline receptors. IRS with a mixture of Clothianidin and another WHO approved insecticide such as deltamethrin could provide improved control of insecticide resistant malaria vector populations and serve as a tool for insecticide resistance management.The efficacy and residual activity of a novel IRS mixture of deltamethrin and clothianidin was evaluated against wild pyrethroid resistant An. gambiae sl in experimental huts in Cove, Benin. Two application rates of the mixture were tested and comparison was made with clothianidin and deltamethrin applied alone. To assess the residual efficacy of the treatments on different local wall substrates, the inner walls of the experimental huts were covered with either cement, mud or plywood.Clothianidin demonstrated a clear delayed expression in mortality of wild pyrethroid resistant An. gambiae sl in the experimental huts which reached its full effect 120 hours after exposure. Overall mortality over the 12-month hut trial was 15% in the control hut and 24-29% in the deltamethrin-treated huts. The mixture of clothianidin 200mg/m2 and deltamethrin 25mg/m2 induced high overall hut mortality rates (87% on mud walls, 82% on cement walls and 61% on wooden walls largely due to the clothianidin component and high hut exiting rates (67-76% mostly due to the deltamethrin component. Mortality rates remained >80% for 8-9 months on mud and cement walls. The residual activity trend was confirmed by results from monthly in situ cone bioassays with laboratory susceptible An. gambiae Kisumu strain.IRS campaigns with the mixture of clothianidin plus deltamethrin have the potential to

  8. Indoor residual spraying with a mixture of clothianidin (a neonicotinoid insecticide) and deltamethrin provides improved control and long residual activity against pyrethroid resistant Anopheles gambiae sl in Southern Benin.

    Science.gov (United States)

    Ngufor, Corine; Fongnikin, Augustin; Rowland, Mark; N'Guessan, Raphael

    2017-01-01

    There is an urgent need for new insecticides for indoor residual spraying (IRS) which can provide improved and prolonged control of malaria vectors that have developed resistance to existing insecticides. The neonicotinoid, clothianidin represents a class of chemistry new to public health. Clothianidin acts as an agonist on nicotinic acetyl choline receptors. IRS with a mixture of Clothianidin and another WHO approved insecticide such as deltamethrin could provide improved control of insecticide resistant malaria vector populations and serve as a tool for insecticide resistance management. The efficacy and residual activity of a novel IRS mixture of deltamethrin and clothianidin was evaluated against wild pyrethroid resistant An. gambiae sl in experimental huts in Cove, Benin. Two application rates of the mixture were tested and comparison was made with clothianidin and deltamethrin applied alone. To assess the residual efficacy of the treatments on different local wall substrates, the inner walls of the experimental huts were covered with either cement, mud or plywood. Clothianidin demonstrated a clear delayed expression in mortality of wild pyrethroid resistant An. gambiae sl in the experimental huts which reached its full effect 120 hours after exposure. Overall mortality over the 12-month hut trial was 15% in the control hut and 24-29% in the deltamethrin-treated huts. The mixture of clothianidin 200mg/m2 and deltamethrin 25mg/m2 induced high overall hut mortality rates (87% on mud walls, 82% on cement walls and 61% on wooden walls) largely due to the clothianidin component and high hut exiting rates (67-76%) mostly due to the deltamethrin component. Mortality rates remained >80% for 8-9 months on mud and cement walls. The residual activity trend was confirmed by results from monthly in situ cone bioassays with laboratory susceptible An. gambiae Kisumu strain. IRS campaigns with the mixture of clothianidin plus deltamethrin have the potential to provide

  9. Acceptability and perceived side effects of insecticide indoor residual spraying under different resistance management strategies

    Directory of Open Access Journals (Sweden)

    Rodríguez Américo David

    2006-01-01

    Full Text Available OBJECTIVE: To assess household acceptability and perceived side effects of residual indoor pyrethroid (PYR, carbamate and organophosphate insecticides sprayed by annual rotation (ROT, spatial mosaic (MOS, and a single insecticide (DDT or PYR in communities of the coastal plain of Chiapas, Mexico. MATERIAL AND METHODS: A questionnaire to assess the acceptability and perceived side effects of indoor insecticides was administered to one member of 30% of the families in eight villages of Chiapas. The association of different insecticide treatments with their responses was evaluated (Chi-square. The intensity of side effects indicated under different treatments was compared in an ordered logistic model, using a severity index as the response variable. RESULTS: Insecticide spraying as a probable cause of symptoms was identified by 2.1% of interviewees. A significantly high percentage of persons with blurred vision, dizziness, sneezing, coughing, numbness, watery eyes, and itching lived in villages under MOS and ROT and a high severity index was significantly associated with ROT treatment. Reduction of mosquito bites and cockroaches were the perceived main benefits, and most villagers that perceived no benefits lived in DDT treated villages. Most of the interviewees welcomed spraying (83.7%, but the smell and having to remove furniture from houses were the main arguments against it. CONCLUSIONS: Acceptability correlated with insecticide spray coverage, although the most frequent suggestion for improvement was to increase the understanding of the objectives of spraying in the communities. The frequency of side effects was low, but higher in localities where a combination of insecticides was applied. This is a limitation for the use of this type of resistance management strategy in public health.

  10. Current Perspectives on Plague Vector Control in Madagascar: Susceptibility Status of Xenopsylla cheopis to 12 Insecticides.

    Science.gov (United States)

    Miarinjara, Adélaïde; Boyer, Sébastien

    2016-02-01

    Plague is a rodent disease transmissible to humans by infected flea bites, and Madagascar is one of the countries with the highest plague incidence in the world. This study reports the susceptibility of the main plague vector Xenopsylla cheopis to 12 different insecticides belonging to 4 insecticide families (carbamates, organophosphates, pyrethroids and organochlorines). Eight populations from different geographical regions of Madagascar previously resistant to deltamethrin were tested with a World Health Organization standard bioassay. Insecticide susceptibility varied amongst populations, but all of them were resistant to six insecticides belonging to pyrethroid and carbamate insecticides (alphacypermethrin, lambdacyhalothrin, etofenprox, deltamethrin, bendiocarb and propoxur). Only one insecticide (dieldrin) was an efficient pulicide for all flea populations. Cross resistances were suspected. This study proposes at least three alternative insecticides (malathion, fenitrothion and cyfluthrin) to replace deltamethrin during plague epidemic responses, but the most efficient insecticide may be different for each population studied. We highlight the importance of continuous insecticide susceptibility surveillance in the areas of high plague risk in Madagascar.

  11. Organochlorine residue levels in livers of birds of prey from Spain: Inter-species comparison in relation with diet and migratory patterns

    Energy Technology Data Exchange (ETDEWEB)

    Drooge, Barend van [Laboratory of Toxicology, Faculty of Veterinary, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Mateo, Rafael [Instituto de Investigacion en Recursos Cinegeticos, IREC (CSIC-UCLM), Ronda de Toledo s/n, 13071 Ciudad Real (Spain); Vives, Ingrid [Laboratory of Toxicology, Faculty of Veterinary, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Cardiel, Iris [Instituto de Investigacion en Recursos Cinegeticos, IREC (CSIC-UCLM), Ronda de Toledo s/n, 13071 Ciudad Real (Spain); Guitart, Raimon [Laboratory of Toxicology, Faculty of Veterinary, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain)], E-mail: raimon.guitart@uab.cat

    2008-05-15

    Livers from 130 specimens corresponding to 18 species of raptors from Spain were analysed for persistent organochlorine (OC) residues. In all species, p,p'-DDE was the most abundant individual OC compound detected, with geometric means ranging from 61 to 40,086 ng/g ww. The geometric mean for {sigma}PCB ranged from 225 to 9184 ng/g ww. Migration to Africa, south of Sahara, where p,p'-DDT is still in use, was not associated with higher liver concentrations of its metabolite, p,p'-DDE. The presence of birds in the diet of the species was an important species-specific factor determining the mean liver concentrations of p,p'-DDE and {sigma}PCB. The effect of the diet on OC concentrations in liver is explained by the lower metabolising capacity of OC compounds in birds, especially for p,p'-DDE. - The contribution of bird biomass in the diet is a determining factor for the accumulation of organochlorines in raptors.

  12. Organochlorine residue levels in livers of birds of prey from Spain: Inter-species comparison in relation with diet and migratory patterns

    International Nuclear Information System (INIS)

    Drooge, Barend van; Mateo, Rafael; Vives, Ingrid; Cardiel, Iris; Guitart, Raimon

    2008-01-01

    Livers from 130 specimens corresponding to 18 species of raptors from Spain were analysed for persistent organochlorine (OC) residues. In all species, p,p'-DDE was the most abundant individual OC compound detected, with geometric means ranging from 61 to 40,086 ng/g ww. The geometric mean for ΣPCB ranged from 225 to 9184 ng/g ww. Migration to Africa, south of Sahara, where p,p'-DDT is still in use, was not associated with higher liver concentrations of its metabolite, p,p'-DDE. The presence of birds in the diet of the species was an important species-specific factor determining the mean liver concentrations of p,p'-DDE and ΣPCB. The effect of the diet on OC concentrations in liver is explained by the lower metabolising capacity of OC compounds in birds, especially for p,p'-DDE. - The contribution of bird biomass in the diet is a determining factor for the accumulation of organochlorines in raptors

  13. Preconcentration of Trace Neonicotinoid Insecticide Residues Using Vortex-Assisted Dispersive Micro Solid-Phase Extraction with Montmorillonite as an Efficient Sorbent

    Directory of Open Access Journals (Sweden)

    Khwankaew Moyakao

    2018-04-01

    Full Text Available In this work, we investigated montmorillonite for adsorption of neonicotinoid insecticides in vortex-assisted dispersive micro-solid phase extraction (VA-d-μ-SPE. High-performance liquid chromatography with photodiode array detection was used for quantification and determination of neonicotinoid insecticide residues, including thiamethoxam, clothianidin, imidacloprid, acetamiprid, and thiacloprid. In this method, the solid sorbent was dispersed into the aqueous sample solution and vortex agitation was performed to accelerate the extraction process. Finally, the solution was filtered from the solid sorbent with a membrane filter. The parameters affecting the extraction efficiency of the proposed method were optimized, such as amount of sorbent, sample volume, salt addition, type and volume of extraction solvent, and vortex time. The adsorbing results show that montmorillonite could be reused at least 4 times and be used as an effective adsorbent for rapid extraction/preconcentration of neonicotinoid insecticide residues. Under optimum conditions, linear dynamic ranges were achieved between 0.5 and 1000 ng mL−1 with a correlation of determination (R2 greater than 0.99. Limit of detection (LOD ranged from 0.005 to 0.065 ng mL−1, while limit of quantification (LOQ ranged from 0.008 to 0.263 ng mL−1. The enrichment factor (EF ranged from 8 to 176-fold. The results demonstrated that the proposed method not only provided a more simple and sensitive method, but also can be used as a powerful alternative method for the simultaneous determination of insecticide residues in natural surface water and fruit juice samples.

  14. Agrochemical residues in rivers sediments, Poas, Costa Rica

    International Nuclear Information System (INIS)

    Masis, Federico; Valdez, Juan; Leon, Sandra; Coto, Tatiana

    2008-01-01

    The organophosphorus and organochlorine agrochemical residues distribution in sediments of 3 rivers located in an ornamental plant production area were analyzed in Poas canton, Alajuela, Costa Rica. The study comprised 8 months in order to assure 3 seasonal episodes: dry, transitional, and rainy seasons. Sediments were taken in 10 sampling stations along the rivers and characterized by a determination of their organic matter and texture. In 7 out of 10 sampling stations pesticide residues were detected in at least 1 of 4 samplings, but quantified only in 4 stations. Agrochemical residues evaluated included 21 organophosphorus and organochlorine pesticides; however, we found residues of only 3 organochlorine pesticides, due their high persistence in the sediment. Residues corresponded to PCNB (80-800 μg.kg -1 ), Endosulfan-β (40-50 μg.kg -1 ), and Endosulfan-α (90 μg.kg -1 ). Chlorothalonil was detected in only one sample. (author) [es

  15. Organochlorine pesticide residues in human breast milk and placenta in Tohoku, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Nakai, K.; Suzuki, K.; Oka, T.; Sugawara, N.; Ohba, T.; Kameo, S.; Satoh, H. [Environmental Heath Sciences, Tohoku Univ. Graduate School of Medicine, Sendai (Japan); Nakamura, T.; Saitoh, Y. [Miyagi Prefectural Inst. of Piblic Health and Environment (Japan); Okamura, K. [Dept. of Obstetrics, Tohoku Univ. Graduate School of Medicine, Sendai (Japan)

    2004-09-15

    Recently, we have started a birth cohort study to examine the effects of exposure to persistent organochemical pollutants and heavy metals on neurodevelopment in Japanese children, The Tohoku Study of Child Development. In this cohort study, biological samples, including maternal peripheral blood, cord blood, placenta, cord tissue, and breast milk have been collected from more than six hundred mother-infant pairs for chemical determinations. The growth of infants has been monitored using neurodevelopmental tests, including the Brazelton Neonatal Behavioral Assessment Scale, the Bayley Scale of Infant Development, the Kyoto Scale of Psychological Development, and others. Exposures to dioxin and related compounds, polychlorinated biphenyls, methylmercury, and several heavy metals were assessed. Additionally, since perinatal exposure to organochlorine pesticides may affect the neurodevelopment of children, we examined the effects of those pesticides in the cohort study. In the present study, several organochlorine pesticides were analyzed in human breast milk and placenta from 20 mothers to identify the major pesticide compounds found in the cohort subjects. The relationship between pesticides in breast milk and the placenta was analyzed to examine the utilization of the placenta as the material for exposure assessment. Some information regarding the factors affecting the contamination of breast milk and the placenta with organochlorine pesticides are also discussed.

  16. Evaluation of Residues of D.D.T and D.D.A in Fish Collected from Caspian Sea, Iran

    Directory of Open Access Journals (Sweden)

    Mohammad Shokrzadeh lamuki

    2012-11-01

    Full Text Available Background: Pesticides are essential in modern agricultural practices but due to their biocide activity and potential risk to the consumer, the control of pesticide residues in foods is a growing source of concern for the general population. Extensive application of such agents as organochlorine pesticides in farmlands and contemporary agricultural industries has led to undesired environmental contamination and human health hazards. Thus, this study attempted to evaluate and analyze the residual values of the organochlorine insecticide D.D.T and its metabolite D.D.A in the four species of most consumed fish collected from the Caspian Sea. Methods: In this investigation, concentrations of residual values of D.D.T and D.D.A were quantitatively determined in the 4 species of fish sampled from 4 major fishing centers (Chalous and Babolsar cities and Khazar Abad and Miankaleh regions in Mazandaran province, Iran, using gas chromatography electron-capture detection (GC–ECD in 2008. Results: The results showed that the highest values of D.D.T were in Mugil auratns (0.033±0.008 mg/kg and Rutilus frisikutum (0.031±0.007 mg/kg fishes collected from Babolsar sampling center. Conclusion: Concentrations of D.D.T and D.D.A in the fish were found to be less than the standard permissible intake.

  17. Organochlorine residues in harbour porpoises from Southwest Greenland

    Energy Technology Data Exchange (ETDEWEB)

    Borrell, Asuncion; Aguilar, Alex; Cantos, Gemma; Lockyer, Christina; Heide-Joergensen, Mads Peter; Jensen, Jette

    2004-02-01

    During the 1995 hunting season, 75 harbour porpoises (Phocoena phocoena) were sampled in three locations in West Greenland: Maniitsoq, Nuuk, and Paamiut. Sex, age, morphometrics, reproductive condition, and organochlorine compound (OC) levels in blubber were determined for each individual. OC levels were extremely low and, therefore considered unlikely to affect the population adversely: mean blubber concentrations, expressed on lipid weight basis were 1.98 (S.D.=1.1) mg/kg for PCBs, 2.76 (S.D.=1.66) mg/kg for tDDT and 0.21 (S.D.=0.11) mg/kg for HCB. No statistical differences were observed among individuals caught in the various locations. OC concentrations showed statistically significant positive associations with age in males but negative in females; consequently, mature females presented lower pollutant loads than their male counterparts. Juveniles did not show differences between sexes. A higher proportion of less chlorinated and more metabolizable polychlorinated biphenyls (PCBs) compared to tPCBs was found in calves (age<=1) than in mature females, indicating that the feeding habits of these two groups differ and that a greater transfer of less chlorinated compounds is passed from females to their pups through lactation and parturition. Harbour porpoises significantly contribute to the dietary intake of OCs by local Inuit populations. This contribution could be reduced if mature males were selectively avoided; however, current hunting procedures make this selection impracticable. - While organochlorine levels in W. Greenland harbour porpoises are low, their contribution to Inuit dietary intake should not be disregarded.

  18. Organochlorine residues in harbour porpoises from Southwest Greenland

    International Nuclear Information System (INIS)

    Borrell, Asuncion; Aguilar, Alex; Cantos, Gemma; Lockyer, Christina; Heide-Joergensen, Mads Peter; Jensen, Jette

    2004-01-01

    During the 1995 hunting season, 75 harbour porpoises (Phocoena phocoena) were sampled in three locations in West Greenland: Maniitsoq, Nuuk, and Paamiut. Sex, age, morphometrics, reproductive condition, and organochlorine compound (OC) levels in blubber were determined for each individual. OC levels were extremely low and, therefore considered unlikely to affect the population adversely: mean blubber concentrations, expressed on lipid weight basis were 1.98 (S.D.=1.1) mg/kg for PCBs, 2.76 (S.D.=1.66) mg/kg for tDDT and 0.21 (S.D.=0.11) mg/kg for HCB. No statistical differences were observed among individuals caught in the various locations. OC concentrations showed statistically significant positive associations with age in males but negative in females; consequently, mature females presented lower pollutant loads than their male counterparts. Juveniles did not show differences between sexes. A higher proportion of less chlorinated and more metabolizable polychlorinated biphenyls (PCBs) compared to tPCBs was found in calves (age<=1) than in mature females, indicating that the feeding habits of these two groups differ and that a greater transfer of less chlorinated compounds is passed from females to their pups through lactation and parturition. Harbour porpoises significantly contribute to the dietary intake of OCs by local Inuit populations. This contribution could be reduced if mature males were selectively avoided; however, current hunting procedures make this selection impracticable. - While organochlorine levels in W. Greenland harbour porpoises are low, their contribution to Inuit dietary intake should not be disregarded

  19. Insecticide treated curtains and residual insecticide treatment to control Aedes aegypti: An acceptability study in Santiago de Cuba.

    Directory of Open Access Journals (Sweden)

    Dennis Pérez

    2018-01-01

    Full Text Available Within the context of a field trial conducted by the Cuban vector control program (AaCP, we assessed acceptability of insecticide-treated curtains (ITCs and residual insecticide treatment (RIT with deltamethrin by the community. We also assessed the potential influence of interviewees' risk perceptions for getting dengue and disease severity.We embedded a qualitative study using in-depth interviews in a cluster randomized trial (CRT testing the effectiveness of ITCs and RIT in Santiago de Cuba. In-depth interviews (N = 38 were conducted four and twelve months after deployment of the tools with people who accepted the tools, who stopped using them and who did not accept the tools. Data analysis was deductive. Main reasons for accepting ITCs at the start of the trial were perceived efficacy and not being harmful to health. Constraints linked to manufacturer instructions were the main reason for not using ITCs. People stopped using the ITCs due to perceived allergy, toxicity and low efficacy. Few heads of households refused RIT despite the noting reasons for rejection, such as allergy, health hazard and toxicity. Positive opinions of the vector control program influenced acceptability of both tools. However, frequent insecticide fogging as part of routine AaCP vector control actions diminished perceived efficacy of both tools and, therefore, acceptability. Fifty percent of interviewees did feel at risk for getting dengue and considered dengue a severe disease. However, this did not appear to influence acceptability of ITCs or RIT.Acceptability of ITCs and RIT was linked to acceptability of AaCP routine vector control activities. However, uptake and use were not always an indication of acceptability. Factors leading to acceptability may be best identified using qualitative methods, but more research is needed on the concept of acceptability and its measurement.

  20. Insecticide treated curtains and residual insecticide treatment to control Aedes aegypti: An acceptability study in Santiago de Cuba.

    Science.gov (United States)

    Pérez, Dennis; Van der Stuyft, Patrick; Toledo, María Eugenia; Ceballos, Enrique; Fabré, Francisco; Lefèvre, Pierre

    2018-01-01

    Within the context of a field trial conducted by the Cuban vector control program (AaCP), we assessed acceptability of insecticide-treated curtains (ITCs) and residual insecticide treatment (RIT) with deltamethrin by the community. We also assessed the potential influence of interviewees' risk perceptions for getting dengue and disease severity. We embedded a qualitative study using in-depth interviews in a cluster randomized trial (CRT) testing the effectiveness of ITCs and RIT in Santiago de Cuba. In-depth interviews (N = 38) were conducted four and twelve months after deployment of the tools with people who accepted the tools, who stopped using them and who did not accept the tools. Data analysis was deductive. Main reasons for accepting ITCs at the start of the trial were perceived efficacy and not being harmful to health. Constraints linked to manufacturer instructions were the main reason for not using ITCs. People stopped using the ITCs due to perceived allergy, toxicity and low efficacy. Few heads of households refused RIT despite the noting reasons for rejection, such as allergy, health hazard and toxicity. Positive opinions of the vector control program influenced acceptability of both tools. However, frequent insecticide fogging as part of routine AaCP vector control actions diminished perceived efficacy of both tools and, therefore, acceptability. Fifty percent of interviewees did feel at risk for getting dengue and considered dengue a severe disease. However, this did not appear to influence acceptability of ITCs or RIT. Acceptability of ITCs and RIT was linked to acceptability of AaCP routine vector control activities. However, uptake and use were not always an indication of acceptability. Factors leading to acceptability may be best identified using qualitative methods, but more research is needed on the concept of acceptability and its measurement.

  1. Concentration-Response and Residual Activity of Insecticides to Control Herpetogramma phaeopteralis (Lepidoptera: Crambidae) in St. Augustinegrass.

    Science.gov (United States)

    Tofangsazi, Nastaran; Cherry, Ron H; Beeson, Richard C; Arthurs, Steven P

    2015-04-01

    Tropical sod webworm, Herpetogramma phaeopteralis Guenée, is an important pest of warm-season turfgrass in the Gulf Coast states of the United States, the Caribbean Islands, and Central America. Current control recommendations rely on topical application of insecticides against caterpillars. The objective of this study was to generate resistance baseline data of H. phaeopteralis to six insecticide classes. Residual activity of clothianidin, chlorantraniliprole, and bifenthrin was also compared under field conditions in Central Florida. Chlorantraniliprole was the most toxic compound tested (LC50 value of 4.5 ppm), followed by acephate (8.6 ppm), spinosad (31.1 ppm), clothianidin (46.6 ppm), bifenthrin (283 ppm) and Bacillus thuringiensis kurstaki, (342 ppm). In field tests, all compounds at label rates were effective (≥94% mortality of larvae exposed to fresh residues). However, a more rapid decline in activity of clothianidin and bifenthrin was observed compared with chlorantraniliprole. Clothianidin had no statistically detectable activity after 4 wk post-application in spring and the fall, and bifenthrin had no detectable activity after 3 wk in the spring and the fall. However, chlorantraniliprole maintained significant activity (≥84% mortality) compared with other treatments throughout the 5-wk study period. This study provides new information regarding the relative toxicities and persistence of current insecticides used for H. phaeopteralis and other turfgrass caterpillars. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  2. Organochlorine residues in some dolphin specimens stranded on Southern Adriatic Coasts (Italy)

    International Nuclear Information System (INIS)

    Storelli, M.M.; Giacominelli Stuffler, R.; Ceci, E.; Marcotrigiano, G.O.

    1999-01-01

    This paper reports the concentration of PCBs and organochlorine compounds and percentage composition of the different PCB congeners in various tissues from four different species of cetaceans stranded on the Adriatic coast of Italy in July-September 1995

  3. Screening of the presence organophosphates and organochlorines pesticide residues in vegetables and fruits using gas chromatography-mass spectrometry

    Science.gov (United States)

    Putri, Dillani; Aryana, Nurhani; Aristiawan, Yosi; Styarini, Dyah

    2017-01-01

    Pesticides is commonly used to improve the quality of agricultural product, especially in vegetables and fruits. Due to pesticide residues in the product become a concern to consumer health, monitoring and analysis of pesticide residues in agriculture product need to be established. The certified reference material (CRM) is often benefited to obtain accurate results in analysis. It is required as the quality control to improve quality assurance of the testing results. Unfortunately in Indonesia, the development of matrix CRM for the analysis of pesticide residues in vegetables and fruits is still limited. This study is aimed to determine the type of commodity and target analyte to be employed in the development of CRM for pesticides in vegetables and fruits. As the preliminary study, the screening of 11 commodities of fresh vegetables and fruits has been conducted to review the information about the presence of organophosphates (OPs) and organochlorines (OCs) in the sample. In this analysis, QuEChERS technique was used in the extraction process and the qualitative analysis was evaluated by using GC-MS. The results showed that strawberry and celery contain residues of pesticide chlorpyrifos. Further analysis of the commodity celery from seven different places has been conducted, resulting that from 3 of all 7 samples (43%) were positive containing chlorpyrifos. Therefore, the development of CRM for chlorpyrifos in celery will be our next research project.

  4. Organochlorines in common dolphins caught in shark nets during ...

    African Journals Online (AJOL)

    The concentrations of organochlorines were determined in blubber and liver samples from common dolphins inhabiting the coastal waters of the south-east coast of southern Africa. Liver levels of PCBs and DDTs are far lower and do not appear directly associated with those in blubber. In males, blubber residue ...

  5. Accumulation features of persistent organochlorines in resident and migratory birds from Asia

    International Nuclear Information System (INIS)

    Kunisue, Tatsuya; Watanabe, Mafumi; Subramanian, Annamalai; Sethuraman, Alagappan; Titenko, Alexei M.; Qui, Vo; Prudente, Maricar; Tanabe, Shinsuke

    2003-01-01

    Accumulation features of persistent organochlorines in migratory birds from Asia did not necessarily reflect only the pollution in the sampling area. - Concentrations of organochlorine contaminants including polychlorinated biphenyls (PCBs), dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexane isomers (HCHs), chlordane compounds (CHLs), hexachlorobenzene (HCB) were determined in the resident and migratory birds, which were collected from India, Japan, Philippines, Russia (Lake Baikal) and Vietnam. Accumulation patterns of organochlorine concentrations in resident birds suggested that the predominant contaminants of each country were as follows: Japan-PCBs Philippines-PCBs and CHLs, India-HCHs and DDTs, Vietnam-DDTs, and Lake Baikal-PCBs and DDTs. The migratory birds from Philippines and Vietnam retained mostly the highest concentrations of DDTs among the organochlorines analyzed, indicating the presence of stopover and breeding grounds of those birds in China and Russia. On the other hand, migratory birds from India and Lake Baikal showed different patterns of organochlorine residues, reflecting that each species has inherent migratory routes and thus has exposure to different contaminants. Species which have breeding grounds around the Red Sea and Persian Gulf showed high levels of PCBs, indicating the presence of areas heavily polluted by PCBs in the Middle East

  6. Northern Alabama colonies of the endangered grey bat Myotis grisescens: Organochlorine contamination and mortality

    Science.gov (United States)

    Clark, D.R.; Bagley, F.M.; Johnson, W.W.

    1988-01-01

    From 1976 to 1986, dead and dying grey bats Myotis grisescens and grey bat guano were collected from caves along the Tennessee River in northern Alabama to determine the possible role of organochlorine chemicals.sbd.in particular wastes from a former DDT manufacturing plant near Huntsville.sbd.in the mortalities. Concentrations of chemical residues in brains were less than known lethal levels: certain observations and analyses did indicate the possibility of past organochlorine-induced bat deaths. Levels of contaminants in bats declined slowly during the 10-year sampling period, but heavy residue burdens persist. The high ratio of DDD to DDE in residue from the former DDT plant made them identifiable as far as 140 km downriver. Grey bats concentrated chemical rsidues to higher levels and demonstrated the presence of these residues over much greater distances than did red-winged blackbirds Agelaius phoeniceus. Grey bats may be the most sensitive indicator available for monitoring the contamination from this former DDT manufacturing site.

  7. Detection of residual organochlorine and organophosphorus pesticides in agricultural soil in Rio Verde region of San Luis Potosi, Mexico.

    Science.gov (United States)

    Velasco, Antonio; Hernández, Sergio; Ramírez, Martha; Ortíz, Irmene

    2014-01-01

    Organochlorine pesticides were intensively used in Mexico from 1950 until their ban and restriction in 1991. However, the presence of these compounds is commonly reported in many regions of the country. The aim of the present study was to identify and quantify residual organochlorine and organophosphorus pesticides in agricultural soil in Rio Verde region, San Luis Potosi state, which has been identified as possibly polluted by pesticides. Composed samples from 24 zones covering an area of approximately 5,440 ha were analyzed. The most frequently found pesticides were p,p'-DDT followed by ,p,p'-DDE, heptachlor, endosulfan and γ-HCH whose frequency rates were 100, 91, 83 and 54%, respectively. The concentration of p,p'-DDT in the crops grown in these soils was in the following order: chili > maize > tomato > alfalfa. The results obtained in this study show that p,p'-DDT values are lower or similar to those found in other agricultural regions of Mexico. Methyl and ethyl parathion were the most frequent organophosphate pesticide detected in 100% and 62.5% of the samples with average concentrations of 25.20 and 47.48 μg kg(-1), respectively. More research is needed to establish the background levels of pesticides in agricultural soils and their potential ecological and human health effects in this region.

  8. Novel and viable acetylcholinesterase target site for developing effective and environmentally safe insecticides.

    Science.gov (United States)

    Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

    2012-04-01

    Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.

  9. Risk Analysis on Organochlorine Pesticides Residue in Potato and Carrot from Conventional and Organic Farms in Citarum Watershed Area, West Java Province, Indonesia

    Directory of Open Access Journals (Sweden)

    Suphia Rahmawati

    2017-03-01

    Full Text Available Six samples of carrot and potatoes were collected from conventional and organic farms. Organochlorine pesticides (OCPs residue was analyzed using liquid-liquid extraction. The concentration of OCPs residue together with the consumption pattern were used to calculate the potential risk. Estimated Daily Intake (EDI of OCPs residue in carrots and potatoes both from conventional and organic farms were below the standard given in SNI 7313:2008 and the Maximum Residue Limit (MRLs from USEPA . Hazard quotient (HQ and Hazard Index (HI as effect analysis were below the unity, thus there may not be a concern for non-carcinogenic effect. Risk analysis on cancer effects indicated that potatoes samples were above the recommended risk by EPA (10-6. In addition, risk of potatoes samples from organic samples was higher compare to that of the conventional farm. Cancer risk analysis of carrot samples were found below the recommended risk by EPA. Cancer risk effect of carrot samples from conventional farm was slightly higher compare to that of the organic farm.

  10. Organochlorine pesticide levels in female adipose tissue from Puebla, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Sanchez, K; Caba, M; Saldariaga-Noreña, H; Meza, E; Zepeda, R; Valencia Quintana, R; Infanzon, R

    2012-02-01

    The objective of this study was to determine the levels of organochlorine pesticides HCB, α-β-γ-HCH, pp'DDE, op'DDT and pp'DDT in adipose tissue of females living in Puebla, Mexico. Organochlorine pesticides were analyzed in 75 abdominal adipose tissue samples taken during 2010 by autopsy at the Forensic Services of Puebla. The results were expressed as mg/kg on fat basis. In analyzed samples the following pesticides were detected: p,p'-DDE in 100% of samples at mean 1.464 mg/kg; p,p'-DDT in 96.0.% of samples at mean 0.105 mg/kg; op'DDT in 89.3% of monitored samples at mean 0.025 mg/kg and β-HCH in 94.7% of the samples at mean 0.108 mg/kg. To show if organochlorine pesticide levels in monitored female's adipose tissues are age dependant, the group was divided in three ages ranges (13-26, 26-57 and 57-96 years). The mean and median levels of all organochlorine pesticides increase significantly (p 0.05). The present results compared to previous ones from 2008 indicates an increase in the concentrations during the 2010 study, but only the differences for pp'DDE and op'DDT were statistically significant. The 2010 group of females was older compared to the 2008 group. The presence of organochlorine pesticide residues is still observed, indicating uniform and permanent exposure to the pesticides by Puebla inhabitants.

  11. Residual Acute Toxicity of Some Modern Insecticides Toward Two Mirid Predators of Tomato Pests.

    Science.gov (United States)

    Wanumen, Andrea C; Carvalho, Geraldo A; Medina, Pilar; Viñuela, Elisa; Adán, Ángeles

    2016-03-31

    The successful integration of chemical and biological control strategies for crop pests depends on a thorough evaluation of the effects of pesticides on the natural enemies of pests. A case-by-case review is difficult to achieve because of the many combinations of pests, natural enemies, and crops that need to be tested. Within this framework, we tested and compared seven insecticides representative of four different modes of action (MoAs) groups on closely related predators (Miridae): flubendiamide, spirotetramat, metaflumizone, and sulfoxaflor onNesidiocoris tenuisReuter and flubendiamide, spiromesifen, indoxacarb, and imidacloprid onMacrolophus basicornis(Stal). We follow the standardized methodology of the International Organization for Biological Control, a sequential testing exposure scheme. The lethal effect of each insecticide was evaluated in adults after three days of contact with treated surfaces in the laboratory, extended laboratory, and semifield tests (inert substrate, tomato leaves, and tomato plant as the treated surface, respectively). Flubendiamide, spiromesifen, and spirotetramat were classified as harmless (class 1), metaflumizone was slightly harmful (class 2) but persistent, indoxacarb was harmless (class 1), and sulfoxaflor and imidacloprid were toxic (class 4) and exhibited a long residual activity. Our results suggest similarities in the acute toxicities of insecticides from the same MoA group on related species of natural enemies. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  12. Pest Prevalence and Evaluation of Community-Wide Integrated Pest Management for Reducing Cockroach Infestations and Indoor Insecticide Residues.

    Science.gov (United States)

    Zha, Chen; Wang, Changlu; Buckley, Brian; Yang, Ill; Wang, Desen; Eiden, Amanda L; Cooper, Richard

    2018-04-02

    Pest infestations in residential buildings are common, but community-wide pest survey data are lacking. Frequent insecticide applications for controlling indoor pests leave insecticide residues and pose potential health risks to residents. In this study, a community-wide pest survey was carried out in a housing complex consisting of 258 units in 40 buildings in New Brunswick, New Jersey. It was immediately followed by implementation of an integrated pest management (IPM) program in all the cockroach-infested apartments and two bed bug apartments with the goal of eliminating pest infestations, reducing pyrethroid residues, and increasing resident satisfaction with pest control services. The IPM-treated apartments were revisited and treated biweekly or monthly for 7 mo. Initial inspection found the top three pests and their infestation rates to be as follows: German cockroaches (Blattella germanica L. [Blattodea: Blattellidae]), 28%; rodents, 11%; and bed bugs (Cimex lectularius L. [Hemiptera: Cimicidae]), 8%. Floor wipe samples were collected in the kitchens and bedrooms of 20 apartments for pyrethroid residue analysis before the IPM implementation; 17 of the 20 apartments were resampled again at 7 mo. The IPM program reduced cockroach counts per apartment by 88% at 7 wk after initial treatment. At 7 mo, 85% of the cockroach infestations found in the initial survey were eliminated. The average number of pyrethroids detected decreased significantly from 6 ± 1 (mean ± SEM) and 5 ± 1 to 2 ± 1 and 3 ± 1 in the kitchens and bedrooms, respectively. The average concentrations of targeted pyrethroids residue also decreased significantly in the kitchens and bedrooms.

  13. Evaluation of organochlorine pesticides in serum from students in Coimbra, Portugal: 1997-2001

    International Nuclear Information System (INIS)

    Lino, Celeste Matos; Silveira, M. Irene Noronha da

    2006-01-01

    In 1997, 1999, 2000, and 2001, in an attempt to evaluate the contamination level of a Portuguese population, organochlorine pesticide residues were evaluated in human serum from students of the University of Coimbra. Concentrations of selected organochlorine pollutants (α-, β-, and γ-HCH, aldrin, dieldrin, HE, HCB, p,p'-DDT, o,p'-DDT, p,p'-DDE, p,p'-DDD) and endosulfan sulfate was measured with gas chromatography-electron capture detector. Our objective is to point out the general levels of pesticide contamination and the differences between the four populations; and together with this, if a connection could be established with gender or the residence area of the subjects. Endosulfan sulfate, p,p'-DDE, o,p'-DDT, and p,p'-DDD were the most frequently identified residues. Endosulfan sulfate present the highest concentrations for all subjects, 42.6 μg/l, with concentrations ranging from undetected to 1295.5 μg/l. Between DDT, isomers, and analogues, o,p'-DDT, and p,p'-DDT presented the highest levels, 24.8 and 21.9 μg/l, respectively. Mean total DDT levels were higher than mean total HCH levels. For Σ-DDT, the highest levels were found among female gender and urban samples. An opposite situation was found in Σ-HCH: males presented higher levels than females. The mean concentration of organochlorine pesticide residues, present in the student populations, showed that it is among the highest levels of contamination, when compared with others from Europe, Asia, and America

  14. The crop-residue of fiber hemp cv. Futura 75: from a waste product to a source of botanical insecticides.

    Science.gov (United States)

    Benelli, Giovanni; Pavela, Roman; Lupidi, Giulio; Nabissi, Massimo; Petrelli, Riccardo; Ngahang Kamte, Stephane L; Cappellacci, Loredana; Fiorini, Dennis; Sut, Stefania; Dall'Acqua, Stefano; Maggi, Filippo

    2018-04-01

    In the attempt to exploit the potential of the monoecious fiber hemp cv. Futura 75 in new fields besides textile, cosmetics and food industry, its crop-residue given by leaves and inflorescences was subjected to hydrodistillation to obtain the essential oils. These are niche products representing an ideal candidate for the development of natural insecticides for the control and management of mosquito vectors, houseflies and moth pests. After GC-MS analysis highlighting a safe and legal chemical profile (THC in the range 0.004-0.012% dw), the leaf and inflorescence essential oils were investigated for the insecticidal potential against three insect targets: the larvae of Culex quinquefasciatus and Spodoptera littoralis and the adults of Musca domestica. The essential oil from inflorescences, showing (E)-caryophyllene (21.4%), myrcene (11.3%), cannabidiol (CBD, 11.1%), α-pinene (7.8%), terpinolene (7.6%), and α-humulene (7.1%) as the main components, was more effective than leaf oil against these insects, with LD 50 values of 65.8 μg/larva on S. littoralis, 122.1 μg/adult on M. domestica, and LC 50 of 124.5 μl/l on C. quinquefasciatus larvae. The hemp essential oil moderately inhibited the acetylcholinesterase (AChE), which is a target enzyme in pesticide science. Overall, these results shed light on the future application of fiber hemp crop-residue for the development of effective, eco-friendly and sustainable insecticides.

  15. Insecticides authorized for use on olive trees and the relationship between their registration and residues in olive oil

    Directory of Open Access Journals (Sweden)

    Lentza-Rizos, Ch.

    1996-12-01

    Full Text Available In order to eliminate losses due to insect attack, several insecticides are used on olive trees. Their residues in olive oil constitute an important parameter of its quality and must be monitored regularly and kept as low possible in order to ensure consumer protection. In this paper the insecticides authorized for use on olive trees are listed and their ADIs and Codex Alimentarius MRLs reported. The existing registrations are discussed from the point of view of their residues in oil.

    Diversos insecticidas son usados para eliminar las pérdidas debidas al ataque de insectos en olivos. Sus residuos en el aceite de oliva constituyen un parámetro importante de su calidad y deben ser controlados con regularidad y mantenidos tan bajos como sea posible en orden a asegurar la protección del consumidor. En este artículo se incluyen los distintos insecticidas autorizados para su uso en olivos así como los valores de ingesta diaria aceptable para el hombre y los límites máximos autorizados de los mismos. Los registros existentes se discuten desde el punto de vista de sus residuos en el aceite.

  16. Organochlorine Pesticide Residues in the Major Rivers of Southern Thailand

    Directory of Open Access Journals (Sweden)

    Abd Naser Haji Samoh

    2009-01-01

    Full Text Available Environmental contaminations by organochlorine pesticides (OCPs of inland water have been a global issue, since most of these compounds are very persistent, bioaccumulative and toxic compounds. Due to the widespread use of DDT for malaria vector eradication programs in the past and no comprehensive works have been conducted to assess trace organic pollutants in river waters, this work is the first effort to assess the contamination levels of OCPs in the major rivers of Southern Thailand. The objectives of this study were to determine the concentration levels of OCPs and oil and grease in the 3 major rivers and to compare the present results with surrounding regions for further assessment of OCPs contamination status in inland waters of Southern Thailand. The water samples were collected along the 3 major rivers (Saiburi, Patani and Tiba River during June 2007-February 2008. Water samples were solid phase extracted with Supelco C-18 cartridge (1g/6 mL and quantified by gas chromatograph (GC-ECD. The concentration of oil and grease was determined by gravimetric method and reported as hexane extractable material (HEM and silica gel treated hexane extractable material (SGT-HEM. Several parameters of waters such as total suspended solid, pH, turbidity, and conductivity were measured. The commonly found OCP residues in these rivers were β-HCH, γ-HCH, heptachlor epoxide, endosulfan 1, p,p’- DDE and endrin aldehyde. The overall results showed that Saiburi River was more polluted with OCPs than Patani and Tiba River, especially p, p’-DDE which was detected in the wide range concentration of 9.6 to 203.1 ng/mL. For oil and grease contamination, Tiba River waters were found to be more polluted than either Patani or Saiburi River. The experimental procedures and analytical results together with the possible sources of OCPs and its environmental impacts are presented.

  17. Organochlorine pollutants in small cetaceans from the Pacific and south Atlantic Oceans, November 1968-June 1976

    Energy Technology Data Exchange (ETDEWEB)

    O' Shea, T.J.; Brownell, R.L. Jr.; Clark, D.R. Jr.; Walker, W.A.; Gay, M.L.; Lamont, T.G.

    1980-09-01

    Organochlorine residues were analyzed in blubber, brain, or muscle tissues of 69 individuals representing 10 species of small cetaceans. Collections were made from November 1968 through June 1976 at localities in the Eastern Tropical Pacific and along the coasts of California, Hawaii, Japan, and Uruguay, Relations of residue concentrations between tissues are described for DDE and PCBs in two dolphin species. sigma DDT and PCB residues in blubber of most of the 19 individuals of the five southern California species sampled exceed concentrations that are associated with reproductive impairment in pinnipeds, although the nature of such associations is not well defined. The sigma DDT residue of 2,695 ppm in blubber of one California coastal Tursiops truncatus is one of the highest concentrations reported in tissues of members of any population of wild mammals. Except for one rough-toothed dolphin (Steno bredanensis) from Maui, Hawaii, all individuals from all localities surveyed were contaminated with organochlorine compounds. Seventeen different organochlorines were detected; greatest diversity occurred near Japan and California. This is the first report of several of these compounds in tissues of any species of marine mammals. The o,p'-isomers and metabolites of DDT were detected unusually frequently. Ratios of p,p'-DDT to p,p'-DDE in blubber of cetaceans from waters off countries where use of this pesticide has been relatively recent and ongoing were at least an order of magnitude higher than in cetaceans from United States waters.

  18. Carry-over of persistent organochlorine pesticides through placenta to fetus

    Directory of Open Access Journals (Sweden)

    Waliszewski Stefan M.

    2000-01-01

    Full Text Available OBJECTIVE: As a consequence of environmental exposure, organochlorine pesticides accumulate in lipid rich-tissues such as maternal adipose tissue and partition to maternal blood serum and umbilical blood serum. To establish their distribution in the human body, the concentration gradients of organochlorine pesticides between these compartments were determined. MATERIAL AND METHODS: Maternal adipose tissue, blood serum and umbilical blood serum samples from 64 volunteers admitted for cesarean delivery at Hospital Benito Coquet Lagunes were studied in Veracruz during 1997 and 1998. The pesticide residues were determined by gas chromatography and results obtained from different sample groups were analyzed using Pearson correlation coefficients and simple lineal regression. RESULTS: Significant results expressed on fat basis of organochlorine pesticides indicate that 1,1,1-trichloro-2,2-bis(4-chlorophenylethane (DDT levels are higher in maternal adipose tissue (4.51 mg/kg DDE and 1.27 mg/kg pp'DDT, maternal blood serum (4.45 mg/kg DDE and 0.78 mg/kg pp'DDT, and umbilical blood serum (4.70 mg/kg DDE and 0.88 mg/kg pp'DDT, due to greater affinity of DDT for lipids. CONCLUSIONS: The statistical evaluation of results and the pairing of samples analyzed indicate that absorbed organochlorine pesticides cross the placental barrier and reach a balanced state between mother and fetus.

  19. A Comparative Study of the Persistence, Movement and Metabolism of Six Insecticides in Soils and Plants

    International Nuclear Information System (INIS)

    Fuhremann, T.W.; Lichtenstein, E.P.

    1981-01-01

    Full text: Two soil types and oat plants grown in these soils were incubated under identical environmental conditions. The insecticides used in order to increase the water solubility were 14 C-DDT, 14 C-lindane, 14 C-fonofos, 14 C-parathion, 14 C-phorate and 14 C-carbofuran. Total amounts of 14 C-residues recovered from insecticide-treated loam soils plus oats grown in these soils were similar with DDT and oarbofuran. They were also higher than those observed with the other insecticides. While most of the 14 C-DDT residues remained in the soils, most of the 14 C-carbofuran residues were recovered from oat leaves in the form of carbofuran and 3-hydroxycarbofuran. 14 C-residues of all insecticides were more persistent in loam than in sandy soil and sand-grown oats took up more 14 C-insecticide residues than loamgrown oats. The more water-soluble insecticides, 14 C-phorate and Ccarbofuran were more mobile and were metabolized to a greater extent than insecticides of lower water solubilities. Unextractable (bound) 14 C-residues in loam soil ranged from 2.8% to 29.1% of the applied doses of 14 C-DDT and 14 C-parathion, respectively. Bound 14 C-residues were lower in the sandy soil than in the loam soil, however, plant-bound 14 C-residues were higher in oats grown in the sandy soil than in loam grown oats. Insecticide metabolites recovered from soils and plants were identified and quantitated whenever possible. The oxygen analog metabolites of the organophosphorus insecticides were most abundant in the sandy soil and in oats grown therein. Data illustrate the importance of chemical structure, water solubility and soil type in predicting the comparative environmental behaviour of pesticides. (author)

  20. Degradation of Insecticides in Poultry Manure: Determining the Insecticidal Treatment Interval for Managing House Fly (Diptera: Muscidae) Populations in Poultry Farms.

    Science.gov (United States)

    Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan

    2016-04-01

    It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.

  1. Organochlorine pesticides in fish, water and sediments in the middle Volta Basin: a case study of Kpando Torkor lake, Volta Region of Ghana

    International Nuclear Information System (INIS)

    Gbeddy, G.K.

    2011-01-01

    The levels of contamination with selected organochlorine pesticides (OCPs) in water, sediment, and two commonly harvested fish species namely Tilapia zilli and Chrysichthys nigrodigitatus from Kpando Torkor Lake were determined. This was to give the general picture of the extent of contamination of these matrices with OCPs and also assess the suitability of the water and fish catch for human consumption. Organochlorine pesticides residues in water samples were extracted using liquid-liquid extraction whilst Soxhlet was used in the case of fish and sediment samples. All extracts were cleaned-up using packed columns and then analyzed using Gas chromatography equipped with 63 Ni electron-capture detector (ECD). Fifteen organochlorine pesticide residues namely β-HCH, γ-HCH, δ-HCH, p,p'-DDT, p,p'-DDD, p,p'-DDE, Heptachlor, Aldrin, Dieldrin, Endrin, γ-Chlordane, α-Endosulfan, β-Endosulfan, Endosulfan sulphate and Methoxychlor were investigated in this study. Thirteen of them excluding γ-HCH and Endrin were detected in sediment and fish samples at concentrations ranging from below the level of quantification (LOQ) to 37.75ng/g wet weight, and occurrence frequencies ranging from 14 to 100%. Twelve of them excluding p,p'-DDT, -HCH and Endrin were however, measured in water samples with concentrations ranging from below LOQ to 0.669μg/L and occurrence frequencies ranging from 14 to 29%. γ-HCH and p,p'-DDD were the most frequently detected residues in all samples analyzed with an average percentage frequency of 85.8, followed by Endosulfan sulphate (83.0%) and β-HCH (80.0%) among others. In consonance with their properties, organochlorine pesticide residues measured in fish samples were higher than those of sediment samples. Even though, the fat content of catfish muscle (10.24%) was higher than tilapia muscle (2.80%), the levels of organochlorine pesticide residues in tilapia tissues were however, higher than that of catfish. For instance, the levels of β-HCH in

  2. Factors Influencing the Spatial Distribution of Organochlorine Pesticides in Soils surrounding Chemical Industrial Parks

    NARCIS (Netherlands)

    Wang, G.; Lu, Y.L.; Wang, T.Y.; Zhang, X.; Han, J.Y.; Luo, W.; Shi, Y.J.; Li, J.; Jiao, W.T.

    2009-01-01

    Topsoil samples (n = 105) were collected to Study the distribution of dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) residues in the vicinity of chemical industrial parks in Tianjin, China. The occurrence and distribution of target organochlorine pesticides (OCPs) were mapped

  3. Toxicological studies for adults and children of insecticide residues with common mode of action (MoA) in pome, stone, berries and other small fruit

    International Nuclear Information System (INIS)

    Lozowicka, B.; Mojsak, P.; Jankowska, M.; Kaczynski, P.; Hrynko, I.; Rutkowska, E.; Szabunko, J.; Borusiewicz, A.

    2016-01-01

    The presence of pesticide residues in fruit is a serious health concern. This paper for the first time demonstrated the Hazard Index (HI) method to carry out acute, chronic and cumulative health risk assessment to the 14 groups of insecticides for three subpopulations. The challenge of this study was to present results from a long period of research (years 2005–2014) with toxicological aspects, especially in multiresidue samples. Near 1000 fresh pome, stone, berries and small fruit were prepared by two accredited MSPD and QuEChERS methods followed by liquid and gas chromatography analyses with various systems of detection ECD/NPD/MS/MS. Twenty percent of the fruit samples contained 16 insecticide residues in the range of 0.01–0.81 mg/kg and 3% over MRL. The class of pesticide with the highest contribution to the ADI was found to be OPPs: dimethoate and diazinon for adults 48% and 66% of the ADI whereas for infants 144% and 294% of the ADI. The highest contributions of the cHQ to common MoA pesticides were AChE inhibitors: 135% for adults and 528% for infants, sodium channel modulators 4.9% and 20%, nicotic acetylocholine receptor < 2.9% and < 10.6% for adults and infants, respectively. The fruit with the highest contribution to the ADI were found to be apples (316%, 58%), cherries (96%, 37%) and pears (129%, 33%) for infants and adults. The study findings indicated that dietary exposures to insecticide residues in fruit would be unlikely to pose unacceptable health risks for the infants, toddlers and adults. - Highlights: • Health risk assessment of insecticide via dietary intake of fruit was estimated. • Sixteen residues in pome, stone, berries and small fruit ranged from 0.01 to 0.8 mg/kg. • Organophosphates were the most frequently occurring group with common MoA. • Dietary exposures for adults and children were below the safety reference values. • Toxicological study provided important date of human health.

  4. Toxicological studies for adults and children of insecticide residues with common mode of action (MoA) in pome, stone, berries and other small fruit

    Energy Technology Data Exchange (ETDEWEB)

    Lozowicka, B., E-mail: B.Lozowicka@iorpib.poznan.pl [Plant Protection Institute - National Research Institute, Laboratory of Pesticide Residues, Chelmonskiego 22, 15-195 Bialystok (Poland); Mojsak, P.; Jankowska, M.; Kaczynski, P.; Hrynko, I.; Rutkowska, E.; Szabunko, J. [Plant Protection Institute - National Research Institute, Laboratory of Pesticide Residues, Chelmonskiego 22, 15-195 Bialystok (Poland); Borusiewicz, A. [Department of Agronomy, The Academy of Agrobusiness in Łomza (Poland)

    2016-10-01

    The presence of pesticide residues in fruit is a serious health concern. This paper for the first time demonstrated the Hazard Index (HI) method to carry out acute, chronic and cumulative health risk assessment to the 14 groups of insecticides for three subpopulations. The challenge of this study was to present results from a long period of research (years 2005–2014) with toxicological aspects, especially in multiresidue samples. Near 1000 fresh pome, stone, berries and small fruit were prepared by two accredited MSPD and QuEChERS methods followed by liquid and gas chromatography analyses with various systems of detection ECD/NPD/MS/MS. Twenty percent of the fruit samples contained 16 insecticide residues in the range of 0.01–0.81 mg/kg and 3% over MRL. The class of pesticide with the highest contribution to the ADI was found to be OPPs: dimethoate and diazinon for adults 48% and 66% of the ADI whereas for infants 144% and 294% of the ADI. The highest contributions of the cHQ to common MoA pesticides were AChE inhibitors: 135% for adults and 528% for infants, sodium channel modulators 4.9% and 20%, nicotic acetylocholine receptor < 2.9% and < 10.6% for adults and infants, respectively. The fruit with the highest contribution to the ADI were found to be apples (316%, 58%), cherries (96%, 37%) and pears (129%, 33%) for infants and adults. The study findings indicated that dietary exposures to insecticide residues in fruit would be unlikely to pose unacceptable health risks for the infants, toddlers and adults. - Highlights: • Health risk assessment of insecticide via dietary intake of fruit was estimated. • Sixteen residues in pome, stone, berries and small fruit ranged from 0.01 to 0.8 mg/kg. • Organophosphates were the most frequently occurring group with common MoA. • Dietary exposures for adults and children were below the safety reference values. • Toxicological study provided important date of human health.

  5. Existence of Insecticides in Tap Drinking Surface and Ground Water in Dakahlyia Governorate, Egypt in 2011

    Directory of Open Access Journals (Sweden)

    RA Mandour

    2011-12-01

    Full Text Available Background: The environmental degradation products of pesticides may enter drinking water and result in serious health problems. Objective: To evaluate the occurrence of insecticides in drinking surface and ground water in Dakahlyia Governorate, northern Egypt in 2011. Methods: We studied blood samples collected from 36 consecutive patients diagnosed with pesticides poisoning and 36 tap drinking water (surface and ground. Blood and water samples were analyzed for pesticides using gas chromatography-electron captured detector (GC-ECD. In addition, blood samples were analyzed for plasma pseudo-cholinesterase level (PChE and red blood cells acetyl cholinesterase activity (AChE. Results: The results confirmed the presence of high concentrations of insecticides, including organonitrogenous and organochlorine in tap drinking surface and ground water. Conclusion: Drinking water contaminated with insecticides constitutes an important health concern in Dakahlyia governorate, Egypt.

  6. Distribution, regional sources and deposition fluxes of organochlorine pesticides in precipitation in Guangzhou, South China

    Science.gov (United States)

    Huang, De-Yin; Peng, Ping'an; Xu, Yi-Gang; Sun, Cui-Xiang; Deng, Hong-Mei; Deng, Yun-Yun

    2010-07-01

    We analyzed rainwater collected from multiple sites, Guangzhou, China, from March to August 2005, with the aim to characterize the distribution, regional sources and deposition fluxes of organochlorine pesticides (OCPs) in South China. Eight species of organochlorine pesticide were detected, including hexachlorocyclohexanes (HCHs), dichlorodiphenyltrichloroethanes (DDTs), and endosulfans. Volume-weighted mean monthly total concentrations varied from 3.65 ± 0.95 to 9.37 ± 2.63 ng L - 1 , and the estimated total wet deposition flux was about 11.43 ± 3.27 µg m - 2 during the monitoring period. Pesticides were mainly detected in the dissolved phase. Distribution coefficients between particulate and dissolved phases in March and April were generally higher than in other months. HCHs, p,p'-DDD and p,p'-DDT in precipitation were attributed to both the residues and present usage of insecticides in Pearl River Delta. The concentrations of p,p'-DDD + p,p'-DDT were relatively high from April to August, which were related to the usage of antifouling paints containing DDT for fishing ships in seaports of the South China Sea in summer. In contrast, endosulfans were relatively high in March, which was related to their seasonal atmospheric transport from cotton fields in eastern China by the Asian winter monsoon. The consistency of the variation of endosulfans, p,p'-DDD and p,p'-DDT concentrations with the alternation of summer and winter monsoon suggested that the Asian monsoon played an important role in the long-range transport of OCPs. In addition, the wet deposition of OCPs may influence not only Pearl River water but also the surface land distributions of pesticides in the Guangzhou area, especially for endosulfans, p,p'-DDD and p,p'-DDT.

  7. Evaluating organochlorine pesticide residues in the aquatic environment of the Lake Naivasha River basin using passive sampling techniques.

    Science.gov (United States)

    Abbasi, Yasser; Mannaerts, Chris M

    2018-05-18

    Passive sampling techniques can improve the discovery of low concentrations by continuous collecting the contaminants, which usually go undetected with classic and once-off time-point grab sampling. The aim of this study was to evaluate organochlorine pesticide (OCP) residues in the aquatic environment of the Lake Naivasha river basin (Kenya) using passive sampling techniques. Silicone rubber sheet and Speedisk samplers were used to detect residues of α-HCH, β-HCH, γ-HCH, δ-HCH, heptachlor, aldrin, heptachlor epoxide, pp-DDE, endrin, dieldrin, α-endosulfan, β-endosulfan, pp-DDD, endrin aldehyde, pp-DDT, endosulfan sulfate, and methoxychlor in the Malewa River and Lake Naivasha. After solvent extraction from the sampling media, the residues were analyzed using gas chromatography electron capture detection (GC-ECD) for the OCPs and gas chromatography-mass spectrometry (GC-MS) for the PCB reference compounds. Measuring the OCP residues using the silicone rubber samplers revealed the highest concentration of residues (∑OCPs of 81 (± 18.9 SD) μg/L) to be at the Lake site, being the ultimate accumulation environment for surficial hydrological, chemical, and sediment transport through the river basin. The total OCP residue sums changed to 71.5 (± 11.3 SD) μg/L for the Middle Malewa and 59 (± 12.5 SD) μg/L for the Upper Malewa River sampling sites. The concentration sums of OCPs detected using the Speedisk samplers at the Upper Malewa, Middle Malewa, and the Lake Naivasha sites were 28.2 (± 4.2 SD), 31.3 (± 1.8 SD), and 34.2 (± 6.4 SD) μg/L, respectively. An evaluation of the different pesticide compound variations identified at the three sites revealed that endosulfan sulfate, α-HCH, methoxychlor, and endrin aldehyde residues were still found at all sampling sites. However, the statistical analysis of one-way ANOVA for testing the differences of ∑OCPs between the sampling sites for both the silicone rubber sheet and Speedisk samplers

  8. Biomonitoring of organochlorines in women with benign and malignant breast disease

    International Nuclear Information System (INIS)

    Siddiqui, M.K.J.; Anand, M.; Mehrotra, P.K.; Sarangi, R.; Mathur, N.

    2005-01-01

    Established risk factors for breast cancer explain breast cancer risk only partially. Organochlorines are considered to be a possible cause for hormone-dependent cancers. A hospital-based case-control study, the first from India, was conducted among 50 women undergoing surgery for breast disease to examine the association between organochlorine exposure and breast cancer risk. Blood, tumor, and surrounding adipose tissue of the breast were collected from the subjects with benign (control) and malignant breast (study) lesions and analyzed to determine organochlorine insecticides using a gas-liquid chromatograph equipped with an electron capture detector. The α, β, γ, and δ isomers of hexachlorocyclohexane (HCH), p,p'-dichlorodiphenyltrichloroethane (DDT), o,p'-DDT, p,p-dichlorodiphenyldichloroethylene, and p,p'-dichlorodiphenyldichloroethane were frequently detected in three specimens. Total HCH and total DDT levels were higher in the blood of the study group (25 cases) than in those of the controls (25 cases) with only γ-HCH being significantly different (P0.05). However, both total HCH and total DDT were higher in the tumor tissues of the controls than in those of the study group; γ-HCH was significantly different (P0.05). The level of total HCH (α-HCH was significantly different, P0.05) was higher in the breast adipose tissue of the study group, whereas total DDT was higher in the breast adipose tissue of the control group. The distribution of known confounders of breast cancer including age, body mass index, age at menarche and menopause, duration of breast feeding, and family history related to breast disease did not differ significantly between benign and malignant groups. This pilot study with limited statistical power does not support a positive association between exposure to organochlorines and risk of breast cancer but paves the way for a larger Indian study with greater statistical power encompassing different regions of the country to enable

  9. Organochlorine residues in harp seals, Phoca groenlandica, from the Gulf of St. Lawrence and Hudson Strait: An evaluation of contaminant concentrations and burdens

    Energy Technology Data Exchange (ETDEWEB)

    Beck, G.G.; Smith, T.G. (Dept. of Fisheries and Oceans, Nanaimo, BC (Canada)); Addison, R.F. (Dept. of Fisheries and Oceans, Sidney, BC (Canada))

    1994-01-01

    Organochlorine contaminant concentrations and burdens were evaluated in blubber samples from 50 harp seals (Phoca groenlandica) obtained from the estuary and northern Gulf of St. Lawrence and Hudson Strait, Canada between December 1988 and December 1989. The concentration and burden of polychlorinated biphenyls (PCBs) increased significantly during the winter months for males occupying the St. Lawrence estuary. The potential for rapid accumulation of contaminants in the estuary was also observed among females: nine postpartum females (1 month after weaning) had higher organochlorine levels than prepartum females from the same location. The lowest observed contaminant concentrations and burdens were in seals from Hudson Strait in autumn. In winter specimens, males had DDT and PCB concentrations about 4 and 2 times as great, respectively, as females of similar age distribution and collection date. Congeners with IUPAC Nos. 138 and 153 accounted for more than 50% of total identifiable PCBs, which is consistent with their prevalence in other marine biota. The concentration of PCBs has declined and the percent p,p'-DDE of total DDT has increased between 1982 and the present study. Unlike the beluga whale (Delphinapterus leucas), harp seals occupy the more polluted waters of the estuary only seasonally, and this may account for their lower residue concentrations. 59 refs., 1 fig., 5 tabs.

  10. Chromogenic platform based on recombinant Drosophila melanogaster acetylcholinesterase for visible unidirectional assay of organophosphate and carbamate insecticide residues

    Energy Technology Data Exchange (ETDEWEB)

    Han Zheng [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Chi Chensen [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Bai Bing; Liu Gang; Rao Qinxiong [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Peng Shaojie [Institute of Shanghai Food and Drug Supervision, 615 Liuzhou Road, Shanghai 200233 (China); Liu Hong [Shanghai Municipal Center for Disease Control and Prevention, 1380 Zhongshan West Road, Shanghai 200336 (China); Zhao Zhihui [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Zhang Dabing [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Wu Aibo, E-mail: wuaibo@saas.sh.cn [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China)

    2012-03-30

    Highlight: Black-Right-Pointing-Pointer A visible chromogenic platform for rapid analysis of OP and CM insecticide residues was developed. Black-Right-Pointing-Pointer The assay has the capabilities of both qualitative measurement and quantitative analysis. Black-Right-Pointing-Pointer The sensitivity, capabilities of resisting interferences and storage stability were desirable. Black-Right-Pointing-Pointer Matrix effects were acceptable and detection performance was satisfactory in real application. - Abstract: In this study we propose a chromogenic platform for rapid analysis of organophosphate (OP) and carbamate (CM) insecticide residues, based on recombinant Drosophila melanogaster acetylcholinesterase (R-DmAChE) as enzyme and indoxyl acetate as substrate. The visible chromogenic strip had the advantages identical to those of commonly used lateral flow assays (LFAs) with utmost simplicity in sample loading and result observation. After optimization, depending on the color intensity (CI) values, the well-established assay has the capabilities of both qualitative measurement via naked eyes and quantitative analysis by colorimetric reader with the desirable IC{sub 50} values against the tested six insecticides (0.06 {mu}g mL{sup -1} of carbofuran, 0.28 {mu}g mL{sup -1} of methomyl, 0.03 {mu}g mL{sup -1} of dichlorvos, 31.6 {mu}g mL{sup -1} of methamidophos, 2.0 {mu}g mL{sup -1} of monocrotophos, 6.3 {mu}g mL{sup -1} of omethoate). Acceptable matrix effects and satisfactory detection performance were confirmed by in-parallel LC-MS/MS analysis in different vegetable varieties at various spiked levels of 10{sup -3} to 10{sup 1} {mu}g g{sup -1}. Overall, the testified suitability and applicability of this novel platform meet the requirements for practical use in food safety management and environmental monitoring, especially in the developing world.

  11. Chromogenic platform based on recombinant Drosophila melanogaster acetylcholinesterase for visible unidirectional assay of organophosphate and carbamate insecticide residues

    International Nuclear Information System (INIS)

    Han Zheng; Chi Chensen; Bai Bing; Liu Gang; Rao Qinxiong; Peng Shaojie; Liu Hong; Zhao Zhihui; Zhang Dabing; Wu Aibo

    2012-01-01

    Highlight: ► A visible chromogenic platform for rapid analysis of OP and CM insecticide residues was developed. ► The assay has the capabilities of both qualitative measurement and quantitative analysis. ► The sensitivity, capabilities of resisting interferences and storage stability were desirable. ► Matrix effects were acceptable and detection performance was satisfactory in real application. - Abstract: In this study we propose a chromogenic platform for rapid analysis of organophosphate (OP) and carbamate (CM) insecticide residues, based on recombinant Drosophila melanogaster acetylcholinesterase (R-DmAChE) as enzyme and indoxyl acetate as substrate. The visible chromogenic strip had the advantages identical to those of commonly used lateral flow assays (LFAs) with utmost simplicity in sample loading and result observation. After optimization, depending on the color intensity (CI) values, the well-established assay has the capabilities of both qualitative measurement via naked eyes and quantitative analysis by colorimetric reader with the desirable IC 50 values against the tested six insecticides (0.06 μg mL −1 of carbofuran, 0.28 μg mL −1 of methomyl, 0.03 μg mL −1 of dichlorvos, 31.6 μg mL −1 of methamidophos, 2.0 μg mL −1 of monocrotophos, 6.3 μg mL −1 of omethoate). Acceptable matrix effects and satisfactory detection performance were confirmed by in-parallel LC–MS/MS analysis in different vegetable varieties at various spiked levels of 10 −3 to 10 1 μg g −1 . Overall, the testified suitability and applicability of this novel platform meet the requirements for practical use in food safety management and environmental monitoring, especially in the developing world.

  12. Reduced ultraviolet light transmission increases insecticide longevity in protected culture raspberry production.

    Science.gov (United States)

    Leach, Heather; Wise, John C; Isaacs, Rufus

    2017-12-01

    High tunnels are large protective structures used for season extension of many crops, including raspberries. These structures are often covered in plastic films to reduce and diffuse ultraviolet light transmission for pest and disease control, but this may also affect the photodegradation and efficacy of pesticides applied under these tunnels. We compared the residue levels of ten insecticides under three tunnel plastics with varying levels of UV transmission and open field conditions. Raspberry plants placed in research-scale tunnels were treated with insecticides and residues on fruit and foliage were monitored for one or two weeks in early 2015 and early and late 2016. Plastics that reduce UV transmission resulted in 50% greater residues of some insecticides compared to transparent plastics, and 60% compared to uncovered tunnels. This increased persistence of residues was evident within 1 day and remained consistently higher for up to 14 days. This pattern was demonstrated for multiple insecticides, including bifenthrin, esfenvalerate, imidacloprid, thiamethoxam, and spinosad. In contrast, the insecticide malathion degraded rapidly regardless of the plastic treatment, indicating less sensitivity to photodegradation. Bioassays using insecticide-treated leaves that were under UV-blocking plastic revealed higher mortality of the invasive fruit pest, Drosophila suzukii, compared to leaves that were uncovered. This indicates that the activity of pesticides under high tunnels covered in UV-reducing plastics may be prolonged, allowing for fewer insecticide applications and longer intervals between sprays. This information can be used to help optimize pest control in protected culture berry production. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. ORGANOCHLORINE PESTICIDES IN FISH OF THE KILIYA DELTA OF THE DANUBE (2003–2005

    Directory of Open Access Journals (Sweden)

    Yu. Sytnik

    2015-09-01

    Full Text Available Purpose. Identification and analysis of the content of organochlorine pesticides (OCP in organs and tissues of benthivorous and predatory fish species of the Kiliya delta of the Danube (Eastern mouth and their comparison with previous years. Methodology. The analysis of the samples of aquatic organisms for the content of residual organochlorine pesticides was carried out by gas-liquid chromatography (GLH based on a unified methodology. The chromatographic analysis was carried out on the gas chromatograph "Color 5" with electron capture detector at the Institute of Hydrobiology of the National Academy of Sciences of Ukraine. Findings. The effect of stable organochlorine pesticides on aquatic organisms is characterized by marked persistence in the environment and by high ability for migration and accumulation on different levels of food chains in aquatic ecosystems. The continuous presence of OCP in all investigated organs and tissues of selected species with the presence of a certain amount of fat and consequently, the fixation of residual organochlorine pesticides. Among benthivorous fishes, the content of OCP in organs and tissues (total is as follows: vimba → roach → wild carp → bream → gibel carp. Among the predators: asp → perch → European catfish → pikeperch. Originality. Recently, a significant number of scientists all around the world returns to the problem of the accumulation and distribution (redistribution of OCP in the components of aquatic ecosystems. This is associated with certain threats to the environment and human health, that could lead to negative consequences as a result of the consumption of fish as the highest trophic level in fresh waters of Ukraine. Practical value. The obtained data indicate that the major commercial fish species of the Kiliya delta of the Danube river contains residual quantities of pesticides. This indicates to the need for continuous hygienic and toxicological monitoring of fish caught

  14. Lead and PCB's in canvasback ducks: Relationship between enzyme levels and residues in blood

    Science.gov (United States)

    Dieter, M.P.; Perry, M.C.; Mulhern, B.M.

    1976-01-01

    Blood samples were taken for two successive years from canvasback ducks trapped in the Chesapeake Bay. The first winter (1972?1973) five plasma enzymes known to respond to organochlorine poisoning were examined. Abnormal enzyme elevations suggested that 20% of the population sampled (23/115 ducks) might contain organochlorine contaminants, but no residue analyses were performed. The second winter (1974) two of the same enzymes, aspartate aminotransferase and lactate dehydrogenase, and a third enzyme known to be specifically inhibited by lead, delta-aminolevulinic acid dehydratase, were assayed in 95 blood samples. Blood residues of organochlorine compounds and of lead were determined in representative samples, and the correlations between residue levels and enzyme changes were examined. The enzyme bioassays in 1974 indicated that lead was a more prevalent environmental contaminant than organochlorine compounds in canvasback ducks; 17% of the blood samples had less than one-half of the normal delta-aminolevulinic acid dehydratase activity, but only 11% exhibited abnormal aspartate aminotransferase or lactate dehydrogenase activities. These findings were confirmed by residue analyses that demonstrated lead concentrations four times higher than background levels, but only relatively low organochlorine concentrations. There was a highly significant inverse correlation between delta-aminolevulinic acid dehydratase activity and blood lead concentrations (Pcontamination in waterfowl. In canvasback ducks 200 ppb of lead in the blood caused a 75% decrease in delta-aminolevulinic acid dehydratase activity, a magnitude of enzyme inhibition that disturbs heme synthesis and is regarded as detrimental in humans.

  15. Residues and Eco-risk Evaluation of Organochlorine Pesticides in Agricultural Soils from Typical Vegetable Produce Areas of Hainan Province, China

    Directory of Open Access Journals (Sweden)

    WU Dong-ming

    2014-08-01

    Full Text Available To determine current levels of organochlorine pesticides(OCPsand assess their sources, ecological risk in agricultural soils from typical vegetable produce areas of Hainan Province, 33 soil samples were collected and detected by the GC method. The results showed that OCPs were found in 90.9%of the collected soil samples and ranged from Not Dedected(NDto 17.37 ng·g-1, with a mean of 2.30 ng·g-1. The DDTs、HCHs、endosulfan and endosulfan sulfate were found over 54%in the collected soil samples. Also, the DDTs were the main compo-nents, and their contribution to the residues of OCPs was over 54.6%. Analysis of the sources of contamination showed that HCHs in the area were mainly derived from lindane. DDTs, which were suspected to have recent application to 18.2%soil, were derived mainly from technical DDTs or dicofol containing DDT impurities. Comparing with various studies and the‘National Environmental Quality Standard for Soils of Chi-na’(GB 15618-1995, OCP pollutions were generally slight in present study, and the ecological risk of HCHs and DDTs residue in agricul-tural soils of Hainan Province was lower.

  16. Assessment of pesticide residues in tomatoes and watermelons ...

    African Journals Online (AJOL)

    This study investigated the levels of pesticide residues in selected fruits from major markets in Dar es Salaam city. Samples of tomatoes and watermelons were analysed for eighteen organochlorine, organophosphorus and pyrethroid pesticide residues. Extraction was performed using acetone followed by dichloromethane: ...

  17. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans.

    Science.gov (United States)

    Moyes, Catherine L; Vontas, John; Martins, Ademir J; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David

    2017-07-01

    Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.

  18. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans

    Science.gov (United States)

    Vontas, John; Martins, Ademir J.; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David

    2017-01-01

    Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance. PMID:28727779

  19. Contemporary status of insecticide resistance in the major Aedes vectors of arboviruses infecting humans.

    Directory of Open Access Journals (Sweden)

    Catherine L Moyes

    2017-07-01

    Full Text Available Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus, making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids. Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.

  20. Organochlorine pesticide contamination of ground water in the city of Hyderabad.

    Science.gov (United States)

    Shukla, Gangesh; Kumar, Anoop; Bhanti, Mayank; Joseph, P E; Taneja, Ajay

    2006-02-01

    Organochlorine pesticides are ubiquitous and persistent organic pollutants used widely throughout the world. Due to the extensive use in agriculture, organic environmental contaminants such as HCH, DDT along with other organochlorine pesticides are distributed globally by transport through air and water. The main aim of present study is to determine contamination levels of organochlorine pesticides in the ground water of Hyderabad City. Water samples were collected from 28 domestic well supplies of the city. For this study, random sampling technique was applied, all the samples were collected in high purity glass bottles and refrigerated at 4 degrees C until analysis. Solid Phase Extraction (SPE) is used for the extraction of organochlorine pesticide residues in water sample. The collected water samples were pre-filtered through a 0.45 microg glass fiber filter (Wattman GF/F) to remove particulate matter and were acidified with hydrochloric acid (6N) to pH 2.5. Methanol modifier (BDH, for pesticide residue analysis, 10 mL) was added to water sample for better extraction. SPE using pre-packed reversed phase octadecyl (C-18 bonded silica) contained in cartridges was used for sample preparation. Prior to the extraction, the C-18 bonded phase, which contains 500 mg of bonded phase, was washed with 20 mL methanol. The sample was mixed well and allowed to percolate through the cartridges with flow rate of 10-15 mL/min under vacuum. After sample extraction, suction continued for 15 min to dry the packing material and pesticides trapped in the C-18 bonded phases were eluted by passing 10 mL hexane and fraction was evaporated in a gentle steam of Nitrogen. In all samples pesticide residues were analyzed by GC (Chemito-8510) with Ni63 ECD detector. Helium was used as carrier gas and nitrogen was used as make up gas. The injection technique was split/split less. All the samples analyzed were found to be contaminated with four pesticides i.e. DDT, beta-Endosulfan, alpha

  1. Organochlorine pesticide residues in dried cocoa beans obtained from cocoa stores at Ondo and Ile-Ife, Southwestern Nigeria

    Directory of Open Access Journals (Sweden)

    J.A.O. Oyekunle

    Full Text Available Levels of organochlorine pesticides (OCPs were determined in dried cocoa beans obtained from cocoa produce stores at Ondo and Ile-Ife, Southwestern Nigeria. Cocoa beans samples were sun dried to a constant weight, pulverized and soxhlet extracted with dichloromethane to obtain the OCPs. Qualitative identification and quantitative evaluation of the extracted OCPs after clean-up on silica gel were accomplished with the aid of a Gas Chromatography coupled with an Electron Capture Detector (GC-ECD. Levels of OCPs in cocoa beans from Ondo had a mean range of ND (p, p’-DDE to 82.17 ± 54.53 ng/g (p, p’-DDT were higher than the OCPs levels in cocoa beans from Ile-Ife with a mean range of 0.37 ± 0.63 ng/g (Endrin to 57.76 ± 81.48 ng/g (p, p’-DDT. The higher levels of OCPs detected in the cocoa beans from Ondo could be an indication of higher volume of OCPs application by cocoa farmers in Ondo and its environs since cocoa plantations were more concentrated than Ile-Ife environs. Levels of OCPs determined in the cocoa beans were within the Maximum Residue Limit (MRLs for OCPs set by the World Health Organization/Food and Agricultural Organization. The study established the presence of OCPs in an important crop of Nigeria. Hence, there is the need to keep monitoring ecotoxicological chemical substances in agricultural food products of Nigeria so as to take steps that ensure health safety of end users. Keywords: Pesticides, Organochlorine, Cocoa beans, Ondo, Ile-Ife, Nigeria

  2. Organochlorine residues in sediments from selected tributaries to Manila Bay, Philippines

    International Nuclear Information System (INIS)

    Bajet, C.M.; Varca, L.M.; Navarro, M.P.

    1999-01-01

    Sediment borne pesticides are the major route of transport of pesticides in the marine environment and benthic dwellers, filter feeders and the flora/fauna closely associated with the sediments could greatly be affected. This paper focuses on the monitoring of organochlorine pesticides in sediments collected from the mouth of rivers draining to Manila Bay and relate to the contribution of inland activities to the overall pollution of the Bay. Sediments from 14-25 tributaries were collected in 1996 to 1998 and analyzed for the presence of HCB, aldrin, dieldrin, lindane, DDT, DDE, DDD, endosulfan I, endosulfan II and endosulfan sulfate using GLC-ECD

  3. Implications of bio-efficacy and persistence of insecticides when indoor residual spraying and long-lasting insecticide nets are combined for malaria prevention.

    Science.gov (United States)

    Okumu, Fredros O; Chipwaza, Beatrice; Madumla, Edith P; Mbeyela, Edgar; Lingamba, Geoffrey; Moore, Jason; Ntamatungro, Alex J; Kavishe, Deo R; Moore, Sarah J

    2012-11-19

    Bio-efficacy and residual activity of insecticides used for indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs) were assessed against laboratory-reared and wild populations of the malaria vector, Anopheles arabiensis in south eastern Tanzania. Implications of the findings are examined in the context of potential synergies and redundancies where IRS and LLINs are combined. Bioassays were conducted monthly for six months on three LLIN types (Olyset® PermaNet 2.0®,and Icon Life®) and three IRS treatments (2 g/m2 pirimiphos-methyl, 2 g/m2 DDT and 0.03 g/m2 lambda-cyhalothrin, sprayed on mud walls and palm ceilings of experimental huts). Tests used susceptible laboratory-reared An. arabiensis exposed in cones (nets and IRS) or wire balls (nets only). Susceptibility of wild populations was assessed using WHO diagnostic concentrations and PCR for knock-down resistance (kdr) genes. IRS treatments killed ≥ 85% of mosquitoes exposed on palm ceilings and ≥ 90% of those exposed on mud walls, but up to 50% of this toxicity decayed within 1-3 months, except for DDT. By 6th month, only 7.5%, 42.5% and 30.0% of mosquitoes died when exposed to ceilings sprayed with pirimiphos-methyl, DDT or lambda-cyhalothrin respectively, while 12.5%, 36.0% and 27.5% died after exposure to mud walls sprayed with the same insecticides. In wire-ball assays, mortality decreased from 98.1% in 1st month to 92.6% in 6th month in tests on PermaNet 2.0®, from 100% to 61.1% on Icon Life® and from 93.2% to 33.3% on Olyset® nets. In cone bioassays, mortality reduced from 92.8% in 1st month to 83.3% in 6th month on PermaNet 2.0®, from 96.9% to 43.80% on Icon Life® and from 85.6% to 14.6% on Olyset®. Wild An. arabiensis were 100% susceptible to DDT, 95.8% to deltamethrin, 90.2% to lambda cyhalothrin and 95.2% susceptible to permethrin. No kdr gene mutations were detected. In bioassays where sufficient contact with treated surfaces is assured, LLINs and IRS kill high

  4. Organochlorine pesticides (OCPs) and polychlorinated biphenyls (PCBs) in sediments from the Gulf of Batabanó, Cuba.

    Science.gov (United States)

    Alonso-Hernandez, C M; Mesa-Albernas, M; Tolosa, I

    2014-01-01

    The spatial distribution of various organochlorinated compounds, e.g. PCBs, DDTs, HCB and HCHs, were investigated in sediments of the Gulf of Batabanó, Cuba. Among the target organochlorine compounds measured, ΣDDT isomers were the predominant contaminant with concentrations ranging from 0.019 to 1.27 ng g(-1)dry wt. Lindane was present at very low concentrations in the range n.d. to 0.05 ng g(-1), while PCBs and other organochlorine pesticide residues, such as HCB, Heptaclor, Aldrin and Mirex were lower than detection limits (∼0.010 ng g(-1)). According to established sediment quality guidelines, the OCPs concentrations encountered in the surface sediments are probably not having an adverse effect on sediment dwelling organisms. Compared to concentrations reported in coastal environments from other parts of the world, PCBs and OCs concentrations in surface sediments of Batabanó Gulf were low and similar to the reported for remote and pristine environments. These results contribute to the sparse regional database for organochlorinated compounds in the Caribbean marine environment. Copyright © 2013. Published by Elsevier Ltd.

  5. Susceptibility of pest Nezara viridula (Heteroptera: Pentatomidae) and parasitoid Trichopoda pennipes (Diptera: Tachinidae) to selected insecticides.

    Science.gov (United States)

    Tillman, P Glynn

    2006-06-01

    Susceptibility of the southern green stink bug, Nezara viridula (L.) (Heteroptera: Pentatomidae), and its endoparasitoid Trichopoda pennipes (F.) (Diptera: Tachinidae) to acetamiprid, cyfluthrin, dicrotophos, indoxacarb, oxamyl, and thiamethoxam was compared in residual and oral toxicity tests. In the residual toxicity test, cyfluthrin, dicrotophos, and oxamyl were highly toxic to N. viridula. Thiamethoxam was moderately toxic to these insects. Each of the four insecticides was highly toxic to T. pennipes after prolonged tarsal contact with dried residues of these chemicals. In the oral toxicity test, where N. viridula fed on food covered with insecticide residues, none of the insecticides were toxic to adults of this stink bug, but acetamiprid, dicrotophos, and thiamethoxam were moderately toxic to the nymphs. In the oral toxicity test, where N. viridula fed on a gel-food containing insecticides, cyfluthrin, dicrotophos, oxamyl, and thiamethoxam were highly toxic to this stink bug. In an oral toxicity test using contaminated sugar water, all of the insecticides were highly toxic to T. pennipes. Because insecticides were as toxic, or more toxic, to T. pennipes than to N. viridula, it is extremely important to conserve this parasitoid by applying these insecticides for control of southern green stink bugs only when the pest reaches economic threshold.

  6. Pest insect olfaction in an insecticide-contaminated environment: info-disruption or hormesis effect.

    Science.gov (United States)

    Tricoire-Leignel, Hélène; Thany, Steeve Hervé; Gadenne, Christophe; Anton, Sylvia

    2012-01-01

    Most animals, including pest insects, live in an "odor world" and depend strongly on chemical stimuli to get information on their biotic and abiotic environment. Although integrated pest management strategies including the use of insect growth regulators (IGRs) are increasingly developed, most insect pest treatments rely on neurotoxic chemicals. These molecules are known to disrupt synaptic transmission, affecting therefore sensory systems. The wide-spread use of neurotoxic insecticides and the growing use of IGRs result in residual accumulation of low concentrations in the environment. These insecticide residues could act as an "info-disruptor" by modifying the chemical communication system, and therefore decrease chances of reproduction in target insects. However, residues can also induce a non-expected hormesis effect by enhancing reproduction abilities. Low insecticide doses might thus induce adaptive processes in the olfactory pathway of target insects, favoring the development of resistance. The effect of sublethal doses of insecticides has mainly been studied in beneficial insects such as honeybees. We review here what is known on the effects of sublethal doses of insecticides on the olfactory system of insect pests.

  7. Pest insect olfaction in an insecticide-contaminated environment : info-disruption or hormesis effect

    Directory of Open Access Journals (Sweden)

    Hélène eTricoire-Leignel

    2012-03-01

    Full Text Available Most animals, including pest insects, live in an odour world and depend strongly on chemical stimuli to get information on their biotic and abiotic environment. Although integrated pest management strategies including the use of insect growth regulators (IGRs are increasingly developed, most insect pest treatments rely on neurotoxic chemicals. These molecules are known to disrupt synaptic transmission, affecting therefore sensory systems. The wide-spread use of neurotoxic insecticides and the growing use of IGRs result in residual accumulation of low concentrations in the environment. These insecticide residues could act as an info-disruptor by modifying the chemical communication system, and therefore decrease chances of reproduction in target insects. However, residues can also induce a non-expected hormesis effect by enhancing reproduction abilities. Low insecticide doses might thus induce adaptive processes in the olfactory pathway of target insects, favouring the development of resistance. The effect of sublethal doses of insecticides has mainly been studied in beneficial insects such as honeybees. We review here what is known on the effects of sublethal doses of insecticides on the olfactory system of insect pests.

  8. Author Details

    African Journals Online (AJOL)

    Oyekunle, JAO. Vol 16, No 2 (2014) - Articles Levels of organochlorine insecticide residues in cowpea grains and dried yam chips from markets in Ile-Ife, southwestern Nigeria: A preliminary survey. Abstract PDF · Vol 17, No 2 (2015) - Articles Measurement of the specific and the apparent molar volumes of some even chain ...

  9. Presence of pesticide residues on produce cultivated in Suriname.

    Science.gov (United States)

    Abdoel Wahid, F; Wickliffe, J; Wilson, M; Van Sauers, A; Bond, N; Hawkins, W; Mans, D; Lichtveld, M

    2017-06-01

    Agricultural pesticides are widely used in Suriname, an upper middle-income Caribbean country located in South America. Suriname imported 1.8 million kg of agricultural pesticides in 2015. So far, however, national monitoring of pesticides in crops is absent. Reports from the Netherlands on imported Surinamese produce from 2010 to 2015 consistently showed that samples exceeded plant-specific pesticide maximum residue limits (MRLs) of the European Union (EU). Consumption of produce containing unsafe levels of pesticide residues can cause neurological disorders, and particularly, pregnant women and children may be vulnerable. This pilot study assessed the presence of pesticide residues in commonly consumed produce items cultivated in Suriname. Thirty-two insecticides (organophosphates, organochlorines, carbamates, and pyrethroids) and 12 fungicides were evaluated for their levels in nine types of produce. Pesticide residue levels exceeding MRLs in this study regarded cypermethrin (0.32 μg/g) in tomatoes (USA MRL 0.20 μg/g), lambda-cyhalothrin (1.08 μg/g) in Chinese cabbage (USA MRL 0.40 μg/g), endosulfan (0.07 μg/g) in tannia (EU MRL 0.05 μg/g), and lindane (0.02 and 0.03 μg/g, respectively) in tannia (EU MRL 0.01 μg/g). While only a few pesticide residues were detected in this small pilot study, these residues included two widely banned pesticides (endosulfan and lindane). There is a need to address environmental policy gaps. A more comprehensive sampling and analysis of produce from Suriname is warranted to better understand the scope of the problem. Preliminary assessments, using intake rate, hazard quotient, and level of concern showed that it is unlikely that daily consumption of tannia leads to adverse health effects.

  10. Persistent organochlorine residues and toxic evaluation of polychlorinated biphenyls in sharks from the Mediterranean Sea (Italy)

    Energy Technology Data Exchange (ETDEWEB)

    Storelli, M.M.; Marcotrigiano, G.O. [Bari Univ., Dip. Farmaco-Biologico, Bari (Italy)

    2001-07-01

    Persistent organochlorines such as polychlorinated biphenyls including coplanar congeners, DDT compounds and HCB were measured in different tissues (muscle, liver and eggs) of two Mediterranean shark species: namely Centrophorus granulosus and Squalus blainvillei. The concentrations of organochlorines in the tissues and organs of both species were in the order DDTs>PCBs>HCB. The highest values of DDTs, PCBs and HCB were found in liver followed by eggs and muscle. Among DDTs the compound found in greatest concentration was p,p -DDE. The PCB profiles were dominated by congeners 138, 153, and 180. The isomers with higher TEQs values were non- and mono-ortho congeners than di-ortho ones in muscle, liver and eggs of both species. Among the non-ortho, PCB 126 was the major contributing individual to the total TEQs in both species. (Author)

  11. Reduction of neonicotinoid insecticide residues in Prairie wetlands by common wetland plants.

    Science.gov (United States)

    Main, Anson R; Fehr, Jessica; Liber, Karsten; Headley, John V; Peru, Kerry M; Morrissey, Christy A

    2017-02-01

    Neonicotinoid insecticides are frequently detected in wetlands during the early to mid-growing period of the Canadian Prairie cropping season. These detections also overlap with the growth of macrophytes that commonly surround agricultural wetlands which we hypothesized may reduce neonicotinoid transport and retention in wetlands. We sampled 20 agricultural wetlands and 11 macrophyte species in central Saskatchewan, Canada, over eight weeks to investigate whether macrophytes were capable of reducing movement of neonicotinoids from cultivated fields and/or reducing concentrations in surface water by accumulating insecticide residues into their tissues. Study wetlands were surrounded by clothianidin-treated canola and selected based on the presence (n=10) or absence (n=10) of a zonal plant community. Neonicotinoids were positively detected in 43% of wetland plants, and quantified in 8% of all plant tissues sampled. Three plant species showed high rates of detection: 78% Equisetum arvense (clothianidin, range: wetlands had higher detection frequency and water concentrations of clothianidin (β±S.E.: -0.77±0.26, P=0.003) and thiamethoxam (β±S.E.: -0.69±0.35, P=0.049) than vegetated wetlands. We assessed the importance of wetland characteristics (e.g. vegetative zone width, emergent plant height, water depth) on neonicotinoid concentrations in Prairie wetlands over time using linear mixed-effects models. Clothianidin concentrations were significantly lower in wetlands surrounded by taller plants (β±S.E.: -0.57±0.12, P≤0.001). The results of this study suggest that macrophytes can play an important role in mitigating water contamination by accumulating neonicotinoids and possibly slowing transport to wetlands during the growing season. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Evaluation of the quality of measurement of organochlorine contaminants in the marine environment: the QUASIMEME experience

    NARCIS (Netherlands)

    Wells, D.E.; Boer, de J.

    2006-01-01

    Organochlorine residues in marine environmental test materials have been included in QUASIMEME Laboratory Performance Studies since 1996. The methods of data assessment include the Cofino model, which provides a sound basis for obtaining a reliable assigned value from the wide range of data

  13. The Preliminary Study of Organochlorine Pesticide Residues on Sediments of Bivalvia Fishing Ground at Eastern Part of Coastal Semarang

    Science.gov (United States)

    Adhi Suryono, Chrisna; Subagyo; Setyati, Wilis Ari; Sri Susilo, Endang; Rochaddi, Baskoro; Triaji Mahendrajaya, Robertus

    2018-02-01

    This paper presents the occurrence level of organochlorine contamination in marine sediments of Semarang coastal areas as a fishing ground of Bivalvia. Five compounds (Heptachlor, Aldrin, Endosulfan, Endrin and pp-DDT) of contaminant have been determined in the sediments surface of Semarang coastal waters. The samples were then analyzed by using gas chromatography and followed by using the method of Standard Method Examination. The result showed that the average concentration of organochlorine pesticides Heptachlor, Aldrin, Endosulfan, Endrin and pp-DDT were 25.5, bellow detected, 7.1, 37.2, 28.6 μ g/L, respectively. The high concentration of pesticide showed on Endrin (65,84 ppb), pp-DDT (29,53 μ g/L), and heptachlor (25,45 μ g/L). The low concentrations were detected on aldrin (bellow detected) and endosulfan (0,92 μ g/L). The concentration of organochlorine pesticides in these areas might contribute on four rivers which deposited the sediment in these coastal waters

  14. The Field Practices of Lambdacyhalothrin and Deltamethrin Insecticides Against Adult Mosquitoes of Anopheles stephensi as the Main Vector of Malaria: Residual Effects

    Directory of Open Access Journals (Sweden)

    Mousa Khosravani

    2017-04-01

    Full Text Available Background Various chemical control methods have adopted in anti-malaria interventions. Indoor residual spraying (IRS has been proven as a candidate in elimination program. On the other hand, resistance to multiple insecticides was implicated as a concern issue in these polices. Pesticides should be evaluated to identify probable resistant and make decision to choose a technique against vectors. Methods In this cross-sectional study, Bioassay test applied on lambdacyhalothrin WP 10% (0.05 mg a.i. /m2 and deltamethrin WP 5% (0.05 mg a.i./m2 on two surfaces (cement and plaster against adult mosquitoes of Anopheles stephensi according to WHO criteria to measure the residual activity in Saravan county, southern Iran. Overall, 3960 mosquitoes was used in our research. The mortality rates of An.stephensi Liston (Diptera: Culicidae measured between selected surfaces and insecticides in several times. Data analyzed by Mann-Whitney (nonparametric test using SPSS v22 statistic software. Results This paper illustrated that maximal course of residual efficacy was about 3 months. No statistically significant different was exhibited between type of surface within mortality rates of An. Stephensi (P = 0.724 but lambdacyhalothrin has more durability than deltamethrin Conclusions We established that lambdacyhalothrin can be used into control and elimination setting of malaria with two rounds of spray at an interval of 3-4 months in south of Iran.

  15. Persistent organochlorine residues in human breast milk from Hanoi and Hochiminh City, Vietnam contamination, accumulation kinetics and risk assessment for infants

    International Nuclear Information System (INIS)

    Minh, Nguyen Hung; Someya, Masayuki; Minh, Tu Binh; Kunisue, Tatsuya; Iwata, Hisato; Watanabe, Mafumi; Tanabe, Shinsuke; Viet, Pham Hung; Tuyen, Bui Cach

    2004-01-01

    Despite the ban on persistent organochlorines (OCs) in most of the developed nations, their usage continued until recently in many Asian developing countries including Vietnam, for agricultural purposes and vector-borne disease eradication programs. In this study, we collected human breast milk samples from the two big cities in Vietnam: Hanoi (n=42) and Hochiminh (n=44) and determined the concentrations of persistent OCs such as PCBs, DDT and its metabolites (DDTs), hexachlorocyclohexanes (HCHs), hexachlorobenzene (HCB), chlordane compounds (CHLs) and tris-4-chlorophenyl-methane (TCPMe). The contamination pattern of OCs was in the order of DDTs > PCBs > HCHs > CHLs∼HCB∼TCPMe. Compilation of available data indicated that DDT residue levels in human breast milk from Vietnam were among the highest values reported for Asian developing countries as well as developed nations. This result suggests recent usage of DDTs in both north and south Vietnam. Interestingly, in both cities, the p,p'-DDT portion was higher in multiparas than those in primiparas. Considering the fact that the interval between the first and the second child of a mother in Vietnam is usually short, this result probably indicates continuous intake of DDTs in the population. Analysis of infant exposure to DDTs via breast milk suggested that the daily intake rates for number of individuals are close to or above the threshold for adverse effects which may raise concern on children health. - It is suggested that daily intake rates of persistent organochlorines in mothers in Vietnam may result in health risk for nursing children

  16. Implications of bio-efficacy and persistence of insecticides when indoor residual spraying and long-lasting insecticide nets are combined for malaria prevention

    Directory of Open Access Journals (Sweden)

    Okumu Fredros O

    2012-11-01

    Full Text Available Abstract Background Bio-efficacy and residual activity of insecticides used for indoor residual spraying (IRS and long-lasting insecticide nets (LLINs were assessed against laboratory-reared and wild populations of the malaria vector, Anopheles arabiensis in south eastern Tanzania. Implications of the findings are examined in the context of potential synergies and redundancies where IRS and LLINs are combined. Methods Bioassays were conducted monthly for six months on three LLIN types (Olyset® PermaNet 2.0®,and Icon Life® and three IRS treatments (2 g/m2 pirimiphos-methyl, 2 g/m2 DDT and 0.03 g/m2 lambda-cyhalothrin, sprayed on mud walls and palm ceilings of experimental huts. Tests used susceptible laboratory-reared An. arabiensis exposed in cones (nets and IRS or wire balls (nets only. Susceptibility of wild populations was assessed using WHO diagnostic concentrations and PCR for knock-down resistance (kdr genes. Results IRS treatments killed ≥ 85% of mosquitoes exposed on palm ceilings and ≥ 90% of those exposed on mud walls, but up to 50% of this toxicity decayed within 1–3 months, except for DDT. By 6th month, only 7.5%, 42.5% and 30.0% of mosquitoes died when exposed to ceilings sprayed with pirimiphos-methyl, DDT or lambda-cyhalothrin respectively, while 12.5%, 36.0% and 27.5% died after exposure to mud walls sprayed with the same insecticides. In wire-ball assays, mortality decreased from 98.1% in 1st month to 92.6% in 6th month in tests on PermaNet 2.0®, from 100% to 61.1% on Icon Life® and from 93.2% to 33.3% on Olyset® nets. In cone bioassays, mortality reduced from 92.8% in 1st month to 83.3% in 6th month on PermaNet 2.0®, from 96.9% to 43.80% on Icon Life® and from 85.6% to 14.6% on Olyset®. Wild An. arabiensis were 100% susceptible to DDT, 95.8% to deltamethrin, 90.2% to lambda cyhalothrin and 95.2% susceptible to permethrin. No kdr gene mutations were detected. Conclusions In bioassays where sufficient contact with

  17. Pheromone-assisted techniques to improve the efficacy of insecticide sprays against Linepithema humile (Hymenoptera: Formicidae).

    Science.gov (United States)

    Choe, Dong-Hwan; Tsai, Kasumi; Lopez, Carlos M; Campbell, Kathleen

    2014-02-01

    Outdoor residual sprays are among the most common methods for targeting pestiferous ants in urban pest management programs. If impervious surfaces such as concrete are treated with these insecticides, the active ingredients can be washed from the surface by rain or irrigation. As a result, residual sprays with fipronil and pyrethroids are found in urban waterways and aquatic sediments. Given the amount of insecticides applied to urban settings for ant control and their possible impact on urban waterways, the development of alternative strategies is critical to decrease the overall amounts of insecticides applied, while still achieving effective control of target ant species. Herein we report a "pheromone-assisted technique" as an economically viable approach to maximize the efficacy of conventional sprays targeting the Argentine ant. By applying insecticide sprays supplemented with an attractive pheromone compound, (Z)-9-hexadecenal, Argentine ants were diverted from nearby trails and nest entrances and subsequently exposed to insecticide residues. Laboratory experiments with fipronil and bifenthrin sprays indicated that the overall kill of the insecticides on Argentine ant colonies was significantly improved (57-142% increase) by incorporating (Z)-9-hexadecenal in the insecticide sprays. This technique, once it is successfully implemented in practical pest management programs, has the potential of providing maximum control efficacy with reduced amount of insecticides applied in the environment.

  18. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  19. Control of pyrethroid and DDT-resistant Anopheles gambiae by application of indoor residual spraying or mosquito nets treated with a long-lasting organophosphate insecticide, chlorpyrifos-methyl

    Directory of Open Access Journals (Sweden)

    Chabi Joseph

    2010-02-01

    Full Text Available Abstract Background Scaling up of long-lasting insecticidal nets (LLINs and indoor residual spraying (IRS with support from the Global Fund and President's Malaria Initiative is providing increased opportunities for malaria control in Africa. The most cost-effective and longest-lasting residual insecticide DDT is also the most environmentally persistent. Alternative residual insecticides exist, but are too short-lived or too expensive to sustain. Dow Agrosciences have developed a microencapsulated formulation (CS of the organophosphate chlorpyrifos methyl as a cost-effective, long-lasting alternative to DDT. Methods Chlorpyrifos methyl CS was tested as an IRS or ITN treatment in experimental huts in an area of Benin where Anopheles gambiae and Culex quinquefasiactus are resistant to pyrethroids, but susceptible to organophosphates. Efficacy and residual activity was compared to that of DDT and the pyrethroid lambdacyalothrin. Results IRS with chlorpyrifos methyl killed 95% of An. gambiae that entered the hut as compared to 31% with lambdacyhalothrin and 50% with DDT. Control of Cx. quinquefasciatus showed a similar trend; although the level of mortality with chlorpyrifos methyl was lower (66% it was still much higher than for DDT (14% or pyrethroid (15% treatments. Nets impregnated with lambdacyhalothrin were compromized by resistance, killing only 30% of An. gambiae and 8% of Cx. quinquefasciatus. Nets impregnated with chlorpyrifos methyl killed more (45% of An gambiae and 15% of Cx. quinquefasciatus, but its activity on netting was of short duration. Contact bioassays on the sprayed cement-sand walls over the nine months of monitoring showed no loss of activity of chlorpyrifos methyl, whereas lambdacyhalothrin and DDT lost activity within a few months of spraying. Conclusion As an IRS treatment against pyrethroid resistant mosquitoes chlorpyrifos methyl CS outperformed DDT and lambdacyhalothrin. In IRS campaigns, chlorpyrifos methyl CS should

  20. Organochlorine pesticides in the ambient air of Chiapas, Mexico

    International Nuclear Information System (INIS)

    Alegria, Henry; Bidleman, Terry F.; Figueroa, Miguel Salvador

    2006-01-01

    Organochlorine (OC) pesticides were measured in the ambient air of Chiapas, Mexico during 2000-2001. Concentrations of some OC pesticides (DDTs, chlordanes, toxaphene) were elevated compared with levels in the Great Lakes region, while those of other pesticides were not (hexachlorocyclohexanes, dieldrin). While this suggests southern Mexico as a source region for the former group of chemicals, comparably high levels have also been reported in parts of the southern United States, where their suspected sources are soil emissions (DDTs, toxaphene) and termiticide usage (chlordane). Ratios of p,p'-DDT/p,p'-DDE and trans-chlordane/cis-chlordane/trans-nonachlor (TC/CC/TN) in Chiapas suggest a mixture of fresh and weathered sources, while congener profiles of toxaphene suggest emission of old residues from soils. This is supported by air parcel back trajectory analysis, which indicated that air masses over Chiapas at the time of sampling had previously passed over areas of continuing or recent use of some OC pesticides as well as areas of past use. - Elevated levels of several organochlorine pesticides were found in the ambient air of southern Mexico

  1. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange

    International Nuclear Information System (INIS)

    Wong, Fiona; Alegria, Henry A.; Bidleman, Terry F.

    2010-01-01

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM = 1.6 ng g -1 ), endosulfans (0.16 ng g -1 ), and toxaphenes (0.64 ng g -1 ). DDTs in soils of southern Mexico showed fresher signatures with higher F DDTe = p,p'-DDT/(p,p'-DDT + p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. - Chemical profiles of residues and soil-air fugacities are used to assess the potential of soil as a source of organochlorine pesticides to the air of Mexico.

  2. Concentrations of organochlorine pesticides and 2,4,6-trichloroanisole in cork bark.

    Science.gov (United States)

    Olivella, M Àngels; Caixach, Josep; Planas, Carles; Oliveras, Anna; Jové, Patrícia

    2012-02-01

    Organochlorine pesticides are persistent lipophilic organic pollutants and tend to accumulate in growing plants. During growth, cork is in contact with the open air for long periods (9-12 years). Owing to the previous widespread use of organochlorine pesticides and their high persistence in the environment, there is a risk that residues of such pesticides may be present in cork. In this study, the concentrations of 14 organochlorine pesticides-all of which are indicators of environmental pollution-were analyzed in cork bark samples from three regions in Spain and one in Portugal. In addition, the concentrations of 2,4,6-trichlorophenol (TCP) and 2,4,6-trichloroanisole (TCA) were also analyzed. Our results show only very low concentrations of lindane, γ-HCH (cork sample from Extremadura (0.1 ng g(-1)) and p,p'-DDE was present at a maximum concentration of 2.9 ng g(-1) in a cork sample from Castile-La Mancha. However, all concentrations were well below the legal limit established by Regulation (EC) No. 396/2005 (10 ng g(-1) in foodstuffs). We can conclude, therefore, that the cork samples we studied complied with food safety standards. Copyright © 2011 Elsevier Ltd. All rights reserved.

  3. Characteristic trend of persistent organochlorine contamination in wildlife from a tropical agricultural watershed, south India.

    Science.gov (United States)

    Ramesh, A; Tanabe, S; Kannan, K; Subramanian, A N; Kumaran, P; Tatsukawa, R

    1992-07-01

    The residue levels of persistent organochlorines, such as HCH (BHC: 1,2,3,4,5,6-hexachlorocyclohexane) isomers, DDT [1,1,1-trichloro-2,2-bis (p-chlorophenyl) ethane] compounds, PCBs (polychlorobiphenyls) and HCB (hexachlorobenzene), were measured in wildlife. The wildlife were sampled from terrestrial and aquatic habitats in and around the agricultural watershed of Parangipettai, South India. On the basis of overall concentrations sigma HCH ranked first followed by sigma DDT, sigma PCB and HCB, reflecting the increasing usage of HCH in recent years in India. The residue levels of organochlorines in birds varied according to their feeding habits and showed the following pattern: inland piscivores and scavengers greater than coastal piscivores greater than insectivores greater than omnivores greater than granivores. High levels of HCH and DDT residues were recorded in Pond heron and Cattle egret which feed in the agricultural fields. Comparison of HCH concentrations in fish and birds in the study area to other locations was made to further understand the dynamics of contaminant accumulation in tropical wildlife. Regarding birds, a wide variation in residue levels could be seen among various countries, with tropical regions registering high levels. In contrast, the variation is not prominent in the case of fish. The residue levels in fish measured in the present study were generally comparable to values reported from other locations. This suggests that the bioavailability of contaminants to the aquatic fauna is less due to the smaller flux and shorter residence time of these chemicals in the tropics.

  4. Carbaryl residues in maize products

    International Nuclear Information System (INIS)

    Zayed, S.M.A.D.; Mansour, S.A.; Mostafa, I.Y.; Hassan, A.

    1976-01-01

    The 14 C-labelled insecticide carbaryl was synthesized from [1- 14 C]-1-naphthol at a specific activity of 3.18mCig -1 . Maize plants were treated with the labelled insecticide under simulated conditions of agricultural practice. Mature plants were harvested and studied for distribution of total residues in untreated grains as popularly roasted and consumed, and in the corn oil and corn germ products. Total residues found under these conditions in the respective products were 0.2, 0.1, 0.45 and 0.16ppm. (author)

  5. Identification and validation of a gene causing cross-resistance between insecticide classes in Anopheles gambiae from Ghana.

    Science.gov (United States)

    Mitchell, Sara N; Stevenson, Bradley J; Müller, Pie; Wilding, Craig S; Egyir-Yawson, Alexander; Field, Stuart G; Hemingway, Janet; Paine, Mark J I; Ranson, Hilary; Donnelly, Martin James

    2012-04-17

    In the last decade there have been marked reductions in malaria incidence in sub-Saharan Africa. Sustaining these reductions will rely upon insecticides to control the mosquito malaria vectors. We report that in the primary African malaria vector, Anopheles gambiae sensu stricto, a single enzyme, CYP6M2, confers resistance to two classes of insecticide. This is unique evidence in a disease vector of cross-resistance associated with a single metabolic gene that simultaneously reduces the efficacy of two of the four classes of insecticide routinely used for malaria control. The gene-expression profile of a highly DDT-resistant population of A. gambiae s.s. from Ghana was characterized using a unique whole-genome microarray. A number of genes were significantly overexpressed compared with two susceptible West African colonies, including genes from metabolic families previously linked to insecticide resistance. One of the most significantly overexpressed probe groups (false-discovery rate-adjusted P P450 gene CYP6M2. This gene is associated with pyrethroid resistance in wild A. gambiae s.s. populations) and can metabolize both type I and type II pyrethroids in recombinant protein assays. Using in vitro assays we show that recombinant CYP6M2 is also capable of metabolizing the organochlorine insecticide DDT in the presence of solubilizing factor sodium cholate.

  6. Survival and Locomotory Behavior of Earwigs After Exposure to Reduced-Risk Insecticides.

    Science.gov (United States)

    Freitas, Catarina D; Gontijo, Lessando M; Guedes, Raul Narciso C; Chediak, Mateus

    2017-08-01

    The conservation of natural enemies is an important tactic to promote biological control of arthropod pests. The earwig Doru luteipes (Sccuder) is the most important predator of the fall armyworm Spodoptera frugiperda (J.E. Smith) in corn fields. One way of conserving these predators in the field is by using only selective insecticides when the pest population reaches the economic threshold. Some recent insecticides such as azadirachtin, chlorantraniliprole, and novaluron have been claimed to pose reduced risk for natural enemies. Nevertheless, there is a dearth of information regarding the selectivity of these insecticides upon earwigs in specific. In this study, we carried out a series of laboratory assays to examine the survivorship and locomotory behavior of D. luteipes after exposure to fresh dry residue of azadirachtin, chlorantraniliprole, and novaluron. Our results show a significant survival reduction for D. luteipes nymphs exposed to fresh residues of chlorantraniliprole and novaluron. In the behavioral studies, adults of D. luteipes stopped more often, spent more time resting (inactive), and moved more slowly immediately after exposure to chlorantraniliprole residue. These results suggest that chlorantraniliprole may mediate an impaired movement and a behavior arrestment of earwigs after contact with this insecticide fresh residue. This could translate into reduced foraging efficiency, and increase exposure and insecticide uptake. Although chlorantraniliprole and novaluron showed a potential to undermine the biological control provided by earwigs, it is yet essential to conduct field trials in order to confirm our laboratory results. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Preparation of reference material for organochlorine pesticides in a herbal matrix.

    Science.gov (United States)

    Wong, Yiu Chung; Wong, Siu Kay; Kam, Tat Ting

    2008-12-01

    The development of reference material for four organochlorine pesticides, namely hexachlorobenzene and three isomers of hexachlorocyclohexane (alpha-hexachlorocyclohexane, beta-hexachlorocyclohexane and gamma-hexachlorocyclohexane), in a ginseng root sample is presented. Raw materials (Panax ginseng) were purchased from a local market and confirmed to contain certain levels of incurred organochlorine pesticide residues by a validated gas chromatography-mass selective detection method. A total of more than 300 bottles each containing 25 g of samples were prepared after the materials had been freeze-dried, milled and thoroughly mixed. The homogeneity and stability of samples from randomly selected bottles were verified and the reference values were characterized using a highly precise isotope dilution gas chromatography-mass spectrometry (ID-GCMS) method that was recently developed by our laboratory. The purity of standard organochlorine chemicals was determined against certified reference materials to establish the accuracy of the ID-GCMS analysis. The concentrations (+/- expanded uncertainty) of hexachlorobenzene, alpha-hexachlorocyclohexane, beta-hexachlorocyclohexane and gamma-hexachlorocyclohexane in the reference material were 0.198 +/- 0.015, 0.450 +/- 0.022, 0.213 +/- 0.011 and 0.370 +/- 0.032 mg kg(-1), respectively. A portion (70 bottles) of the samples was also used in a proficiency testing (PT) scheme for assessing the testing capabilities of field laboratories. The consensus mean values of the PT obtained from the 70 participants were on the same order but deviated by -2.7 to -14.1% from those of the assigned reference values. Because of the wide spread of participants' data (relative standard deviation ranging from 44 to 56%), the PT results were not included in the calculation of the assigned values of the reference materials. The materials served as suitable reference materials to ascertain the quality control and validation processes for the

  8. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Fiona [Centre for Atmospheric Research Experiments, Science and Technology Branch, Environment Canada, 6248 Eighth Line, Egbert, Ontario L01 1N0 (Canada); Department of Chemistry, University of Toronto Scarborough, 1265 Military Trail, Toronto, Ontario M1C 1A4 (Canada); Alegria, Henry A. [Department of Environmental Science, Policy and Geography, University of South Florida St. Petersburg, 140 7th Ave. S., St. Petersburg, FL 33701 (United States); Bidleman, Terry F., E-mail: terry.bidleman@ec.gc.c [Centre for Atmospheric Research Experiments, Science and Technology Branch, Environment Canada, 6248 Eighth Line, Egbert, Ontario L01 1N0 (Canada)

    2010-03-15

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM = 1.6 ng g{sup -1}), endosulfans (0.16 ng g{sup -1}), and toxaphenes (0.64 ng g{sup -1}). DDTs in soils of southern Mexico showed fresher signatures with higher F{sub DDTe} = p,p'-DDT/(p,p'-DDT + p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. - Chemical profiles of residues and soil-air fugacities are used to assess the potential of soil as a source of organochlorine pesticides to the air of Mexico.

  9. Comparison of susceptibility of pest Euschistus servus and predator Podisus maculiventris (Heteroptera: Pentatomidae) to selected insecticides.

    Science.gov (United States)

    Tillman, P Glynn; Mullinix, Benjamin G

    2004-06-01

    Susceptibility of the brown stink bug, Euschistus serous (Say), and the spined soldier bug, Podisus maculiventris (Say), to acetamiprid, cyfluthrin, dicrotophos, indoxacarb, oxamyl, and thiamethoxam, was compared in residual and oral toxicity tests. Generally, susceptibility of P. maculiventris to insecticides was significantly greater than or not significantly different from that of E. servus. Cyfluthrin and oxamyl were more toxic to the predator than to E. servus in residual and feeding tests, respectively. Dicrotophos is the only compound that exhibited both good residual and oral activity against E. servus, but even this toxicant was more toxic to the predator than to the pest in oral toxicity tests. Feeding on indoxacarb-treated food caused high mortality for both nymphs and adults of P. maculiventris. In contrast, E. servus was unaffected by feeding on food treated with this compound. Insecticide selectivity to P. maculiventris was detected only with acetamiprid for adults in residual toxicity tests and for nymphs in oral toxicity tests. Because insecticide selectivity to P. maculiventris was limited, it is extremely important to conserve P. maculiventris in cotton fields by applying these insecticides for control of brown stink bugs only when the pest reaches economic threshold.

  10. The comparative insecticidal and residual efficacy of sniper and ...

    African Journals Online (AJOL)

    Otoigiakih

    Chemical control is still the main approach for urban pest control (Castle et al., 1999; Rozendaal, 1997; Marrs,. 1993; Lee and Yap, 2003; Tidwell et al., 1994). The use of insecticides is seen as the most effective tool in cockroach control program (WHO, 1996; Chavasse and. Yap, 1997; Lee and Yap, 2003; Tidwell et al., ...

  11. Organochlorine pesticides in sediment and biological samples from the coastal lagoons of Nicaragua

    International Nuclear Information System (INIS)

    Montenegro, S.; Lacayo, M.; Picado, F.; Lopez, A.

    1999-01-01

    A study was carried out on the Pacific coast of Nicaragua to investigate the contamination of the coastal lagoons with residues of agricultural pesticides. Samples were taken during 1995 from the areas of Estero Real, Padre Ramos, Maderas Negras, Naranjo and Paso Caballos, and during 1996 from Aposentillo to Estero Barquito - Posoltega River. Analysis of the samples of sediment and aquatic life (fishes, oysters and bivalves) showed that they were contaminated with organochlorine pesticides. The pesticides found in the highest concentrations were toxaphene (1,734 μg.kg -1 ) and p,p-DDE (275 μg kg -1 ). These data indicate widespread contamination of the ecosystem with organochlorine pesticides in the main Pacific coastal lagoons of Nicaragua, resulting from intensive agricultural use of pesticides during the past decades. The contamination has been carried from the agricultural areas to the coastal lagoons by the rivers passing through the cultivated areas. (author)

  12. Insecticide susceptibility of Aedes aegypti populations from Senegal and Cape Verde Archipelago.

    Science.gov (United States)

    Dia, Ibrahima; Diagne, Cheikh Tidiane; Ba, Yamar; Diallo, Diawo; Konate, Lassana; Diallo, Mawlouth

    2012-10-22

    Two concomitant dengue 3 (DEN-3) epidemics occurred in Cape Verde Archipelago and Senegal between September and October 2009. Aedes aegypti was identified as the vector of these epidemics as several DEN-3 virus strains were isolated from this species in both countries. The susceptibility to pyrethroids, organochlorine, organophosphates and carbamate was investigated in two field strains of Aedes aegypti from both countries using WHO diagnostic bioassay kits in order to monitor their the current status of insecticide susceptibility. The two tested strains were highly resistant to DDT. The Cape Verde strain was found to be susceptible to all others tested insecticides except for propoxur 0.1%, which needs further investigation. The Dakar strain was susceptible to fenitrothion 1% and permethrin 0.75%, but displayed reduced susceptibility to deltamethrin, lambda-cyhalothrin and propoxur. As base-line results, our observations stress a careful management of insecticide use for the control of Ae. aegypti. Indeed, they indicate that DDT is no longer efficient for the control of Ae. aegypti populations in Cape Verde and Dakar and further suggest a thorough follow-up of propoxur susceptibility status in both sites and that of deltamethrin and lambda-cyhalothrin in Ae. aegypti populations in Dakar. Thus, regular monitoring of susceptibility is greatly needed as well as the knowing if this observed resistance/susceptibility is focal or not and for observed resistance, the use of biochemical methods is needed with detailed comparison of resistance levels over a large geographic area. Aedes aegypti, Insecticides, Susceptibility, Cape Verde, Senegal.

  13. Effect of Cooking on 14C-Chloropyrifos Residues in Stored Faba Beans

    International Nuclear Information System (INIS)

    Mahdy, F.

    2006-01-01

    The effect of cooking on the amount and nature of 14 C-chloropyrifos residues in stored vicia faba beans was studied. faba beans treated with (ethyl-1- 14 C) chloropyrifos insecticide at a dose 15 and 45 mg insecticide/kg seeds and stored for 30 weeks had 50-54% of the actual applied doses inside the grains in the form of extractable and bound 14 C- chloropyrifos residues. Extractable residues in cooked beans included, in addition to the parent insecticide O-analogue, desethyl chloropyrifos and 3,5,6-trichloro pyridinol, as main degradation products of 14 C-chloropyrifos

  14. Development of a new method for the determination of residues of the neonictinoid insecticide imidacloprid in juvenile Chinook (Oncorhynchus tyshawytscha) using ELISA detection

    Science.gov (United States)

    Frew, John A.; Grue, Christian E.

    2012-01-01

    The neonicotinoid insecticide imidacloprid (IMI) has been proposed as an alternative to carbaryl for controlling indigenous burrowing shrimp on commercial oyster beds in Willapa Bay and Grays Harbor, Washington. A focus of concern over the use of this insecticide in an aquatic environment is the potential for adverse effects from exposure to non-target species residing in the Bay, such as juvenile Chinook (Oncorhynchus tshawytscha) and cutthroat trout (O. clarki). Federal registration and State permiting approval for the use of IMI will require confirmation that the compound does not adversely impact these salmonids following field applications. This will necessitate an environmental monitoring program for evaluating exposure in salmonids following the treatment of beds. Quantification of IMI residues in tissue can be used for determining salmonid exposure to the insecticide. Refinement of an existing protocol using liquid-chromatography mass spectrometry (LC-MS) detection would provide the low limits of quantification, given the relatively small tissue sample sizes, necessary for determining exposure in individual fish. Such an approach would not be viable for the environmental monitoring effort in Willapa Bay and Grays Harbor due to the high costs associated with running multiple analyses, however. A new sample preparation protocol was developed for use with a commercially available enzyme-linked immunosorbent assay (ELISA) for the quantification of IMI, thereby providing a low-cost alternative to LC-MS for environmental monitoring in Willapa Bay and Grays Harbor. Extraction of the analyte from the salmonid brain tissue was achieved by Dounce homogenization in 4.0 mL of 20.0 mM Triton X-100, followed by a 6 h incubation at 50–55 °C. Centrifugal ultrafiltration and reversed phase solid phase extraction were used for sample cleanup. The limit of quantification for an average 77.0 mg whole brain sample was calculated at 18.2 μg kg-1 (ppb) with an average

  15. A new threat to public health: organochlorines and food.

    Science.gov (United States)

    Hall, R H

    1992-01-01

    Ambient levels of persistent toxic chemicals, chemicals that persist for decades in the environment, have reached levels high enough to affect the health of children. The organochlorines (PCBs, DDT and the dioxin family) accumulate in human adipose tissue. Pregnant women pass the contamination to their fetuses. The developing nervous system is the most vulnerable. Neurobehavioral deficits, including short-term memory loss, are detected in children born to mothers at the high end of the distribution curve of organochlorines. Humans are not alone in their susceptibility to these subtle effects. Wildlife exposed to the same spectrum of organochlorines as humans suffer a variety of behavioral changes. Rats and Rhesus monkeys fed diets containing the organochlorines under laboratory conditions exhibit behavioral changes that persist into adulthood. For humans, food provides 80 percent of organochlorine contamination. Meat, fish, dairy and commercial fruit are the main sources. A vegetarian diet including unsprayed fruit minimizes contamination. The ultimate solution to this public health problem is elimination of the organochlorines from the environment.

  16. Multiple insecticide resistances in the disease vector Culex p. quinquefasciatus from Western Indian Ocean.

    Science.gov (United States)

    Pocquet, Nicolas; Milesi, Pascal; Makoundou, Patrick; Unal, Sandra; Zumbo, Betty; Atyame, Célestine; Darriet, Frédéric; Dehecq, Jean-Sébastien; Thiria, Julien; Bheecarry, Ambicadutt; Iyaloo, Diana P; Weill, Mylène; Chandre, Fabrice; Labbé, Pierrick

    2013-01-01

    Several mosquito-borne diseases affect the Western Indian Ocean islands. Culex pipiens quinquefasciatus is one of these vectors and transmits filariasis, Rift Valley and West Nile viruses and the Japanese encephalitis. To limit the impact of these diseases on public health, considerable vector control efforts have been implemented since the 50s, mainly through the use of neurotoxic insecticides belonging to Organochlorines (OC), Organophosphates (OP) and pyrethroids (PYR) families. However, mosquito control failures have been reported on site, and they were probably due to the selection of resistant individuals in response to insecticide exposure. In this study, we used different approaches to establish a first regional assessment of the levels and mechanisms of resistance to various insecticides. Bioassays were used to evaluate resistance to various insecticides, enzyme activity was measured to assess the presence of metabolic resistances through elevated detoxification, and molecular identification of known resistance alleles was investigated to determine the frequency of target-site mutations. These complementary approaches showed that resistance to the most used insecticides families (OC, OP and PYR) is widespread at a regional scale. However, the distribution of the different resistance genes is quite heterogeneous among the islands, some being found at high frequencies everywhere, others being frequent in some islands and absent in others. Moreover, two resistance alleles displayed clinal distributions in Mayotte and La Réunion, probably as a result of a heterogeneous selection due to local treatment practices. These widespread and diverse resistance mechanisms reduce the capacity of resistance management through classical strategies (e.g. insecticide rotation). In case of a disease outbreak, it could undermine the efforts of the vector control services, as only few compounds could be used. It thus becomes urgent to find alternatives to control populations

  17. Multiple insecticide resistances in the disease vector Culex p. quinquefasciatus from Western Indian Ocean.

    Directory of Open Access Journals (Sweden)

    Nicolas Pocquet

    Full Text Available Several mosquito-borne diseases affect the Western Indian Ocean islands. Culex pipiens quinquefasciatus is one of these vectors and transmits filariasis, Rift Valley and West Nile viruses and the Japanese encephalitis. To limit the impact of these diseases on public health, considerable vector control efforts have been implemented since the 50s, mainly through the use of neurotoxic insecticides belonging to Organochlorines (OC, Organophosphates (OP and pyrethroids (PYR families. However, mosquito control failures have been reported on site, and they were probably due to the selection of resistant individuals in response to insecticide exposure. In this study, we used different approaches to establish a first regional assessment of the levels and mechanisms of resistance to various insecticides. Bioassays were used to evaluate resistance to various insecticides, enzyme activity was measured to assess the presence of metabolic resistances through elevated detoxification, and molecular identification of known resistance alleles was investigated to determine the frequency of target-site mutations. These complementary approaches showed that resistance to the most used insecticides families (OC, OP and PYR is widespread at a regional scale. However, the distribution of the different resistance genes is quite heterogeneous among the islands, some being found at high frequencies everywhere, others being frequent in some islands and absent in others. Moreover, two resistance alleles displayed clinal distributions in Mayotte and La Réunion, probably as a result of a heterogeneous selection due to local treatment practices. These widespread and diverse resistance mechanisms reduce the capacity of resistance management through classical strategies (e.g. insecticide rotation. In case of a disease outbreak, it could undermine the efforts of the vector control services, as only few compounds could be used. It thus becomes urgent to find alternatives to

  18. Bioefficacy, dissipation kinetics and safety evaluation of selected insecticides in Allium cepa L.

    Science.gov (United States)

    Srinivas P, Satya; Banerjee, Kaushik; Jadhav, Manjusha R; Ghaste, Manoj S; Lawande, K E

    2012-01-01

    This paper reports the bioefficacy of selected insecticides against thrips and their pre-harvest intervals (PHI) in onion pertaining to their recommended application rates and maximum residue limits. Profenophos, methomyl and imidacloprid showed comparatively higher bioefficacy against thrips. GC-MS and LC-MS/MS-based residue analysis methods in onion bulbs and composite matrix of bulbs+leaves were thoroughly validated. The residue data for bulb+leaves was assessed with reference to the EU-MRLs applicable for spring onion. Dimethoate was the most stable chemical with PHI of 52.5 days, followed by monocrotophos (24 days) and carbofuran (20.5 days). The PHIs of profenophos, chlorpyrifos, methomyl and cypermethrin were similar and within the range of 10-13 days. Imidacloprid and λ-cyhalothrin had similar PHI of 4.5 days. Spinosad was the fastest-degrading chemical with PHI of 2 days. The combined bioefficacy and residue dynamics information will support label-claim of these insecticides for the management of thrips in onion, help in scheduling their applications in pest management program as per relative PHIs and minimize the residue accumulations at harvest. The dietary exposure was less than the maximum permissible intake for most of the insecticides on all sampling days except for dimethoate and monocrotophos.

  19. Erythritol, a non-nutritive sugar alcohol sweetener and the main component of truvia®, is a palatable ingested insecticide.

    Directory of Open Access Journals (Sweden)

    Kaitlin M Baudier

    Full Text Available Insecticides have a variety of commercial applications including urban pest control, agricultural use to increase crop yields, and prevention of proliferation of insect-borne diseases. Many pesticides in current use are synthetic molecules such as organochlorine and organophosphate compounds. Some synthetic insecticides suffer drawbacks including high production costs, concern over environmental sustainability, harmful effects on human health, targeting non-intended insect species, and the evolution of resistance among insect populations. Thus, there is a large worldwide need and demand for environmentally safe and effective insecticides. Here we show that Erythritol, a non-nutritive sugar alcohol, was toxic to the fruit fly Drosophila melanogaster. Ingested erythritol decreased fruit fly longevity in a dose-dependent manner, and erythritol was ingested by flies that had free access to control (sucrose foods in choice and CAFE studies. Erythritol was US FDA approved in 2001 and is used as a food additive in the United States. Our results demonstrate, for the first time, that erythritol may be used as a novel, environmentally sustainable and human safe approach for insect pest control.

  20. Incremental cost of implementing residual insecticide treatment with delthametrine on top of intensive routine Aedes aegypti control.

    Science.gov (United States)

    Baly, Alberto; Gonzalez, Karelia; Cabrera, Pedro; Popa, Julio C; Toledo, Maria E; Hernandez, Claudia; Montada, Domingo; Vanlerberghe, Veerle; Van der Stuyft, Patrick

    2016-05-01

    Information on the cost of implementing residual insecticide treatment (RIT) for Aedes control is scarce. We evaluated the incremental cost on top of intensive conventional routine activities of the Aedes control programme (ACP) in the city of Santiago de Cuba, Cuba. We conducted the cost analysis study in 2011-2012, from the perspective of the ACP. Data sources were bookkeeping records, activity registers of the Provincial ACP Centre and the accounts of an RIT implementation study in 21 clusters of on average four house blocks comprising 5180 premises. The annual cost of the routine ACP activities was 19.66 US$ per household. RIT applications in rounds at 4-month intervals covering, on average, 97.2% and using 8.5 g of delthametrine annually per household, cost 3.06 US$ per household per year. Delthametrine comprised 66.5% of this cost; the additional cost for deploying RIT comprised 15.6% of the total ACP routine cost and 27% of the cost related to routine adult stage Aedes control. The incremental cost of implementing RIT is high. It should be weighed against the incremental effect on the burden caused by the array of pathogens transmitted by Aedes. The cost could be reduced if the insecticide became cheaper, by limiting the number of yearly applications or by targeting transmission hot spots. © 2016 John Wiley & Sons Ltd.

  1. Effects of fish oil replacement and re-feeding on the bioaccumulation of organochlorine compounds in gilthead sea bream (Sparus aurata L.) of market size.

    Science.gov (United States)

    Nácher-Mestre, Jaime; Serrano, Roque; Benedito-Palos, Laura; Navarro, Juan C; López, Francisco J; Pérez-Sánchez, Jaume

    2009-08-01

    Organochlorine pesticide residues and polychlorinated biphenyls were determined in raw materials, fish feeds and fillets from fish exposed through the productive cycle (14 months) to experimental diets with different percentages of fish oil replacement with vegetable oils. Detectable amounts of organochlorine compounds were found in raw materials derived from fish sources with none being detected in vegetable ingredients. Fish feeds presented trace concentrations of contaminants at the ng/g level, which varied according to the contribution of the different resources used in their manufacture. Contaminants did not accumulate during the first 11 months of exposure, and low concentrations of organochlorine compounds were found both at the start and at the end of this feeding period. Fillets from fish fed the fish oil diet presented the highest concentrations of organochlorine compounds, with these decreasing in proportion to fish oil replacement. Three months of fish oil re-feeding during the finishing phase only produced significant bioaccumulation over the course of the first month. By optimizing fish meal and fish oil replacement with vegetable oils alternative feeds can contribute to significantly reduce the risk of organochlorine uptake by consumers.

  2. Susceptibility of Anopheles gambiae to insecticides used for malaria vector control in Rwanda.

    Science.gov (United States)

    Hakizimana, Emmanuel; Karema, Corine; Munyakanage, Dunia; Iranzi, Gad; Githure, John; Tongren, Jon Eric; Takken, Willem; Binagwaho, Agnes; Koenraadt, Constantianus J M

    2016-12-01

    -cyhalothrin, deltamethrin, permethrin) and organochlorines (DDT) and the large presence of target site insensitivity. The results demonstrate the need for Rwanda to expand monitoring for insecticide resistance including further metabolic resistance testing and implement an insecticide resistance management strategy to sustain the gains made in malaria control.

  3. Organochlorine pesticides and PCBs in air of southern Mexico (2002-2004)

    Science.gov (United States)

    Alegria, Henry A.; Wong, Fiona; Jantunen, Liisa M.; Bidleman, Terry F.; Figueroa, Miguel Salvador; Bouchot, Gerardo Gold; Moreno, Victor Ceja; Waliszewski, Stefan M.; Infanzon, Raul

    Air samples were collected in southern Mexico in 2002-2004 to determine the extent of contamination with organochlorine (OC) pesticides and polychlorinated biphenyls (PCBs). The ΣDDTs ranged from 239 to 2360 pg m -3. Other prominent OC pesticides were endosulfans, toxaphene and lindane. Pesticides detected in lower concentrations include chlordanes, dieldrin, and heptachlor. Proportions of DDT compounds suggested fresh use of DDT in some locations and a mix of fresh and aged residues at others. Ratios of trans-chlordane/ cis-chlordane were consistent with fresh chlordane usage or emission of residues from former termiticide applications. The ΣPCBs was relatively low at all sites. Concentrations of OC pesticides measured with passive samplers agreed well with those measured using high-volume samplers. Air back trajectory analysis suggests a complex pattern of regional atmospheric transport.

  4. Distribution and migration of pesticide residues in mosquito control impoundments St. Lucie County, Florida, USA

    Science.gov (United States)

    Parkinson, R. W.; Wang, T. C.; White, J. R.; David, J. R.; Hoffman, M. E.

    1993-09-01

    This project was designed to: (1) document the distribution and migration of organochlorine pesticide residues within marsh substrates of 18 St. Lucie County mosquito control impoundments located along the Indian River Lagoon estuary, and (2) evaluate the impact of water management techniques on residue mobility. Our results indicate that detectible concentrations of organochlorine compounds, applied between the late 1940s and early 1950s, are present in 16 of the 18 St. Lucie County mosquito control impoundments. These compounds are primarily restricted to the surficial, organic-rich wetland sediment, which, based upon geotechnical analysis, was exposed to the atmosphere at a time when the impoundments were subjected to pesticide treatment. Contaminated sediments are present below the surficial, organic-rich layer, suggesting that some vertical migration of pesticides has occurred. It is unlikely that leaching associated with the downward percolation of impounded water was responsible for this migration as pesticide residues were never detected within the in situ pore waters. An alternative explanation is that biological processes (e.g., rooting, burrowing) facilitated the downward flux of organochlorine compounds into sediment horizons not subjected to direct treatment. Eighty-eight surface water samples obtained from two impoundments subjected to contrasting water management techniques were analyzed for pesticide content. None of the surficial water samples collected in association with these impoundments contained detectible concentrations of organochlorine compounds. These samples were unfiltered and contained as much as 25 mg/1 of particulate organic matter. This suggests that the currently preferred management technique (RIM), which is designed to maintain water quality, limit mosquito production, and provide for ecological continuity, does not hydraulically mobilize pesticide residues into the Indian River Lagoon estuary.

  5. Degradation analysis of some synthetic and bio-insecticides sprayed on okra crop using HPLC

    International Nuclear Information System (INIS)

    Abar, M.F.; Haq, M.A.; Yasmin, N.; Khan, M.F.U.

    2012-01-01

    This study aimed to find out the degradation of three conventional and two bio-insecticides sprayed on okra crop. Imidacloprid, Endosulfan and Profenofos were selected as convectional and biosal and spinosad as bioinsecticide. The insecticides were sprayed at the rates of 49.4, 642.2, 988, 35.5 and 158 g. a. i. ha/sup -1/ respectively. The insecticide residues were analyzed in the leaf and fruit after 0, 1, 3 and 7 days using high performance liquid chromatography. First order degradation kinetics was fitted on this data and degradation rate constants and half life were calculated. Conventional insecticides were found to be more persistent in the crop (Average half life: 1.95, 2.42 and 1.57 days for imidacloprid, endosulfan and profenofos respectively) than bioinsecticides (Average half life 1.25 and 0.27 days for spinosad and biosal respectively). Residues of all tested insecticides were compared with codex and EU MRLs and found both the bio-insecticides treated crops safe for human consumption even after few hours of spray. Endosulfan and profenofos treated crops were not found to be fit for consumption even after 7 days of application. Imidacloprid being biorational (low risk) was also safe for consumption on the next day of application. (author)

  6. Reduced Insecticide Susceptibility in Aedes vexans (Diptera: Culicidae) Where Agricultural Pest Management Overlaps With Mosquito Abatement.

    Science.gov (United States)

    Dunbar, Mike W; Bachmann, Amanda; Varenhorst, Adam J

    2018-05-04

    Mosquito abatement programs in Midwestern communities frequently exist within landscapes dominated by agriculture. Although separately managed, both agricultural pests and mosquitoes are targeted by similar classes of insecticides. As a result, there is the potential for unintended insecticide exposure to mosquito populations from agricultural pest management. To determine the impact that agricultural management practices have on mosquito insecticide susceptibility we compared the mortality of Aedes vexans (Meigen; Diptera: Culicidae) between populations sampled from locations with and without mosquito abatement in South Dakota, a region dominated by agricultural production. Collection locations were either within towns with mosquito abatement programs (n = 2; Brookings and Sioux Falls, SD) or located > 16 km from towns with mosquito abatement programs (n = 2; areas near Harrold and Willow Lake, SD). WHO bioassays were used to test susceptibly of adults to differing insecticide classes relative to their respective controls; 1) an organochlorine (dieldrin 4%), 2) an organophosphate (malathion 5%), and 3) a pyrethroid (lambda-cyhalothrin 0.05%). Corrected mortality did not significantly differ between locations with or without abatement; however, when locations were analized by proportion of developed land within the surrounding landscape pyrethroid mortality was significantly lower where crop production dominated the surrounding landscape and mosquito abatement was present. These data suggest that agricultural pest management may incidentally contribute to reduced mosquito susceptibility where overlap between agricultural pest management and mosquito abatement exists. Decoupling insecticide classes used by both agricultural and public health pest management programs may be necessary to ensure continued efficacy of pest management tools.

  7. Combining the essential oil of Piper aduncum L. with commercial insecticides

    Directory of Open Access Journals (Sweden)

    Murilo Fazolin

    2016-12-01

    Full Text Available The use of synergists is important to minimize the amount of chemical insecticide required for insect control. Their use may contribute to reducing environmental contamination and preserving beneficial insects. The aim of this study was to evaluate the synergy and uniformity of the response of Spodoptera frugiperda (Noctuidae larvae to doses of an essential oil of an Amazon chemotype, Piper aduncum (Piperaceae, when combinationed with the following commercial insecticides: cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate, compared to piperonyl butoxide (PBO. Through the relationship between CL50 and DL50 of insecticides taken separately and their synergistic combinations with the essential oil and PBO, synergism factors (SF were obtained for comparison with each other. With residual contact, there was a significant enhancement of commercial insecticides formulated with cypermethrin (SF = 73.03, zeta-cypermethrin (SF = 16.51 and permethrin (SF = 8.46-17.22, when combined with the P. aduncum essential oil; in turn, with topical application, there was only an observed significant enhancement for zeta-cypermethrin (SF = 0.40-4.26, permethrin (SF = 2.10-4.79 and esfenvarelate (SF = 3.80 insecticides when combined with the essential oil. With the exception of esfenvarelate, the other synergistic combinations showed homogeneous responses for topical application and residual contact for at least one synergistic combination with P. aduncum essential oil. The significance of the SF values from combining P. aduncum essential oil with cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate insecticides may indicate that this essential oil is an alternative option to PBO.

  8. Increased proportions of outdoor feeding among residual malaria vector populations following increased use of insecticide-treated nets in rural Tanzania

    Directory of Open Access Journals (Sweden)

    Azizi Salum

    2011-04-01

    Full Text Available Abstract Background Insecticide-treated nets (ITNs and indoor residual spraying (IRS represent the front-line tools for malaria vector control globally, but are optimally effective where the majority of baseline transmission occurs indoors. In the surveyed area of rural southern Tanzania, bed net use steadily increased over the last decade, reducing malaria transmission intensity by 94%. Methods Starting before bed nets were introduced (1997, and then after two milestones of net use had been reached-75% community-wide use of untreated nets (2004 and then 47% use of ITNs (2009-hourly biting rates of malaria vectors from the Anopheles gambiae complex and Anopheles funestus group were surveyed. Results In 1997, An. gambiae s.l. and An. funestus mosquitoes exhibited a tendency to bite humans inside houses late at night. For An. gambiae s.l., by 2009, nocturnal activity was less (p = 0.0018. At this time, the sibling species composition of the complex had shifted from predominantly An. gambiae s.s. to predominantly An. arabiensis. For An. funestus, by 2009, nocturnal activity was less (p = 0.0054 as well as the proportion biting indoors (p An. funestus s.s. remained the predominant species within this group. As a consequence of these altered feeding patterns, the proportion (mean ± standard error of human contact with mosquitoes (bites per person per night occurring indoors dropped from 0.99 ± 0.002 in 1997 to 0.82 ± 0.008 in 2009 for the An. gambiae complex (p = 0.0143 and from 1.00 ± An. funestus complex (p = 0.0004 over the same time period. Conclusions High usage of ITNs can dramatically alter African vector populations so that intense, predominantly indoor transmission is replaced by greatly lowered residual transmission, a greater proportion of which occurs outdoors. Regardless of the underlying mechanism, the residual, self-sustaining transmission will respond poorly to further insecticidal measures within houses. Additional vector control

  9. Atmospheric Concentrations of Organochlorine Pesticides in the ...

    African Journals Online (AJOL)

    Organochlorine pesticides may still be in use in the Eastern African region for agricultural purposes and for the control of mosquitoes. Atmospheric concentrations of organochlorine pesticides are expected to be higher in the tropics compared to temperate regions due to prevailing high temperatures. However, no study has ...

  10. Sucrose Improves Insecticide Activity Against Drosophila suzukii (Diptera: Drosophilidae).

    Science.gov (United States)

    Cowles, Richard S; Rodriguez-Saona, Cesar; Holdcraft, Robert; Loeb, Gregory M; Elsensohn, Johanna E; Hesler, Steven P

    2015-04-01

    The addition of sucrose to insecticides targeting spotted wing drosophila, Drosophila suzukii (Matsumura), enhanced lethality in laboratory, semifield, and field tests. In the laboratory, 0.1% sucrose added to a spray solution enhanced spotted wing drosophila feeding. Flies died 120 min earlier when exposed to spinosad residues at label rates enhanced with sucrose. Added sucrose reduced the LC50 for dried acetamiprid residues from 82 to 41 ppm in the spray solution. Laboratory bioassays of spotted wing drosophila mortality followed exposure to grape and blueberry foliage and/or fruit sprayed and aged in the field. On grape foliage, the addition of 2.4 g/liter of sugar with insecticide sprays resulted in an 11 and 6% increase of spotted wing drosophila mortality at 1 and 2 d exposures to residues, respectively, averaged over seven insecticides with three concentrations. In a separate experiment, spinetoram and cyantraniliprole reduced by 95-100% the larval infestation of blueberries, relative to the untreated control, 7 d after application at labeled rates when applied with 1.2 g/liter sucrose in a spray mixture, irrespective of rainfall; without sucrose infestation was reduced by 46-91%. Adding sugar to the organically acceptable spinosyn, Entrust, reduced larval infestation of strawberries by >50% relative to without sugar for five of the six sample dates during a season-long field trial. In a small-plot field test with blueberries, weekly applications in alternating sprays of sucrose plus reduced-risk insecticides, spinetoram or acetamiprid, reduced larval infestation relative to the untreated control by 76%; alternating bifenthrin and phosmet (without sucrose) reduced infestation by 65%. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. 40 CFR 180.586 - Clothianidin; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Clothianidin; tolerances for residues... § 180.586 Clothianidin; tolerances for residues. (a) General. Tolerances are established for residues of the insecticide clothianidin, including its metabolites and degradates. Compliance with the tolerance...

  12. Potential use of edible crops in the phytoremediation of endosulfan residues in soil.

    Science.gov (United States)

    Mitton, Francesca M; Gonzalez, Mariana; Monserrat, José M; Miglioranza, Karina S B

    2016-04-01

    Endosulfan is a persistent and toxic organochlorine pesticide of banned or restricted use in several countries. It has been found in soil, water, and air and is bioaccumulated and magnified in ecosystems. Phytoremediation is a technology that promises effective and inexpensive cleanup of contaminated hazardous sites. The potential use of tomato, sunflower, soybean and alfalfa species to remove endosulfan from soil was investigated. All species were seeded and grown in endosulfan-spiked soils (8000 ng g(-1) dry weight) for 15 and 60 days. The phytoremediation potential was evaluated by studying the endosulfan levels and distribution in the soil-plant system, including the evaluation of soil dehydrogenase activity and toxic effects on plants. Plant endosulfan uptake leads to lower insecticide levels in the rhizosphere with regards to bulk soil or near root soil at 15 days of growth. Furthermore, plant growth-induced physical-chemical changes in soil were evidenced by differences in soil dehydrogenase activity and endosulfan metabolism. Sunflower showed differences in the uptake and distribution of endosulfan with regard to the other species, with a distribution pesticide pattern of aerial tissues > roots at 15 days of growth. Moreover, at 60 days, sunflower presented the highest pesticide levels in roots and leaves along with the highest phytoextraction capacity. Lipid peroxidation levels correlated positively with endosulfan accumulation, reflecting the negative effect of this insecticide on plant tissues. Considering biomass production and accumulation potential, in conjunction with the reduction of soil pesticide levels, sunflower plants seem to be the best phytoremediation candidate for endosulfan residues in soils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. Contamination status and accumulation features of persistent organochlorines in pet dogs and cats from Japan

    International Nuclear Information System (INIS)

    Kunisue, Tatsuya; Nakanishi, Shigeyuki; Watanabe, Mafumi; Abe, Takao; Nakatsu, Susumu; Kawauchi, Sakio; Sano, Akihiko; Horii, Akira; Kano, Yasumasa; Tanabe, Shinsuke

    2005-01-01

    Concentrations of persistent organochlorines (OCs) such as polychlorinated dibenzo-p-dioxin (PCDDs), dibenzofurans (PCDFs), biphenyls, dichlorodiphenyltrichloroethane and their metabolites (DDTs), hexachlorocyclohexane isomers, hexachlorobenzene, and chlordane compounds were determined in genital organs of pet dogs and cats and pet foods from Japan. Levels of OCs in dogs were relatively lower than those in cats, while residue levels in their diets were almost similar, implying that accumulation and elimination mechanisms of these contaminants are different between dogs and cats. When bioconcentration factors (BCFs) were estimated from concentrations of OCs in dogs, cats, and their diets, BCFs of all the OCs except PCDD/DFs exceeded 1.0 in cats. On the other hand, in all the dogs, BCFs of DDTs were below 1.0, suggesting that dogs do not bioconcentrate DDTs. Furthermore, BCFs of all the OCs except PCDD/DFs in dogs were notably lower than those in cats, suggesting that dogs have higher metabolic and elimination capacity for these contaminants than cats. When residue levels of OCs in livers, adipose tissue, and genital organs of two pet dogs were examined, hepatic sequestration of PCDD/DFs and oxychlordane was observed. - Pet dogs may have higher metabolic and elimination capacity for organochlorines than pet cats

  14. The Effect of Processing on 14C- Chlofenvinphos Residues in Maize Oil and Bioavailability of its Cake Residues on Rats

    International Nuclear Information System (INIS)

    Mahdy, F.; El-Maghraby, S.

    2008-01-01

    Maize seed obtained from 14 C-chlofenvinphos treated plants contained 0.12 % of the applied dose. The insecticide residues in crude oil, methanol and coke amounted to 10 %, 6 % and 69 %, respectively of original residues inside the seeds.The 14 C activity in the crude oil could be a gradual reduced by the refining processes. The alkali treatment and bleaching steps are more effective steps in the refining processes remove about (63 %). The refined oil contained only about 17 % of the 14 C-residues originally present. The major residues in processed oil contain parent compound, in addition to five metabolites of the insecticide. When rats fed the extracted seeds (cake), the bound residues were found to be considerably bioavailable. After feeding rats for 5 days with the cake, a substantial amount of 14 C-residues was eliminated in the urine (59.5 %), while about 20 % was excreted in the feces. About 15 % of the radioactivity was distribution among various organs

  15. Synergistic potential of dillapiole-rich essential oil with synthetic pyrethroid insecticides against fall armyworm

    Directory of Open Access Journals (Sweden)

    Murilo Fazolin

    2016-03-01

    Full Text Available ABSTRACT: The objective of this study was to evaluate the synergy and response homogeneity of the Spodoptera frugiperda larvae population to the Piper aduncum essential oil in combination with pyrethroid insecticides (alpha-cypermethrin, beta-cypermethrin, fenpropathrin, and gamma-cyhalothrin compared to piperonylbutoxide (PBO as positive control. Synergism (SF comparisons were obtained using lethal concentration (LC50 and lethal dose (LD50 ratios of insecticides individually and in their respective synergistic combinations with essential oil and PBO. Dose/concentration-mortality slope curves were used to establish relative toxicity increase promoted by synergism. They also determined homogeneity response. Residual contact revealed significant potentiation for commercial insecticides formulated with beta-cypermethrin (SF=9.05-0.5 and fenpropathrin (SF=34.05-49.77 when combined with the P. aduncum essential oil. For topical contact, significant potentiation occurred only for alpha-cypermethrin (SF=7.55-3.68, fenpropathrin (SF=3.37-1.21, and gamma-cyhalothrin (SF=5.79-10.48 insecticides when combined with essential oil. With the exception of fenpropathrin and gamma-cyhalothrin, insecticides synergistic combinations presented homogeneous response by topical as well as residual contact at least with essential oil. The SF significance values ​​of the P. aduncum essential oil combined with alpha-cypermethrin, beta-cypermethrin, fenpropathrin, and gamma-cyhalothrin insecticides indicated potential for this oil to be used as an alternative to PBO.

  16. MARKET BASKET SURVEY FOR SOME PESTICIDES RESIDUES IN FRUITS AND VEGETABLES FROM GHANA

    Directory of Open Access Journals (Sweden)

    Crentsil Kofi Bempah

    2012-12-01

    Full Text Available A study was conducted to investigate the organochlorine, organophosphorus and synthetic pyrethroid pesticide residues in fruits and vegetables from markets in Ghana. For this purpose, a total of 309 fruits and vegetable samples, were collected and analyzed by gas chromatography with electron capture detector. The obtained results showed that the predominance of organochlorine followed by organophosphorus and synthetic pyrethroid pesticides in most of the analyzed samples. The detected concentrations of them were most significant in vegetable samples. The results obtained showed that 39.2 % of the fruits and vegetable samples analyzed contained no detectable level of the monitored pesticides, 51.0 % of the samples gave results with trace levels of pesticide residues below the maximum residue limit (MRL, while 9.8 % of the samples were above the MRL. The findings point to the urgent need to establish reliable monitoring programs for pesticides, so that any exceedance in concentration over environmental quality standards can be detected and appropriate actions taken.

  17. Does Bt Corn Really Produce Tougher Residues

    Science.gov (United States)

    Bt corn hybrids produce insecticidal proteins that are derived from a bacterium, Bacillus thuringiensis. There have been concerns that Bt corn hybrids produce residues that are relatively resistant to decomposition. We conducted four experiments that examined the decomposition of corn residues und...

  18. Evaluation of Patterns and Spatial Trends of Pesticide Residues ...

    African Journals Online (AJOL)

    This paper reports on the analysis of organochlorine pesticides pollution data obtained from samples collected from Vikuge farm, Coast Region, Tanzania between 2000 and 2003 by principal component analysis (PCA). PCA of the data sets for pesticide residues in water, soil and sediments samples from Vikuge has shown ...

  19. Monitoring of organochlorine and organophosphorus pesticide residues in water during different seasons of Tighra reservoir Gwalior, Madhya Pradesh, India.

    Science.gov (United States)

    Mamta; Rao, R J; Wani, Khursheed Ahmad

    2015-11-01

    Analysis of pesticides during different seasons for pesticidal contamination in water samples of Tighra reservoir was carried out on gas chromatograph-electron capture detector with capillary columns following multiresidual analytical technique. Organochlorine pesticides, viz., hexachlorobenzene (HCB), alpha-benzene hexachloride (BHC), beta-BHC, γ-BHC, heptachlor, aldrin, alpha-endosulfan, beta-endosulfan, p,p-DDE, dieldrin, o,p-dichlorodiphenyldichloroethane (DDD), p,p-DDD, p,p-dichlorodiphenyltrichloroethane (DDT), and endrin, and organophosphorus pesticides, viz., choloropyrifos, methyl parathion, diazion, dicholorovos, ethion, malathion, and parathion, were detected in water samples during different seasons. However, the pesticide concentration varied during different seasons at different sites. The prominent reason of contamination is the use of pesticides (both organochlorine and organophosphorus) in the agricultural fields near Tighra reservoir. On the basis of our observations, more extensive monitoring studies need to be carried out, covering all wetlands of Madhya Pradesh to enforce the policies for the restricted application of pesticides in agricultural fields adjacent to wetlands.

  20. Determination of levels of organochlorine pesticides in plastic resin pellets on selected beaches in the Greater Accra region of Ghana

    International Nuclear Information System (INIS)

    Amoatey, A. E.

    2012-07-01

    that a major portion of the EOCI measured in plastic resin pellets remained uncharacterized. The accumulation of organochlorine pesticide residue on the plastic resin pellets suggests that it can be used as a monitoring tool for marine pollution. (au)

  1. Leaf-air transfer of organochlorine pesticides from three selected vegetables

    Energy Technology Data Exchange (ETDEWEB)

    Yang Xinglun [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Jiang Xin [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China)]. E-mail: jiangxin@issas.ac.cn; Yu Guifen [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Yao Fenxia [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Bian Yongrong [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China); Wang Fang [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, 71 East Beijing Road, Nanjing 210008 (China)

    2007-07-15

    The leaf-air transfer of organochlorine pesticides (OCPs) in three kinds of vegetables, namely lettuce, romaine and garlic leaves was investigated. It was found that although the uptake of OCPs by the three selected vegetables was similar under controlled conditions, the depuration varied significantly among chemicals and plant species in terms of elimination rate, final residue of each OCPs, as well as the effect of temperature on the residue of OCPs in the vegetables. The results indicated that neither QCB nor HCB could be trapped tightly by any of the three selected vegetables, in contrast, p,p'-DDT could be retained effectively by all of them; the retainment of {alpha}-HCH, {gamma}-HCH, p,p'-DDE, was dependent on the vegetable species, of which the garlic leaf had the biggest ability to trap them. Our work provided insight into the behavior of OCPs in the agroecosystem. - The leaf-air transfer of OCPs varied significantly among chemicals and the three selected vegetables.

  2. Leaf-air transfer of organochlorine pesticides from three selected vegetables

    International Nuclear Information System (INIS)

    Yang Xinglun; Jiang Xin; Yu Guifen; Yao Fenxia; Bian Yongrong; Wang Fang

    2007-01-01

    The leaf-air transfer of organochlorine pesticides (OCPs) in three kinds of vegetables, namely lettuce, romaine and garlic leaves was investigated. It was found that although the uptake of OCPs by the three selected vegetables was similar under controlled conditions, the depuration varied significantly among chemicals and plant species in terms of elimination rate, final residue of each OCPs, as well as the effect of temperature on the residue of OCPs in the vegetables. The results indicated that neither QCB nor HCB could be trapped tightly by any of the three selected vegetables, in contrast, p,p'-DDT could be retained effectively by all of them; the retainment of α-HCH, γ-HCH, p,p'-DDE, was dependent on the vegetable species, of which the garlic leaf had the biggest ability to trap them. Our work provided insight into the behavior of OCPs in the agroecosystem. - The leaf-air transfer of OCPs varied significantly among chemicals and the three selected vegetables

  3. Residual toxicity of insecticides used in Tunisian citrus orchards on the imported parasitoid Diachasmimorpha longicaudata (Hymenoptera: Braconidae: Implications for IPM program of Ceratitis capitata (Diptera: Tephritidae

    Directory of Open Access Journals (Sweden)

    Ahlem Harbi

    2017-12-01

    Full Text Available Citrus agro-industry is globally harshened mainly by Ceratitis capitata (Wiedemann, the most worldwide destructive tephritid fruit fly species. Citrus agro-industry is one of the pillars of Tunisia economy, and by hence, harshened by this species. Tunisia has established an Integrated Pest Management (IPM programme against citrus pests, including C. capitata, that rely on the structured use of pesticides, on the application several trapping protocols, along with pilot-scale sterile insect technique program and, since 2013, with pilot-scale releases of the braconid parasitoid Diachasmimorpha longicaudata Ashmed (Hymenoptera: Braconidae. Insecticide side-effects on parasitoids and other natural enemies are being requested for a successful implementation of biological control within any IPM programme. However, these data are almost scarce for the braconid species D. longicaudata. To this end, we have determined the side-effects of malathion, methidathion, acetamiprid, azadiractin, abamectin, deltametrin+thiacloprid and spinosad, as the most popular insecticides used in Tunisia either as fresh residues or at several aged time points, on the parasitoid D. longicaudata according the IOBC pesticide harm-classification. IOBC classification evolution of residues over time had allowed determining the best combination of pesticide applications in a structured fashion with the viable releases of D. longicaudata for the control of C. capitata in Tunisian citrus agro-ecosystems.

  4. Residual toxicity of insecticides used in Tunisian citrus orchards on the imported parasitoid Diachasmimorpha longicaudata (Hymenoptera: Braconidae): Implications for IPM program of Ceratitis capitata (Diptera: Tephritidae)

    Energy Technology Data Exchange (ETDEWEB)

    Harbi, A.; Abbes, K.; Sabater-Muñoz, B.; Beitia, F.; Chermiti, B.

    2017-07-01

    Citrus agro-industry is globally harshened mainly by Ceratitis capitata (Wiedemann), the most worldwide destructive tephritid fruit fly species. Citrus agro-industry is one of the pillars of Tunisia economy, and by hence, harshened by this species. Tunisia has established an Integrated Pest Management (IPM) programme against citrus pests, including C. capitata, that rely on the structured use of pesticides, on the application several trapping protocols, along with pilot-scale sterile insect technique program and, since 2013, with pilot-scale releases of the braconid parasitoid Diachasmimorpha longicaudata Ashmed (Hymenoptera: Braconidae). Insecticide side-effects on parasitoids and other natural enemies are being requested for a successful implementation of biological control within any IPM programme. However, these data are almost scarce for the braconid species D. longicaudata. To this end, we have determined the side-effects of malathion, methidathion, acetamiprid, azadiractin, abamectin, deltametrin+thiacloprid and spinosad, as the most popular insecticides used in Tunisia either as fresh residues or at several aged time points, on the parasitoid D. longicaudata according the IOBC pesticide harm-classification. IOBC classification evolution of residues over time had allowed determining the best combination of pesticide applications in a structured fashion with the viable releases of D. longicaudata for the control of C. capitata in Tunisian citrus agro-ecosystems.

  5. Contamination of persistent organochlorines in sediments from Mekong River Delta, South Vietnam

    Energy Technology Data Exchange (ETDEWEB)

    Hung, Minh Nguyen; Kajiwara, Natsuko; Kunisue, Tatsuya; Subramanian, A.; Iwata, Hisato; Tanabe, Shinsuke [Ehime Univ., Matsuyama (Japan). Center for Marine Environmental Studies; Hung, Viet Pham [Hanoi National Univ., Hanoi (Viet Nam); Cach, Tuyen Bui [Univ. for Agriculture and Forestry, Hochiminh (Viet Nam)

    2004-09-15

    Mekong River is the longest river in southeastern Asia, which flows a distance of almost 4800 km from China through Myanmar, Thailand, Laos, Cambodia and Vietnam. The Mekong River basin with an area of nearly 800 thousand square kilometers is an important habitat for approximately 60 million people. Mekong River delta in South Vietnam, which is inhabited by about 20 million people, is one of the most highly productive agriculture lands in the world. Rice production is major economical sector in Mekong delta contributing half of the rice production in Vietnam - approximately 35 million tons annually. On the other hand, development of agriculture in Mekong delta raised some concern on environmental quality and disturbance on ecosystem. For example, intensive use of organochlorine (OC) insecticides such as DDTs, chlordanes, HCHs may lead to considerable residues in the agriculture land. Moreover, relative persistence of such chemicals together with natural processes like evaporation and run-off, might enhance their ubiquitous distribution in environment, food chains and eventually bio-accumulate in humans. In Vietnam, despite official ban on the usage of OCs on 1995, there have been evidences of recent uses of such chemicals, particularly DDT, throughout the country. It can be anticipated that similar situation may occur in Mekong River delta due to high population density and intensive agriculture activities in this region. Despite this fact, no comprehensive study, to evaluate the status of contamination by persistent OCs in this region, has been made in recent years. In this study, we collected sediments from different locations along Mekong River and determined the concentrations of persistent OCs such as DDTs, HCHs, CHLs, HCB and PCBs in order to elucidate the recent contamination status, their usage pattern as well as to evaluate potential pollution sources of these chemicals to the river.

  6. Levels of Organochlorine Pesticides in Blood Plasma from Residents of Malaria-Endemic Communities in Chiapas, Mexico

    OpenAIRE

    Ruiz-Suárez, Luz E.; Castro-Chan, Ricardo A.; Rivero-Pérez, Norma E.; Trejo-Acevedo, Antonio; Guillén-Navarro, Griselda K.; Geissen, Violette; Bello-Mendoza, Ricardo

    2014-01-01

    Organochlorine (OC) pesticides have been extensively used for pest control in agriculture and against malaria vectors in the region of Soconusco, Chiapas, in southern Mexico. Our study aimed to identify whether the inhabitants of four Soconusco communities at different locations (i.e., altitudes) and with different history of use of OC pesticides, have been similarly exposed to residues of these pesticides. In particular, we analyzed the potential relationship between levels of OC pesticides ...

  7. Measuring exposure to organochlorinated pesticides

    Directory of Open Access Journals (Sweden)

    Gulnar Azevedo e Silva Mendonça

    1998-01-01

    Full Text Available Environmental epidemiological investigations in cancer remain, with rare exceptions, inconclusive. The difficulties of establishing patterns of measurements of exposure in the human body is one of the limitations of these studies. The findings of six recent epidemiological studies that analyzed the association between organochlorinated compounds and breast cancer are reviewed in considering the problems of measuring environmental exposure through biological markers. The epidemiological evidence based on these studies do not indicate a risk of breast cancer related to organochlorines. Some aspects that may partially explain this absence of risk are discussed regarding the investigation of environmental carcinogenic agents in populations with low but homogeneously sprayed levels of exposure.

  8. Residuos de insecticidas organoclorados presentes en leche cruda comercializada en el departamento de Córdoba, Colombia Organochlorine insecticide residues present in raw milk sold in the Department Córdoba, Colombia

    Directory of Open Access Journals (Sweden)

    2012-01-01

    Full Text Available En el estudio se determinaron residuos de plaguicidas organoclorados en leche cruda proveniente de hatos lecheros del departamento de Córdoba, Colombia. Durante el procedimiento de extracción se utilizó una columna de tierra de diatomeas y como sistema eluyente una mezcla de n-hexano-acetonaacetato de etilo (4:2:1, seguida de metanol al 5% en hexano. Para la determinación se usó un cromatógrafo de gases Perkin Elmer, Autosystem XL con detector captura de electrones, en modo de inyección ‘splitless', una columna capilar Rtx-5 30 m, 0.25 mm di y 0.25 µm de espesor de película. El porcentaje de recuperación para los plaguicidas determinados se encontró entre 88.5 y 96%, los límites de detección se definieron entre 0.01 y 0.04 ng/g con desviaciones estándar In this investigation organochlorine pesticide residues in raw milk from Dairy herds in the Cordoba department were determined. During the extraction procedure using a column of diatomaceous earth as eluting system a mixture of n-hexane-acetone-ethyl acetate (4:2:1, followed by 5% methanol in hexane. For the determination we used a gas Chromatograph Perkin Elmer, Autosystem XL with electron capture detector, split less injection mode, a capillary column Rtx-5 30m, 0.25 mm id and 0.25 um film thickness. The recovery rate for certain pesticides were between 88.5 and 96%, the detection limits were defined between 0.01 and 0.04 ng/g, relative standard deviations less than 6%. In the 63 samples tested p, p'-DDT, a-HCH, d-HCH, aldrin, dieldrin, endrin, heptachlor, heptachlor epoxide and g-chlordane were determined, establishing concentrations between 27.1 and 469.6 ng/g. The frequencies of occurrence ranged between 1.6 and 65.1% for heptachlor and p, p'-DDT, respectively. The older population that lives in the sub-regions: Middle Sinú, San Jorge and Savannas were exposed to high health risk associated with the concentration a-HCH, aldrin and dieldrin in raw milk.

  9. Pesticide residues in birds and mammals

    Science.gov (United States)

    Stickel, L.F.; Edwards, C.A.

    1973-01-01

    SUMMARY: Residues of organochlorine pesticides and their breakdown products are present in the tissues of essentially all wild birds throughout the world. These chemicals accumulate in fat from a relatively small environmental exposure. DDE and dieldrin are most prevalent. Others, such as heptachlor epoxide, chlordane, endrin, and benzene hexachloride also occur, the quantities and kinds generally reflecting local or regional use. Accumulation may be sufficient to kill animals following applications for pest control. This has occurred in several large-scale programmes in the United States. Mortality has also resulted from unintentional leakage of chemical from commercial establishments. Residues may persist in the environment for many years, exposing successive generations of animals. In general, birds that eat other birds, or fish, have higher residues than those that eat seeds and vegetation. The kinetic processes of absorption, metabolism, storage, and output differ according to both kind of chemical and species of animal. When exposure is low and continuous, a balance between intake and excretion may be achieved. Residues reach a balance at an approximate animal body equilibrium or plateau; the storage is generally proportional to dose. Experiments with chickens show that dieldrin and heptachlor epoxide have the greatest propensity for storage, endrin next, then DDT, then lindane. The storage of DDT was complicated by its metabolism to DDE and DDD, but other studies show that DDE has a much greater propensity for storage than either DDD or DDT. Methoxychlor has little cumulative capacity in birds. Residues in eggs reflect and parallel those in the parent bird during accumulation, equilibrium, and decline when dosage is discontinued. Residues with the greatest propensity for storage are also lost most slowly. Rate of loss of residues can be modified by dietary components and is speeded by weight loss of the animal. Under sublethal conditions of continuous

  10. Pesticide residues and bees--a risk assessment.

    Directory of Open Access Journals (Sweden)

    Francisco Sanchez-Bayo

    Full Text Available Bees are essential pollinators of many plants in natural ecosystems and agricultural crops alike. In recent years the decline and disappearance of bee species in the wild and the collapse of honey bee colonies have concerned ecologists and apiculturalists, who search for causes and solutions to this problem. Whilst biological factors such as viral diseases, mite and parasite infections are undoubtedly involved, it is also evident that pesticides applied to agricultural crops have a negative impact on bees. Most risk assessments have focused on direct acute exposure of bees to agrochemicals from spray drift. However, the large number of pesticide residues found in pollen and honey demand a thorough evaluation of all residual compounds so as to identify those of highest risk to bees. Using data from recent residue surveys and toxicity of pesticides to honey and bumble bees, a comprehensive evaluation of risks under current exposure conditions is presented here. Standard risk assessments are complemented with new approaches that take into account time-cumulative effects over time, especially with dietary exposures. Whilst overall risks appear to be low, our analysis indicates that residues of pyrethroid and neonicotinoid insecticides pose the highest risk by contact exposure of bees with contaminated pollen. However, the synergism of ergosterol inhibiting fungicides with those two classes of insecticides results in much higher risks in spite of the low prevalence of their combined residues. Risks by ingestion of contaminated pollen and honey are of some concern for systemic insecticides, particularly imidacloprid and thiamethoxam, chlorpyrifos and the mixtures of cyhalothrin and ergosterol inhibiting fungicides. More attention should be paid to specific residue mixtures that may result in synergistic toxicity to bees.

  11. BEES AS BIOINDICATORS TO GUARANTEE HEALTHY PRODUCTS FOR THE CONSUMER

    Directory of Open Access Journals (Sweden)

    B. Brusa

    2011-04-01

    Full Text Available Many investigators have employed honeybees or honeybee products as tools for assessing environmental pollution in industrial areas. The pollution in northwest Italy by insecticides used in crop protection, heavy metals and radioactivity has been investigated utilizing, as a bioindicator: honeybees, bee honey, wax, pollen produced in this area. Honeybees and honeybee products samples collected from 6 apiaries located in this area were analyzed for neonicotinoids residues with LC/MS method, pesticides organochlorines and organophosphates by GCECD and GC-NPD methods, PCB using GC-MS, radioactivity on 137Cs by g spectrometer and heavy metals with atomic spectroscopy. The results show: 19 honeybee samples were positive on neonicotinoids (clothianidin residues (total of 78 samples, no one sample was positive on pesticides organochlorines and organophosphates residues (total of 32 honeybee samples, the radioactivity levels were always below the instrumental limit determination, at last the heavy metal content (Pb, Cd, Cr on 21 honey samples was favorable. This study indicates that in agricultural areas with developed apiculture, useful information about the occurrence and the distribution of pesticide residues due to crop protection treatments can be derived from the analysis of randomly collected honeybee products samples, used as bioindicators.

  12. Residues of Organochlorinated Pesticides in Soil from Tomato ...

    African Journals Online (AJOL)

    This work presents the concentrations of five pesticide residues, lindane, chlorpyrifos, endosulfan, p, p'-DDE and p, p'-DDD in soil samples collected from tomato fields in Ngarenanyuki, Tanzania. Endosulfan sulphate was detected in 100 % of the sample analysed with mean concentration of 0.2407 mg/kg dw. Chlorpyrifos ...

  13. The effect of insecticide applications to melon crop on melon aphid and its natural enemies

    International Nuclear Information System (INIS)

    Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.

    1999-01-01

    Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less

  14. Chlorfenapyr, a Potent Alternative Insecticide of Phoxim To Control Bradysia odoriphaga (Diptera: Sciaridae).

    Science.gov (United States)

    Zhao, Yunhe; Wang, Qiuhong; Wang, Yao; Zhang, Zhengqun; Wei, Yan; Liu, Feng; Zhou, Chenggang; Mu, Wei

    2017-07-26

    Bradysia odoriphaga is the major pest affecting Chinese chive production, and in China, it has developed widespread resistance to organophosphorus insecticides. Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action that does not confer cross-resistance to neurotoxic insecticides. However, the effect of chlorfenapyr on organophosphate-resistant B. odoriphaga is not well understood. The present study evaluated the potential of chlorfenapyr for the control of phoxim-resistant B. odoriphaga. The results showed that chlorfenapyr had significant insecticidal activity to B. odoriphaga in multiple developmental stages, and there were no significant differences in susceptibility between the field (phoxim-resistant) and laboratory (phoxim-susceptible) populations. The pot experiment and field trials confirmed the results of our laboratory bioassays. In the field trial, chlorfenapyr applied at 3.0, 6.0, or 12.0 kg of active ingredient (a.i.)/ha significantly decreased the number of B. odoriphaga and improved the yield compared to phoxim at 6.0 kg of a.i./ha and the control conditions. Moreover, the final residues of chlorfenapyr on plants were below the maximum residue limits (MRLs) as a result of its non-systemic activity. These results demonstrate that chlorfenapyr has potential as a potent alternative to phoxim for controlling B. odoriphaga.

  15. Assessment of imidacloprid and acetamiprid residues in okra and eggplant grown in peri-urban areas and their dietary intake in humans

    International Nuclear Information System (INIS)

    Amjad, A.; Akhtar, S.; Randhawa, M.; Binyameen, M.

    2018-01-01

    This research work was designed to estimate the gradually increasing use of insecticides on vegetables to create awareness among the consumers regarding their insecticide residues. The main aim of this study is to highlight the harmful effects of insecticides in comparison with dietary intake assessment of vegetables. In this regard, total 180 (n = 60×3) samples of okra (Abelmoschus esculentus) and eggplant (Solanum melongena) comprising of 30 samples vegetable were collected from the peri-urban farming system of Multan, Faisalabad and Gujranwala to assess insecticide residues along with their dietary intake assessment. The selected samples were quantified for the insecticide residues by using High Performance Liquid Chromatography (HPLC) technique equipped with UV/Visible detector. Results revealed that imidacloprid residues found in eggplant (0.226 mg Kg-1) and okra (0.176 mg Kg-1) from Multan region were greater than the residues reported from Gujranwala and Faisalabad. Out of all analyzed samples for imidacloprid and acetamaprid residues, 58% and 65% samples contained detectable residues respectively. Whereas 10% and 15% samples exceeded their maximum residue limits (MRLs) established by European Commission. Dietary intake assessment for imidacloprid and acetamiprid was calculated as per their maximum permissible intake (MPI) values i.e. 3.84 and 4.48 mg person-1day-1, respectively, which revealed that although a reasonable proportion of samples exceeded MRLs but their consumption was found within safe limit. (author)

  16. Determinação de resíduos de organoclorados em águas fluviais do município de Viçosa - MG Determination of organochlorinated present in river from the region of Viçosa, MG

    Directory of Open Access Journals (Sweden)

    Cíntia Maria Chagas

    1999-07-01

    Full Text Available In this work the contamination, by organochlorinated, of a drinking water source located in the region of Viçosa, MG, was evaluated. The identification and quantification of the analytes was carried out using a gas-chromatograph equipped with an electron capture detector after liquid-liquid extraction and concentration. Four insecticides, Aldrin, Epoxy heptachloride, Endrin and op'- DDT were detected in concentrations that are higher than the safety limits established in the Brazilian legislation.

  17. Acute toxicity of organochlorine insecticide endosulfan to the giant freshwater prawn Macrobrochium rosenbergii

    Science.gov (United States)

    Dai, Xilin; Xiong, Zhaodi; Xie, Jian; Ding, Fujiang

    2014-01-01

    Endosulfan, an organochlorine pesticide, is highly toxic and effective at controlling pests in agriculture, horticulture, and public health programs. In this study, static bioassays were used to evaluate the toxicity of endosulfan to freshwater prawns ( Macrobrachium rosenbergii) of various lengths (1.5±0.03, 4±0.08, and 7±0.06 cm). Additionally, the activities of peroxidase (POD), acid phosphatase (ACP), alkaline phosphatase, acetylcholinesterase (AChE), and Na+/K+-ATPase were analyzed to reflect the effects of endosulfan exposure. The 96 h LC50 of endosulfan for prawns 1.5, 4, and 7 cm long were 1.86, 4.53, and 6.09 μg/L, respectively, improved tolerance to endosulfan with growth. The POD activities of test organisms exposed to low concentrations of endosulfan were inhibited, indicating the presence of oxygen damaged tissue. Moreover, a notable decrease in AChE activity was observed due to overstimulation of neurotransmission, which might result in abnormal behavior. The effect caused by endosulfan on phosphatase production in the hepatopancreas of prawns 1.5, 4, and 7 cm long was different because the ability of nonspecific immune regulation increased with growth. The 96 h LC50 values obtained in this study could be used in the formulation of water-quality criteria in China. Moreover, the changes in enzymes activities of M. rosenbergii under stress of endosulfan could be applied in the establishment of early warning indicators for bio-safety.

  18. Effects of Sublethal Concentrations of Insecticides on the Functional Response of Two Mirid Generalist Predators.

    Directory of Open Access Journals (Sweden)

    Angeliki F Martinou

    Full Text Available The use of agrochemicals particularly pesticides, can hamper the effectiveness of natural enemies, causing disruption in the ecosystem service of biological control. In the current study, the effects of the insecticides thiacloprid and chlorantraniliprole on the functional response curves were assessed for two mirid predator nymphs, Macrolophus pygmaeus Rambur and Nesidiocoris tenuis Reuter. In the absence of insecticides, both predators exhibited a type II functional response when feeding on eggs of the moth Ephestia kuehniella. N. tenuis seems to be a more efficient predator than M. pygmaeus, as model estimated handling time was significantly lower for the former than for the latter. Residual exposure of M. pygmaeus to sublethal concentrations of either insecticide was associated with a change in the asymptote but not the type of the functional response curve. Thiacloprid seems to be the least compatible with M. pygmaeus, as it led to both a significant reduction of the attack rate and an increase in handling time. In contrast, chlorantraniliprole exposure significantly increased the handling time, but not the attack rate of the predator. Residual exposure of N. tenuis to sublethal concentrations of either insecticide did not have a significant effect on the type nor the parameters of the functional response model. The results show that pesticide residues that do not have lethal effects on beneficial arthropods can reduce prey consumption depending on predator species and on likely risks associated with toxicity.

  19. Effects of Sublethal Concentrations of Insecticides on the Functional Response of Two Mirid Generalist Predators.

    Science.gov (United States)

    Martinou, Angeliki F; Stavrinides, Menelaos C

    2015-01-01

    The use of agrochemicals particularly pesticides, can hamper the effectiveness of natural enemies, causing disruption in the ecosystem service of biological control. In the current study, the effects of the insecticides thiacloprid and chlorantraniliprole on the functional response curves were assessed for two mirid predator nymphs, Macrolophus pygmaeus Rambur and Nesidiocoris tenuis Reuter. In the absence of insecticides, both predators exhibited a type II functional response when feeding on eggs of the moth Ephestia kuehniella. N. tenuis seems to be a more efficient predator than M. pygmaeus, as model estimated handling time was significantly lower for the former than for the latter. Residual exposure of M. pygmaeus to sublethal concentrations of either insecticide was associated with a change in the asymptote but not the type of the functional response curve. Thiacloprid seems to be the least compatible with M. pygmaeus, as it led to both a significant reduction of the attack rate and an increase in handling time. In contrast, chlorantraniliprole exposure significantly increased the handling time, but not the attack rate of the predator. Residual exposure of N. tenuis to sublethal concentrations of either insecticide did not have a significant effect on the type nor the parameters of the functional response model. The results show that pesticide residues that do not have lethal effects on beneficial arthropods can reduce prey consumption depending on predator species and on likely risks associated with toxicity.

  20. Neonicotinoid insecticide residues in surface water and soil associated with commercial maize (corn fields in southwestern Ontario.

    Directory of Open Access Journals (Sweden)

    Arthur Schaafsma

    Full Text Available Neonicotinoid insecticides have come under scrutiny for their potential unintended effects on non-target organisms, particularly pollinators in agro-ecosystems. As part of a larger study of neonicotinoid residues associated with maize (corn production, 76 water samples within or around the perimeter of 18 commercial maize fields and neighbouring apiaries were collected in 5 maize-producing counties of southwestern Ontario. Residues of clothianidin (mean = 2.28, max. = 43.60 ng/mL and thiamethoxam (mean = 1.12, max. = 16.50 ng/mL were detected in 100 and 98.7% of the water samples tested, respectively. The concentration of total neonicotinoid residues in water within maize fields increased six-fold during the first five weeks after planting, and returned to pre-plant levels seven weeks after planting. However, concentrations in water sampled from outside the fields were similar throughout the sampling period. Soil samples from the top 5 cm of the soil profile were also collected in these fields before and immediately following planting. The mean total neonicotinoid residue was 4.02 (range 0.07 to 20.30 ng/g, for samples taken before planting, and 9.94 (range 0.53 to 38.98 ng/g, for those taken immediately after planting. Two soil samples collected from within an conservation area contained detectable (0.03 and 0.11 ng/g concentrations of clothianidin. Of three drifted snow samples taken, the drift stratum containing the most wind-scoured soil had 0.16 and 0.20 ng/mL mainly clothianidin in the melted snow. The concentration was at the limit of detection (0.02 ng/mL taken across the entire vertical profile. With the exception of one sample, water samples tested had concentrations below those reported to have acute, chronic or sublethal effects to honey bees. Our results suggest that neonicotinoids may move off-target by wind erosion of contaminated soil. These results are informative to risk assessment models for other non-target species in maize

  1. Neonicotinoid Insecticide Residues in Surface Water and Soil Associated with Commercial Maize (Corn) Fields in Southwestern Ontario

    Science.gov (United States)

    Schaafsma, Arthur; Limay-Rios, Victor; Baute, Tracey; Smith, Jocelyn; Xue, Yingen

    2015-01-01

    Neonicotinoid insecticides have come under scrutiny for their potential unintended effects on non-target organisms, particularly pollinators in agro-ecosystems. As part of a larger study of neonicotinoid residues associated with maize (corn) production, 76 water samples within or around the perimeter of 18 commercial maize fields and neighbouring apiaries were collected in 5 maize-producing counties of southwestern Ontario. Residues of clothianidin (mean = 2.28, max. = 43.60 ng/mL) and thiamethoxam (mean = 1.12, max. = 16.50 ng/mL) were detected in 100 and 98.7% of the water samples tested, respectively. The concentration of total neonicotinoid residues in water within maize fields increased six-fold during the first five weeks after planting, and returned to pre-plant levels seven weeks after planting. However, concentrations in water sampled from outside the fields were similar throughout the sampling period. Soil samples from the top 5 cm of the soil profile were also collected in these fields before and immediately following planting. The mean total neonicotinoid residue was 4.02 (range 0.07 to 20.30) ng/g, for samples taken before planting, and 9.94 (range 0.53 to 38.98) ng/g, for those taken immediately after planting. Two soil samples collected from within an conservation area contained detectable (0.03 and 0.11 ng/g) concentrations of clothianidin. Of three drifted snow samples taken, the drift stratum containing the most wind-scoured soil had 0.16 and 0.20 ng/mL mainly clothianidin in the melted snow. The concentration was at the limit of detection (0.02 ng/mL) taken across the entire vertical profile. With the exception of one sample, water samples tested had concentrations below those reported to have acute, chronic or sublethal effects to honey bees. Our results suggest that neonicotinoids may move off-target by wind erosion of contaminated soil. These results are informative to risk assessment models for other non-target species in maize agro

  2. Organochlorine contaminants in complete clutches of Morelet's crocodile (Crocodylus moreletii) eggs from Belize

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Ted H. [Department of Chemistry and Biochemistry, University of Alaska Fairbanks, Fairbanks, AK 99775-6160 (United States); Canas, Jaclyn E. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States); Rainwater, Thomas R. [Institute of Environmental and Human Health, PO Box 764, Jefferson, TX 75657 (United States); Platt, Steven G. [Department of Math and Science, Oglala Lakota College, 490 Piya Wiconi Road, Kyle, SD, 57752 (United States); McMurry, Scott T. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States); Anderson, Todd A. [Institute of Environmental and Human Health, Texas Tech University, Box 41163, Lubbock, TX 79409 (United States)]. E-mail: todd.anderson@ttu.edu

    2006-11-15

    Seven complete clutches of Morelet's crocodile (Crocodylus moreletii) eggs were collected in northern Belize and examined for organochlorine (OC) pesticide residues. The primary OC detected, p,p-DDE, was found in every egg analyzed (n = 175). Other OCs detected included p,p-DDT, p,p-DDD, methoxychlor, aldrin, and endosulfan I. Concentrations of individual OCs ranged from 4 ppb (ng chemical/g egg wet weight) to greater than 500 ppb. A statistical evaluation of p,p-DDE levels in three complete clutches was used to derive the minimum number of eggs needed from a clutch to precisely determine the mean p,p-DDE concentration representative of that clutch. Sample sizes of 8 (80% confidence level) and 11 (90% confidence level) were determined to yield an accurate estimate of contaminant levels in a full clutch of eggs. The statistically recommended sample size of 11 eggs (at 90% confidence level) was successfully tested on the four additional clutches. -- Sampling the non-viable eggs of a clutch can provide a statistically reasonable estimation of both the organochlorine contaminant distribution and concentrations in that clutch.

  3. Pesticide Residues and Bees – A Risk Assessment

    Science.gov (United States)

    Sanchez-Bayo, Francisco; Goka, Koichi

    2014-01-01

    Bees are essential pollinators of many plants in natural ecosystems and agricultural crops alike. In recent years the decline and disappearance of bee species in the wild and the collapse of honey bee colonies have concerned ecologists and apiculturalists, who search for causes and solutions to this problem. Whilst biological factors such as viral diseases, mite and parasite infections are undoubtedly involved, it is also evident that pesticides applied to agricultural crops have a negative impact on bees. Most risk assessments have focused on direct acute exposure of bees to agrochemicals from spray drift. However, the large number of pesticide residues found in pollen and honey demand a thorough evaluation of all residual compounds so as to identify those of highest risk to bees. Using data from recent residue surveys and toxicity of pesticides to honey and bumble bees, a comprehensive evaluation of risks under current exposure conditions is presented here. Standard risk assessments are complemented with new approaches that take into account time-cumulative effects over time, especially with dietary exposures. Whilst overall risks appear to be low, our analysis indicates that residues of pyrethroid and neonicotinoid insecticides pose the highest risk by contact exposure of bees with contaminated pollen. However, the synergism of ergosterol inhibiting fungicides with those two classes of insecticides results in much higher risks in spite of the low prevalence of their combined residues. Risks by ingestion of contaminated pollen and honey are of some concern for systemic insecticides, particularly imidacloprid and thiamethoxam, chlorpyrifos and the mixtures of cyhalothrin and ergosterol inhibiting fungicides. More attention should be paid to specific residue mixtures that may result in synergistic toxicity to bees. PMID:24718419

  4. Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.

    Science.gov (United States)

    Thompson, Charles M; Prins, John M; George, Kathleen M

    2010-01-01

    Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.

  5. Lethal and Sublethal Effects of Insecticides Used on Citrus, on the Ectoparasitoid Tamarixia radiata.

    Science.gov (United States)

    Beloti, Vitor Hugo; Alves, Gustavo Rodrigues; Araújo, Diogo Feliciano Dias; Picoli, Mateus Manara; Moral, Rafael de Andrade; Demétrio, Clarice Garcia Borges; Yamamoto, Pedro Takao

    2015-01-01

    Huanglongbing (HLB) is a disease associated with the bacteria "Candidatus Liberibacter spp." and has been devastating citrus orchards around the world. Its management involves control of the insect vector, the Asian citrus psyllid Diaphorina citri Kuwayama. However, the indiscriminate use of chemicals has caused pest outbreaks and eliminated the natural enemies of the vector, such as the parasitoid Tamarixia radiata (Waterston), the main agent for biological control of D. citri. This study assessed the lethal and sublethal effects of insecticides recommended for integrated production of citrus on the parasitoid T. radiata. When adult parasitoids were exposed to residues of 25 insecticides, 20% of them, i.e., gamma-cyhalothrin, etofenprox, azadirachtin, tebufenozide and pyriproxyfen, were considered as harmless (Class 1), 12% as slightly harmful (Class 2), 12% as moderately harmful (Class 3) and 56% as harmful (Class 4), according to the classification proposed by the IOBC/WPRS. Afterward, 14 insecticides (5 harmless and 9 harmful) were sprayed on the parasitoid pupae. Of the 14 insecticides tested, only the organophosphates dimethoate and chlorpyrifos affected the parasitoid emergence. The effects of insecticides on the parasitism capacity of adults exposed to residues of azadirachtin, etofenprox, gamma-cyhalothrin, pyriproxyfen and tebufenozide (harmless) were also evaluated. Tebufenozide and gamma-cyhalothrin affected the parasitism of the F0 generation, but did not affect the emergence of the F1 and F2 generations. Therefore, for an effective IPM program, selective insecticides or harmful pesticides to adult parasitoids could be used in the field, provided that the adults do not occur naturally and the chemical applications do not coincide with parasitoid releases.

  6. Lethal and Sublethal Effects of Insecticides Used on Citrus, on the Ectoparasitoid Tamarixia radiata.

    Directory of Open Access Journals (Sweden)

    Vitor Hugo Beloti

    Full Text Available Huanglongbing (HLB is a disease associated with the bacteria "Candidatus Liberibacter spp." and has been devastating citrus orchards around the world. Its management involves control of the insect vector, the Asian citrus psyllid Diaphorina citri Kuwayama. However, the indiscriminate use of chemicals has caused pest outbreaks and eliminated the natural enemies of the vector, such as the parasitoid Tamarixia radiata (Waterston, the main agent for biological control of D. citri. This study assessed the lethal and sublethal effects of insecticides recommended for integrated production of citrus on the parasitoid T. radiata. When adult parasitoids were exposed to residues of 25 insecticides, 20% of them, i.e., gamma-cyhalothrin, etofenprox, azadirachtin, tebufenozide and pyriproxyfen, were considered as harmless (Class 1, 12% as slightly harmful (Class 2, 12% as moderately harmful (Class 3 and 56% as harmful (Class 4, according to the classification proposed by the IOBC/WPRS. Afterward, 14 insecticides (5 harmless and 9 harmful were sprayed on the parasitoid pupae. Of the 14 insecticides tested, only the organophosphates dimethoate and chlorpyrifos affected the parasitoid emergence. The effects of insecticides on the parasitism capacity of adults exposed to residues of azadirachtin, etofenprox, gamma-cyhalothrin, pyriproxyfen and tebufenozide (harmless were also evaluated. Tebufenozide and gamma-cyhalothrin affected the parasitism of the F0 generation, but did not affect the emergence of the F1 and F2 generations. Therefore, for an effective IPM program, selective insecticides or harmful pesticides to adult parasitoids could be used in the field, provided that the adults do not occur naturally and the chemical applications do not coincide with parasitoid releases.

  7. Organochlorine insecticides in African agroecosystems. Report of a final research co-ordination meeting

    International Nuclear Information System (INIS)

    1997-03-01

    Adverse effects also appear within the agroecosystem itself. Intensive use of broad spectrum insecticides can reduce populations of insect parasites and predators; as a result, pest populations may be inadequately controlled. This, in turn, can lead to the need of more frequent use of pesticides and to the appearance of secondary pests. We are slowly beginning to understand how natural enemies and the other non-target fauna are affected by pesticide use in a few agroecosystems in the developed countries. The knowledge about these matters in developing countries is very rudimentary. The objectives of this programme were to increase the knowledge of how pesticides affect the agroecosystem especially pest-natural enemy interactions and the non-target fauna within and outside African agroecosystem. Chlorinated hydrocarbon pesticides were used as representing the compounds most likely to produce undesirable consequences. This TECDOC reports the accomplishments of the programme which was financed by the Swedish International Development Authority (SIDA). Refs, figs, tabs

  8. Variations of insecticide residual bio-efficacy on different types of walls: results from a community-based trial in south Cameroon

    Directory of Open Access Journals (Sweden)

    Etang Josiane

    2011-11-01

    Full Text Available Abstract Background Determination of residual activity of insecticides is essential information for the selection of appropriate indoor spraying operation. The present study was undertaken to evaluate the residual effect of three candidate insecticide formulations on different indoor surfaces in order to guide future interventions, in the context of Cameroon and other African countries. Methods The study was conducted in the Ntougou neighbourhood in Yaoundé (capital city of Cameroon. Bendiocarb WP, lambda-cyhalothrin CS and deltamethrin WG were sprayed on the indoor wall surfaces of local cement, wood and mud houses. Their effects on the knockdown and mortality of the Kisumu susceptible strain of Anopheles gambiae s.s were assessed each month from March to September 2009, using the WHO plastic cones test. Knockdown and mortality rates were compared between different surfaces using Chi-square test. A Kaplan-Meir model was used to estimate the time of treatment failure. Results With bendiocarb WP, the knockdown rates were frequently above 98% during 13 weeks after spraying, except on mud walls where it significantly decreased at the 13th week (P th (83% and the 20th (88% weeks respectively (P 98%; while it varied between 60 and 100% on wood or mud surfaces. The survival estimates of bendiocarb WP treatments remaining effective in killing An. gambiae s.s. (mortality rate ≥ 80% was > 13 weeks on cement and wood surfaces and 13 weeks on mud surfaces. Those of lambda-cyhalothrin CS were > 26 weeks on wood surfaces, and 20 weeks on concrete and mud surfaces. By contrast, those of deltamethrin WG were 26 weeks on concrete, 20 weeks on mud surfaces and 15 weeks on wood surfaces. Conclusion Current data suggest variable durations of spray cycles for each product, according to the type of wall surfaces, highlighting the importance of testing candidate products in local context before using them in large scale.

  9. Overall and class-specific scores of pesticide residues from fruits and vegetables as a tool to rank intake of pesticide residues in United States: A validation study.

    Science.gov (United States)

    Hu, Yang; Chiu, Yu-Han; Hauser, Russ; Chavarro, Jorge; Sun, Qi

    2016-01-01

    Pesticide residues in fruits and vegetables are among the primary sources of pesticide exposure through diet, but the lack of adequate measurements hinder the research on health effects of pesticide residues. Pesticide Residue Burden Score (PRBS) for estimating overall dietary pesticide intake, organochlorine pesticide score (OC-PRBS) and organophosphate pesticide score (OP-PRBS) for estimating organochlorine and organophosphate pesticides-specific intake, respectively, were derived using U.S. Department of Agriculture Pesticide Data Program data and National Health and Nutrition Examination Survey (NHANES) food frequency questionnaire data. We evaluated the performance of these scores by validating the scores against pesticide metabolites measured in urine or serum among 3,679 participants in NHANES using generalized linear regression. The PRBS was positively associated with a score summarizing the ranks of all pesticide metabolites in a linear fashion (p for linear trend trend trend 0.07) for the OC-PRBS. The PRBS and OP-PRBS had similar performance when they were derived from fruits and vegetables with high vs. low pesticide residues, respectively (p for trend trend 0.07) than from less contaminated Fruits and vegetables (p for trend 0.63), although neither of the associations achieved statistical significance. The PRBS and the class-specific scores for two major types of pesticides were significantly associated with pesticide biomarkers. These scores can reasonably rank study participants by their pesticide residue exposures from fruits and vegetables in large-scale environmental epidemiological studies. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  11. Unit costs for house spraying and bednet impregnation with residual insecticides in Colombia: a management tool for the control of vector-borne disease.

    Science.gov (United States)

    Kroeger, A; Ayala, C; Medina Lara, A

    2002-06-01

    A study of unit costs and cost components of two malaria-control strategies (house spraying and bednet impregnation with residual insecticides) was undertaken in 11 malaria-endemic states (departamentos) of Colombia, using data provided by control staff on self-administered questionnaires. The accuracy of the data was verified by personal visits, telephone conversations and complementary information from 10 other states. Allthe financial-cost components of the malaria-control operations carried out in the previous 6 months and the results of the control operations themselves (including the numbers of houses sprayed and numbers of bednets impregnated/day) were recorded. The information was stratified according to whether the target communities were 'near' or 'far away' from an operational base, the far-away communities being those that needed overnight stays by the control staff. The main variables analysed were unit costs/house treated, and annual cost/person protected. The results show that house spraying was generally more expensive for the health services than bednet impregnation. This is particularly the case in 'nearby' communities, where most of those at-risk live. In such communities, spraying one house was 7.2 times more expensive than impregnating one bednet. Even if only those sleeping under an impregnated net were assumed to be protected, the unit costs/person protected in a 'nearby' community were twice as high for house spraying than for bednet impregnation. In 'nearby' communities, where technicians could return to the operational base each evening, insecticides made up 80% of the total spraying costs and 42% of the costs of bednet impregnation. In 'far-away' communities, however, salaries and 'per diems' were the most important cost components, representing, respectively, 23% and 22% of the costs of spraying, and 34% plus 27% of the costs of impregnation. Insecticide wastage and non-use of discounts on insecticide prices (available through the

  12. Natural Organochlorines as Precursors of 3-Monochloropropanediol Esters in Vegetable Oils.

    Science.gov (United States)

    Tiong, Soon Huat; Saparin, Norliza; Teh, Huey Fang; Ng, Theresa Lee Mei; Md Zain, Mohd Zairey Bin; Neoh, Bee Keat; Md Noor, Ahmadilfitri; Tan, Chin Ping; Lai, Oi Ming; Appleton, David Ross

    2018-01-31

    During high-temperature refining of vegetable oils, 3-monochloropropanediol (3-MCPD) esters, possible carcinogens, are formed from acylglycerol in the presence of a chlorine source. To investigate organochlorine compounds in vegetable oils as possible precursors for 3-MCPD esters, we tested crude palm, soybean, rapeseed, sunflower, corn, coconut, and olive oils for the presence of organochlorine compounds. Having found them in all vegetable oils tested, we focused subsequent study on oil palm products. Analysis of the chlorine isotope mass pattern exhibited in high-resolution mass spectrometry enabled organochlorine compound identification in crude palm oils as constituents of wax esters, fatty acid, diacylglycerols, and sphingolipids, which are produced endogenously in oil palm mesocarp throughout ripening. Analysis of thermal decomposition and changes during refining suggested that these naturally present organochlorine compounds in palm oils and perhaps in other vegetable oils are precursors of 3-MCPD esters. Enrichment and dose-response showed a linear relationship to 3-MCPD ester formation and indicated that the sphingolipid-based organochlorine compounds are the most active precursors of 3-MCPD esters.

  13. Dissipation of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb-insecticides used to control codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae) in apples for production of baby food.

    Science.gov (United States)

    Szpyrka, Ewa; Matyaszek, Aneta; Słowik-Borowiec, Magdalena

    2017-05-01

    Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and nitrogen-phosphorus detection (GC-ECD/NPD) was used for the residue analysis. The analytical performance of the method was satisfactory, with expanded uncertainties ≤36% (a coverage factor, k = 2, and a confidence level of 95%). The dissipations of insecticides were studied in pseudo-first-order kinetic models (for which the coefficient of determination, R 2 , ranged between 0.9188 and 0.9897). Residues of studied insecticides were below their maximum residue limits of 0.5 mg/kg at an early stage of growth of the fruit. The half-lives of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb were 16-17, 4-6 and 20-24 days, respectively. The initial residue levels declined gradually and reached the level of 0.01 mg/kg in 1 month for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb. To obtain the insecticide residue levels below 0.01 mg/kg, which is the default MRL for food intended for infants and young children, the application of the studied insecticides should be carried out at recommended doses not later then: 1 month before harvest for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb.

  14. 40 CFR 180.151 - Ethylene oxide; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Ethylene oxide; tolerances for... § 180.151 Ethylene oxide; tolerances for residues. (a) General. (1) Tolerances are established for residues of the antimicrobial agent and insecticide ethylene oxide, when used as a postharvest fumigant in...

  15. 40 CFR 180.539 - d-Limonene; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false d-Limonene; tolerances for residues. 180.539 Section 180.539 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 180.539 d-Limonene; tolerances for residues. (a) General. (1) The insecticide d-limonene may be safely...

  16. 40 CFR 180.130 - Hydrogen Cyanide; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Hydrogen Cyanide; tolerances for... § 180.130 Hydrogen Cyanide; tolerances for residues. (a) General. A tolerance for residues of the insecticide hydrogen cyanide from postharvest fumigation as a result of application of sodium cyanide is...

  17. The status of pesticide pollution in surface waters (rivers and lakes) of Greece. Part I. Review on occurrence and levels

    International Nuclear Information System (INIS)

    Konstantinou, Ioannis K.; Hela, Dimitra G.; Albanis, Triantafyllos A.

    2006-01-01

    This review evaluates and summarizes the results of long-term research projects, monitoring programs and published papers concerning the pollution of surface waters (rivers and lakes) of Greece by pesticides. Pesticide classes mostly detected involve herbicides used extensively in corn, cotton and rice production, organophosphorus insecticides as well as the banned organochlorines insecticides due to their persistence in the aquatic environment. The compounds most frequently detected were atrazine, simazine, alachlor, metolachlor and trifluralin of the herbicides, diazinon, parathion methyl of the insecticides and lindane, endosulfan and aldrin of the organochlorine pesticides. Rivers were found to be more polluted than lakes. The detected concentrations of most pesticides follow a seasonal variation, with maximum values occurring during the late spring and summer period followed by a decrease during winter. Nationwide, in many cases the reported concentrations ranged in low ppb levels. However, elevated concentrations were recorded in areas of high pesticide use and intense agricultural practices. Generally, similar trends and levels of pesticides were found in Greek rivers compared to pesticide contamination in other European rivers. Monitoring of the Greek water resources for pesticide residues must continue, especially in agricultural regions, because the nationwide patterns of pesticide use are constantly changing. Moreover, emphasis should be placed on degradation products not sufficiently studied so far. - Information on pesticide pollution of surface waters in Greece is reviewed

  18. Compatibility of the entomopathogenic fungus Lecanicillium muscarium and insecticides for eradication of sweetpotato whitefly, Bemisia tabaci.

    Science.gov (United States)

    Cuthbertson, Andrew G S; Walters, Keith F A; Deppe, Carola

    2005-08-01

    The compatibility of the entomopathogenic fungus Lecanicillium muscarium and chemical insecticides used to control the second instar stages of the sweetpotato whitefly, Bemisia tabaci, was investigated. The effect on spore germination of direct exposure for 24 h to the insecticides imidacloprid, buprofezin, teflubenzuron and nicotine was determined. Only exposure to buprofezin was followed by acceptable spore germination. However, all chemicals significantly reduced spore germination when compared to a water control. Infectivity of L. muscarium in the presence of dry residues of buprofezin, teflubenzuron and nicotine (imidacloprid is a systemic pesticide) on foliage were also investigated. No significant detrimental effects on the level of control of B. tabaci was recorded when compared with fungi applied to residue free foliage on either tomato or verbena plants. Fungi in combination with imidacloprid gave higher B. tabaci mortality on verbena foliage compared to either teflubenzuron or nicotine and fungi combinations. Use of these chemical insecticides with L. muscarium in integrated control programmes for B. tabaci is discussed.

  19. Biochemical activity of the insecticide (diflubenzuron) residues on male albino rats

    International Nuclear Information System (INIS)

    Abdel- Naser, H.F.O.

    1997-01-01

    The toxicological studies of the insecticide. Diflubenzuron were investigated in experimental animals during 45th days feeding study. The studies carried out included treatment of wheat grains with 100 and 300 ppm DFB, this was accomplished by feeding male rats for 45 days (sub chronic toxicity study) on DFB incorporated in grains to monitor any possible change that might have been altered in the animal during that period. 6 tabs., 17 figs., 109 refs

  20. Residue analysis of four diacylhydrazine insecticides in fruits and vegetables by Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) method using ultra-performance liquid chromatography coupled to tandem mass spectrometry.

    Science.gov (United States)

    Liu, Xingang; Xu, Jun; Dong, Fengshou; Li, Yuanbo; Song, Wenchen; Zheng, Yongquan

    2011-08-01

    The new analytical method using Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) procedure for simultaneous determination of diacylhydrazine insecticide residues in fruits and vegetables was developed using ultra-performance liquid chromatography coupled with tandem mass spectrometry (UPLC-MS/MS). The four insecticides (tebufenozide, methoxfenozide, chromafenozide, and halofenozide) were extracted from six fruit and vegetable matrices using acetonitrile and subsequently cleaned up using primary secondary amine (PSA) or octadecylsilane (C18) as sorbent prior to UPLC-MS/MS analysis. The determination of the target compounds was achieved in less than 3.0 min using an electrospray ionization source in positive mode (ESI+) for tebufenozide, methoxfenozide, and halofenozide and in negative mode (ESI-) for chromafenozide. The limits of detection were below 0.6 μg kg(-1), while the limit of quantification did not exceed 2 μg kg(-1) in different matrices. The QuEChERS procedure by using two sorbents (PSA and C18) and the matrix-matched standards gave satisfactory recoveries and relative standard deviation (RSD) values in different matrices at four spiked levels (0.01, 0.05, 0.1, and 1 mg kg(-1)). The overall average recoveries for this method in apple, grape, cucumber, tomato, cabbage, and spinach at four levels ranged from 74.2% to 112.5% with RSDs in the range of 1.4-13.8% (n = 5) for all analytes. This study provides a theoretical basis for China to draw up maximum residue limits and analytical method for diacylhydrazine insecticide in vegetables and fruits.

  1. Residues of legacy organochlorine contaminants in the milk of Alpine and Saanen goats from the central region of Mexico.

    Science.gov (United States)

    Schettino, Beatriz; Gutiérrez, Rey; Ortiz, Rutilio; Vega, Salvador; Urban, Georgina; Ramírez, Acacia

    2013-08-01

    This study investigated a suite of legacy organochlorine contaminants in the milk of two breeds of goats raised in the central region of Mexico, where this agricultural production is of national (Mexican) economic importance. Forty milk samples from Alpine and Saanen goats were assessed. It was found that the concentrations of the majority of organochlorine pesticides in milk samples were lower than those stipulated in Mexican and international regulation. The values in both breeds of goat exceeded the upper permissible limits of Codex Alimentarius for delta hexachloro cyclohexane (HCH) (17.3 of samples of Saanen) and heptachlor plus heptachlor epoxide (50 % and 13 % of samples). It may be concluded that milk from these goat breeds from central Mexico showed some risks of contamination in certain times of the year (dry season). However, under further assessment and use of pesticides the goat's milk will likely be safe for human consumption and for use in products such as cheeses, regional candies and desserts (cajeta). In recent years, goat milk production has increased in the central regions and it is an economic alternative to milk from livestock. It is necessary to continue the monitoring of goat's milk to assess the presence and control of HCHs through best management practices.

  2. Country-level operational implementation of the Global Plan for Insecticide Resistance Management.

    Science.gov (United States)

    Hemingway, Janet; Vontas, John; Poupardin, Rodolphe; Raman, Jaishree; Lines, Jo; Schwabe, Chris; Matias, Abrahan; Kleinschmidt, Immo

    2013-06-04

    Malaria control is reliant on the use of long-lasting pyrethroid-impregnated nets and/or indoor residual spraying (IRS) of insecticide. The rapid selection and spread of operationally significant pyrethroid resistance in African malaria vectors threatens our ability to sustain malaria control. Establishing whether resistance is operationally significant is technically challenging. Routine monitoring by bioassay is inadequate, and there are limited data linking resistance selection with changes in disease transmission. The default is to switch insecticides when resistance is detected, but limited insecticide options and resistance to multiple insecticides in numerous locations make this approach unsustainable. Detailed analysis of the resistance situation in Anopheles gambiae on Bioko Island after pyrethroid resistance was detected in this species in 2004, and the IRS program switched to carbamate bendiocarb, has now been undertaken. The pyrethroid resistance selected is a target-site knock-down resistance kdr-form, on a background of generally elevated metabolic activity, compared with insecticide-susceptible A. gambiae, but the major cytochrome P450-based metabolic pyrethroid resistance mechanisms are not present. The available evidence from bioassays and infection data suggests that the pyrethroid resistance mechanisms in Bioko malaria vectors are not operationally significant, and on this basis, a different, long-lasting pyrethroid formulation is now being reintroduced for IRS in a rotational insecticide resistance management program. This will allow control efforts to be sustained in a cost-effective manner while reducing the selection pressure for resistance to nonpyrethroid insecticides. The methods used provide a template for evidence-based insecticide resistance management by malaria control programs.

  3. Determination of pesticide residues in fruits of Nawabshah district, Sindh, Pakistan

    International Nuclear Information System (INIS)

    Anwar, T.; Ahmad, I.; Tahir, S.

    2011-01-01

    Eight fruit samples of apple, guava, orange, grapes, pear, persimmon, banana and pear purchased from the local markets of Nawabshah district, Sindh and residues of pesticide of organophosphate (OP), pyrethroid and organochlorine (OC) (i.e., dichlorvos, fenvalerate, dimethoate, methyl parathion, fenitrothion, cypermethrin, endosulfan, deltamethrin, mevinphos, chlorpyriphos, profenofos and dicofol) were monitored in fruit samples by Gas Chromatography (GC). All the fruit samples were found contaminated except banana and among these only apple samples were found exceeding the maximum residue limits (MRL) of Codex Alimentarius Commission. (author)

  4. Reduced risk insecticides to control scale insects and protect natural enemies in the production and maintenance of urban landscape plants.

    Science.gov (United States)

    Frank, Steven D

    2012-04-01

    Armored scale insects are among the most difficult to manage and economically important arthropod pests in the production and maintenance of urban landscape plants. This is because of morphological traits that protect them from contact insecticides. I compared initial and season-long control of euonymus scale, Unaspis euonymi Comstock (Hemiptera: Diaspidae), by reduced-risk insecticides (insect growth regulators [IGRs], neonicotinoids, spirotetramat) to determine if they controlled scale as well as more toxic insecticides such as the organophosphate, acephate, and pyrethroid, bifenthrin. I also evaluated how these insecticides affected natural enemy abundance on experimental plants and survival when exposed to insecticide residue. All insecticides tested reduced first generation euonymus scale abundance. In 2009, reinfestation by second generation euonymus scale was highest on plants treated with acetamiprid and granular dinotefuran. In 2010, systemic neonicotinoids and spirotetramat prevented cottony cushion scale infestation 133 d after treatment whereas scale readily infested plants treated with bifenthrin and horticultural oil. Encarsia spp. and Cybocephalus spp. abundance was related to scale abundance. These natural enemies were generally less abundant than predicted by scale abundance on granular dinotefuran treated plants and more abundant on granular thiamethoxam treated plants. Bifenthrin residue killed 90-100% of O. insidiosus and E. citrina within 24 h. My results indicate that reduced risk insecticides can provide season-long scale control with less impact on natural enemies than conventional insecticides. This could have economic and environmental benefits by reducing the number of applications necessary to protect nursery and landscape plants from scale.

  5. Chemical characterization and insecticidal activity of Calotropis gigantea L. flower extract against Tribolium castaneum (Herbst

    Directory of Open Access Journals (Sweden)

    Muhammad Rowshanul Habib

    2016-12-01

    Full Text Available Objective: To test the insecticidal activity of ethyl acetate extract of Calotropis gigantea L. flower (designated as EECF against stored grain pest Tribolium castaneum (Herbst of different larval and adult stages. Methods: Residual film method was used here to study the toxicity of EECF against Tribolium castaneum and gas chromatography-mass spectrometer analysis was also performed to characterize the chemicals of EECF. Results: In residual film bioassay, EECF showed lowest LD50 (0.134 mg/cm2 against 1st instar larvae of Tribolium castaneum and this finding ultimately revealed that the insect of initial stage was more susceptible than other stages. From the results of this study, it was found that with the increasing of age, Tribolium castaneum showed some extent of resistance against the toxicity of EECF. Moreover, chemical profiles of EECF identified by gas chromatography-mass spectrometer analysis were also found to consistent with its insecticidal activity. Conclusions: So, the overall results suggested that extracts of Calotropis gigantea L. flower have potential insecticidal effect which might be used in pest control.

  6. Estimation of insecticide persistence, biological activity and mosquito resistance to PermaNet® 2 long-lasting insecticidal nets over three to 32 months of use in Ethiopia.

    Science.gov (United States)

    Anshebo, Gedeon Yohannes; Graves, Patricia M; Smith, Stephen C; Wills, Aprielle B; Damte, Mesele; Endeshaw, Tekola; Shargie, Estifanos Biru; Gebre, Teshome; Mosher, Aryc W; Patterson, Amy E; Emerson, Paul M

    2014-03-06

    Information is needed on the expected durability of insecticidal nets under operational conditions. The persistence of insecticidal efficacy is important to estimate the median serviceable life of nets under field conditions and to plan for net replacement. Deltamethrin residue levels were evaluated by the proxy method of X-ray fluorescence spectrometry on 189 nets used for three to six months from nine sites, 220 nets used for 14-20 months from 11 sites, and 200 nets used for 26-32 months from ten sites in Ethiopia. A random sample of 16.5-20% of nets from each time period (total 112 of 609 nets) were tested by bioassay with susceptible mosquitoes, and nets used for 14-20 months and 26-32 months were also tested with wild caught mosquitoes. Mean insecticide levels estimated by X-ray fluorescence declined by 25.9% from baseline of 66.2 (SD 14.6) mg/m2 at three to six months to 44.1 (SD 21.2) mg/m2 at 14-20 months and by 30.8% to 41.1 (SD 18.9) mg/m2 at 26-32 months. More than 95% of nets retained greater than 10 mg/m2 of deltamethrin and over 79% had at least 25 mg/m2 at all time periods. By bioassay with susceptible Anopheles, mortality averaged 89.0% on 28 nets tested at three to six months, 93.3% on 44 nets at 14-20 months and 94.1% on 40 nets at 26-32 months. With wild caught mosquitoes, mortality averaged 85.4% (range 79.1 to 91.7%) at 14-20 months but had dropped significantly to 47.2% (39.8 to 54.7%) at 26-32 months. Insecticide residue level, as estimated by X-ray fluorescence, declined by about one third between three and six months and 14-20 months, but remained relatively stable and above minimum requirements thereafter up to 26-32 months. The insecticidal activity of PermaNet® 2.0 long-lasting insecticidal nets in the specified study area may be considered effective to susceptible mosquitoes at least for the duration indicated in this study (32 months). However, results indicated that resistance in the wild population is already rendering nets with

  7. Residues of 14C-cyolane in cottonseed products

    International Nuclear Information System (INIS)

    Zayed, S.M.A.D.; Osman, A.Z.; Fakhr, I.M.I.; Bahig, M.E.

    1981-01-01

    The systemic insecticide cyolane [2-(0,0-diethylphosphoryl)-imino-1,3-dithiolane] was prepared from 14 C-ethanol, phosphorus oxychloride and 2-amino-1,3-dithiolane. Cotton plants were treated with two applications of the insecticide under conditions of local agricultural practice. 14 C-residues in the crude oil and cake of the harvested cotton seeds amounted to 1.63 and 0.014 mg/kg respectively. About 50% of the 14 C-activity present in the crude oil was found to be eliminated by simulated commercial processes used for refining of the oil. Alkali treatment and bleaching removed 16% and 25% of the radioactive residues respectively. Winterization of the bleached oil at 5-7 0 C for 3 days effected a further elimination of 13%. 14 C-residues in the cotton seed products and in the samples of the refined oil were characterized and the main constituents identified using chromatographic techniques. (author)

  8. Evaluation of systemic neonicotinoid insecticides for the management of the Asian citrus psyllid Diaphorina citri on containerized citrus.

    Science.gov (United States)

    Byrne, Frank J; Daugherty, Matthew P; Grafton-Cardwell, Elizabeth E; Bethke, James A; Morse, Joseph G

    2017-03-01

    Studies were conducted to evaluate uptake and retention of three systemic neonicotinoid insecticides, dinotefuran, imidacloprid and thiamethoxam, in potted citrus nursery plants treated at standard label rates. Infestation of these plants placed at a field site with moderate levels of Asian citrus psyllid (ACP) was monitored for 14 weeks following treatments, and insecticide residues in leaf tissue were quantified using enzyme-linked immunosorbent assay (ELISA). Bioassays were conducted using leaves harvested on various dates post-treatment to compare the efficacies of residues against adult ACP. Residues of the three neonicotinoids were detected in leaf tissues within 1 week after treatment. Peak concentrations established at 1 week for imidacloprid and dinotefuran and at 2 weeks for thiamethoxam. Imidacloprid and thiamethoxam outperformed the control and dinotefuran treatments at protecting trees from infestations by ACP eggs and nymphs. For a given insecticide concentration in leaf tissue, thiamethoxam induced the highest mortality of the three insecticides, and dinotefuran was the least toxic. If the time needed to achieve effective thresholds of a systemic neonicotinoid is known, treatments at production facilities could be scheduled that would minimize unnecessary post-treatment holding periods and ensure maximum retention of effective concentrations after the plants have shipped to retail outlets. The rapid uptake of the insecticides and retention at effective concentrations in containerized citrus suggest that the current 30 day post-treatment shipping restriction from production facilities to retail outlets outside of quarantine could be shortened to 14 days. Thiamethoxam should be added to the list of approved nursery treatments. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  9. Assessment of pesticide residues in vegetables from the Western Usambara and Uruguru Mountains in Tanzania.

    Science.gov (United States)

    Mtashobya, Lewis A

    2017-09-25

    Assessment of levels of pesticide residues in vegetables was carried out in some villages in the Western Usambara and Uluguru Mountains of Tanzania where varieties of vegetables are grown. Tomatoes and cabbages were the most popular enterprise grown all year round and therefore were selected as the model crops for this study. Analysis of the cleaned sample extracts on a gas chromatography with electron capture detector (GC-ECD) and confirmation on the Gas chromatography-mass spectrometry (GC-MS) revealed dominance of organochlorine pesticides. Organophosphorous pesticides (parathion and marathion) were only detected in some samples, however, in most cases with higher concentrations compared to organochlorine pesticides. Levels of pesticide residues detected in vegetables were up to: parathion 5.07 μg/Kg, marathion 3.73 μg/Kg, α-endosulfan 0.32 μg/Kg, β-endosulfan 0.53 μg/Kg, dieldrin 1.36 μg/Kg, γ-HCH 0.25 μg/Kg, α-HCH 0.09 μg/Kg, and p, p'-DDT 0.64 μg/Kg. These results clearly show that vegetables are contaminated with different pesticide residues. However, the total levels of pesticide residues in both tomatoes and cabbages are lower than their respective codex alimentarius maximum residue levels (MRLs). This means that the vegetables produced in the area are suitable for human consumption.

  10. Sources and characteristics of organochlorine pesticides in the soil and sediment along the Kaidu-Peacock River, Northwest of China

    Science.gov (United States)

    Chen, Wei; Qi, Shihua; Peng, Fei; Qu, Chengkai; Zhang, Yuan; Xing, Xinli; Zhang, Jiaquan

    2016-04-01

    Organochlorine pesticides (OCPs) are a sub-group of persistent organic pollutants (POPs), which have raised the concerns from researchers all around the world for several decades. But very little research has been conducted on POPs in the arid zone of Northwest China. More than 100 soil and sediment samples were collected from Kaidu-Peacock River of Xinjiang, Northwest of China, to investigate the organochlorine pesticides (OCPs) in this region analysed by the gas chromatograph equipped with a mass selective detector (GC-MSD). Our pre-study in 2006 (Chen et al. 2011) in the same region, showed that OCPs except o,p'-DDT were detected in sediments from the Peacock River. Similar results were found in the whole river catchment in this investigation. DDTs, HCHs, chlordanes and endosulfans were the dominant OCPs residual in the soil and sediments. This study confirmed that POPs, such as OCPs in this region were contributed to by both local emissions and long-term atmospheric transport and may pose risks to human health and the ecosystem. Chen, W., Jing, M., Bu, J., Ellis Burnet, J., Qi, S., Song, Q., Ke, Y., Miao, J., Liu, M. & Yang, C. (2011) Organochlorine pesticides in the surface water and sediments from the Peacock River Drainage Basin in Xinjiang, China: a study of an arid zone in Central Asia. Environmental Monitoring and Assessment, 177, 1-21.

  11. MONITOREO DE RESIDUOS DE PESTICIDAS ORGANOCLORADOS EN CAMARÓN (Penaeus vannamei DEL ÁREA COSTERA DE LA BAHÍA CARTAGENA (COLOMBIA MONITORAMENTO RESÍDUOS DE PESTICIDAS ORGANOCLORADOS EM CAMARÃO (Penaeus vannamei A ÁREA DA BAÍA COSTEIRA DE CARTAGENA (COLÔMBIA MONITORING OF ORGANOCHLORINE PESTICIDES RESIDUES IN SHRIMP (Penaeus vannamei FROM THE COASTAL AREA OF CARTAGENA BAY COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEATRIZ E JARAMILLO

    2010-12-01

    limite de detecção de todos os pesticidas organoclorados estão dentro da faixa de 0,1 a 13 ng g-1. A concentração de resíduos de pesticidas organoclorados em camarão foi inferior ao limite máximo permitido para os animais aquáticos, recomendado pela FAO.The utilization of organochlorine pesticides for pest control chemical has been of great interest on residue contamination from biológical organisms in the environment. Shrimp (Penaeus vannamei samples were monitored as bioindicators for assessment of the water quality in coastal waters along the Cartagena Bay. Twenty-seven samples were collected from 3 sample stations during january, june and november of 2008. The retention times of the extracts of Shrimp were compared with standard mix of 20 organochlorine pesticides. Gas chromatography equipped with an microelectron capture detector was used as instrumental technique. The aim of this paper was determinate the residual contamination for organochlorine pesticides in shrimp muscle obtained in Cartagena's Beaches. The limit of detection of all organochlorine pesticides compounds was at the range of O.1-13 ngg-1. The concentration of organochlorine pesticides residues in shrimp was lower than the maximum residue limit for aquatic animals as recommended by the FAO.

  12. Pollutants in harp seals (Phoca groenlandica). I. Organochlorines

    Energy Technology Data Exchange (ETDEWEB)

    Ronald, K; Frank, R J; Dougan, J L; Frank, R; Braun, H E

    1984-09-01

    Between 1976 and 1978, 248 harp seals were sampled from 5 locations in the Northwest Atlantic and Arctic for organochlorine (OC) residue analysis in tissue. Blood, kidney, brain, muscle and blubber samples were analysed for PCB, DDT, dieldrin, hexachlorobenzene (HCB), and heptachlor epoxide. Levels were generally greatest in blubber tissue. Overall, mean levels of DDT and PCB were greater than those of other OC. A barrier prevented OC compounds from accumulating in the brain to the level one might expect in lipid tissues. Positive correlations were found between 1: DDT and PCB, 2: DDT and dieldrin, and 3: PCB and deildrin. Male harp seals bioaccumulated DDT, PCB, heptachlor epoxide and dieldrin with age. As a group, adult males sampled in the Gulf of St. Lawrence carried the highest concentrations of all OC, except that chlordane did not appear to bioaccumulate and levels of hexachlorobenzene were minimal. Females generally ceased exhibiting significant bioaccumulation once breeding age was reached, due to transplacental and transmammary residue transfer of OC from mother to pup. There were some significant differences in OC levels between locations with DDT: Gulf greater than Front; PCB: Gulf greater than Front; dieldrin: Gulf greater than Front; heptachlor epoxide: Front greater than Gulf. No significant differences were found, however, when northern locations (Grise Fiord, Northwest Greenland, Pangnirtung) were compared to southern (Gulf, Front) on a group basis.

  13. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  14. Underpinning sustainable vector control through informed insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Edward K Thomsen

    Full Text Available There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions.A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s.Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.

  15. Propoxur (2-iso propoxy-phenyl-N-methylcarbamate) residues in cocoa beans. Part of a coordinated programme on isotopic-tracer aided studies of chemical residues in cotton seed, feed, oil and related products

    International Nuclear Information System (INIS)

    Adomako, D.

    1982-05-01

    Pod-bearing Amazon and Amelonado cocoa plants were sprayed with Unden 20% (propoxur, arprocarb, baygon) at the recommended rate of 210 g a.i./ha and twice the recommended rate at monthly intervals from July to October 1976, and cured beans from the ripe pods analysed for propoxur residues by gas chromatography. In a radiotracer study with 14 C-labelled propoxur, the effect of processing methods on residues and systemic uptake of propoxur from insecticide deposits on pod surfaces were also investigated. Residues did not exceed 0.03 mg/kg. There was no relationship between residues and harvesting time, cocoa type or rate of application. Contamination of beans with insecticide deposits on the pod surface during processing, and systemic uptake of insecticide from pod surfaces were negligible. Experiments were also designed to provide data on 14 C-propoxur residues in cocoa beans, uptake of the chemical from pod surfaces and persistence on the leaves and in the soil. Leaves were picked from the lowest five branches of the cocoa trees, 13 months after the application of 14 C-propoxur, dried at 80 0 for 4 days, stored and analysed for their 14 C-activity. Soil samples were collected at 15 cm and 30 cm distances from the trunk base of treated trees, dried, stored and analysed. The analytical procedure involved extraction and clean-up steps after a standard method using acetone, chloroform and a coagulating agent. Propoxur residues in cocoa leaves collected 13 months after the insecticide application ranged from 0.01 to 0.04 mg/kg. Residues in shells from cocoa pods treated with 14 C-propoxur 2 months prior to harvest did not exceed 0.02 mg/kg. Propoxur residues in soil samples collected at 6, 16, and 19 months following application ranged from 0.01 to 0.03 mg/kg. These low levels are probably related to volatilization and heavy rains. Possible binding to soil cannot be precluded. The low levels of propoxur are unlikely to present any toxicological hazard to humans

  16. Diagnostic doses and times for Phlebotomus papatasi and Lutzomyia longipalpis sand flies (Diptera: Psychodidae: Phlebotominae) using the CDC bottle bioassay to assess insecticide resistance.

    Science.gov (United States)

    Denlinger, David S; Creswell, Joseph A; Anderson, J Laine; Reese, Conor K; Bernhardt, Scott A

    2016-04-15

    Insecticide resistance to synthetic chemical insecticides is a worldwide concern in phlebotomine sand flies (Diptera: Psychodidae), the vectors of Leishmania spp. parasites. The CDC bottle bioassay assesses resistance by testing populations against verified diagnostic doses and diagnostic times for an insecticide, but the assay has been used limitedly with sand flies. The objective of this study was to determine diagnostic doses and diagnostic times for laboratory Lutzomyia longipalpis (Lutz & Nieva) and Phlebotomus papatasi (Scopoli) to ten insecticides, including pyrethroids, organophosphates, carbamates, and DDT, that are used worldwide to control vectors. Bioassays were conducted in 1,000-ml glass bottles each containing 10-25 sand flies from laboratory colonies of L. longipalpis or P. papatasi. Four pyrethroids, three organophosphates, two carbamates and one organochlorine, were evaluated. A series of concentrations were tested for each insecticide, and four replicates were conducted for each concentration. Diagnostic doses were determined only during the exposure bioassay for the organophosphates and carbamates. For the pyrethroids and DDT, diagnostic doses were determined for both the exposure bioassay and after a 24-hour recovery period. Both species are highly susceptible to the carbamates as their diagnostic doses are under 7.0 μg/ml. Both species are also highly susceptible to DDT during the exposure assay as their diagnostic doses are 7.5 μg/ml, yet their diagnostic doses for the 24-h recovery period are 650.0 μg/ml for Lu. longipalpis and 470.0 μg/ml for P. papatasi. Diagnostic doses and diagnostic times can now be incorporated into vector management programs that use the CDC bottle bioassay to assess insecticide resistance in field populations of Lu. longipalpis and P. papatasi. These findings provide initial starting points for determining diagnostic doses and diagnostic times for other sand fly vector species and wild populations using the CDC

  17. Comparison of Insecticide Susceptibilities of Empoasca vitis (Hemiptera: Cicadellidae) from Three Main Tea-Growing Regions in China.

    Science.gov (United States)

    Wei, Qi; Yu, Hua-Yang; Niu, Chun-Dong; Yao, Rong; Wu, Shun-Fan; Chen, Zhuo; Gao, Cong-Fen

    2015-06-01

    Empoasca vitis (Göthe) is an important insect pest in tea-growing areas of China, and chemical control is the main tactic for the management of this pest. Due to the pressure of increasing insecticide resistance and more stringent food safety regulations, development of sound IPM strategies for E. vitis is an urgent matter. This study comparatively evaluated four field populations of E. vitis from three different tea-growing regions in China for their susceptibilities to eight insecticides using a simple leaf-dip methodology. E. vitis was found to be most sensitive to indoxacarb (LC505 mg/liter) and sophocarpidine (LC50>95 mg/liter, a botanical pesticide) regardless of populations. Population (geographical) variations were higher for indoxacarb and imidacloprid than other compounds. Judging by the 95% fiducial limits of LC50 values, all populations had similar susceptibilities to chlorfenapyr, bifenthrin, and acetamiprid or imidacloprid. Correlation analysis suggested that chlorfenapyr and indoxacarb or isoprocarb may have a high risk of cross resistance. Considering potency (LC50) and maximum residual levels, chlorfenapyr and bifenthrin are good insecticide options followed by acetamiprid and indoxacarb. These results provide valuable information to intelligently select insecticides for IPM programs that are efficacious against E. vitis while also managing insecticide resistance and maximum residual levels for tea production in China. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Assessment of organochlorine hydrocarbons transformation in contaminated agricultural products and foodstuffs under gamma-radiation

    Science.gov (United States)

    Mel'nikova, T. V.; Polyakova, L. P.; Oudalova, A. A.

    2017-01-01

    The problem of an estimation of organochlorinated pollutants transformation (particularly organochlorinated pesticides (OCP) and polychlorinated biphenyls (PCB)) under gamma-irradiation has become important in connection with radiation technologies application in the food industry. According to earlier researches, small doses of OCP lead to serious damages of an organism, comparable with damages from high doses. Among radiolysis products of OCP in model solutions various substances on a structure have been found out. Though of trace concentration of each of them, in sum with the initial pesticides residue they make up significant of mass contamination (as shown earlier up to 90% from initial OCP). In this work fish samples (bream) containing OCPs (15.20 ng/g of hexachlorocyclohexane isomers and 87.10 ng/g of DDT and its metabolites), as well as PCB (18.51 ng/g) were studied. The minced fish was irradiated at dose of 10 kGy with dose rate of 1.35 Gy/sec. Then, by methods of gas-liquid chromatography (GLC) and gas chromatography-mass spectrometry (GC-MS), it was found that the OCPs degradation varied from 3 up to 61% and the PCB degradation - 24-52%. Significant complication of chemical composition was shown comparing to the primary biological sample contamination. As a result of fish irradiation, secondary pollution appeared that included residues of primary organochlorine hydrocarbons and their radiation-induced metabolites. Among the investigated OCPs the most stable proved to be alfa-hexachlorocyclohexane (alfa-HCH), the least stable - DDT which corresponds to the previous findings about the radiation stability of OCPs in model solutions. Mass spectra of the irradiated samples of minced bream showed the presence of radiation metabolites of OCPs, that had also been found at irradiation of model solutions of 2,2-di(4-chlorophenyl)-1-chlorethylene (DDMU), DDD and 1a, 2e, 3e, 4e, 5e-pentahlorcyclohexane. There was revealed a decomposition product formed during the

  19. Assessment of organochlorine hydrocarbons transformation in contaminated agricultural products and foodstuffs under gamma-radiation

    International Nuclear Information System (INIS)

    Mel’nikova, T V; Polyakova, L P; Oudalova, A A

    2017-01-01

    The problem of an estimation of organochlorinated pollutants transformation (particularly organochlorinated pesticides (OCP) and polychlorinated biphenyls (PCB)) under gamma-irradiation has become important in connection with radiation technologies application in the food industry. According to earlier researches, small doses of OCP lead to serious damages of an organism, comparable with damages from high doses. Among radiolysis products of OCP in model solutions various substances on a structure have been found out. Though of trace concentration of each of them, in sum with the initial pesticides residue they make up significant of mass contamination (as shown earlier up to 90% from initial OCP). In this work fish samples (bream) containing OCPs (15.20 ng/g of hexachlorocyclohexane isomers and 87.10 ng/g of DDT and its metabolites), as well as PCB (18.51 ng/g) were studied. The minced fish was irradiated at dose of 10 kGy with dose rate of 1.35 Gy/sec. Then, by methods of gas-liquid chromatography (GLC) and gas chromatography-mass spectrometry (GC-MS), it was found that the OCPs degradation varied from 3 up to 61% and the PCB degradation – 24-52%. Significant complication of chemical composition was shown comparing to the primary biological sample contamination. As a result of fish irradiation, secondary pollution appeared that included residues of primary organochlorine hydrocarbons and their radiation-induced metabolites. Among the investigated OCPs the most stable proved to be alfa-hexachlorocyclohexane (alfa-HCH), the least stable – DDT which corresponds to the previous findings about the radiation stability of OCPs in model solutions. Mass spectra of the irradiated samples of minced bream showed the presence of radiation metabolites of OCPs, that had also been found at irradiation of model solutions of 2,2-di(4-chlorophenyl)-1-chlorethylene (DDMU), DDD and 1a, 2e, 3e, 4e, 5e-pentahlorcyclohexane. There was revealed a decomposition product formed during

  20. A rapid, solid phase extraction (SPE technique for the extraction and gas chromatographic determination lindane pesticide residue in tissue and milk

    Directory of Open Access Journals (Sweden)

    Yuningsih

    2006-03-01

    Full Text Available Organochlorine pesticide contamination in feed can cause residue in animal product (tissue and milk, so its become a problem in food safety. Solid phase extraction (SPE has been carried out for determination organochlorine pesticide residues in food animal production. The technique was rapid, not costly and produce limited amount of hazardous-waste. Samples were homogenized with acetonitrile trough cartridge C18, eluted in fluorocyl column with 2% ether-petroleum or acetonitrile fortissue and milk samples respectively. The recoveries of tissue sample by addition lindane standard solution: 0.50 and 1.00 μg are 85.10 and 103.10% respectively, while that of milk with the addition of 0.50, 1.00 and 1.50 μg are 83.80, 88.69 and 91.24% respectively. Three replicates were carried out for every sample. According of validation criteria of FAO/IAEA the recovery for analysis of pesticide residues was 70-110%. Therefore, the method is applicable.

  1. Persistence of organochlorine chemical residues in fish from the Tombigbee River (Alabama, USA): Continuing risk to wildlife from a former DDT manufacturing facility

    Science.gov (United States)

    Hinck, J.E.; Norstrom, R.J.; Orazio, C.E.; Schmitt, C.J.; Tillitt, D.E.

    2009-01-01

    Organochlorine pesticide and total polychlorinated biphenyl (PCB) concentrations were measured in largemouth bass from the Tombigbee River near a former DDT manufacturing facility at McIntosh, Alabama. Evaluation of mean p,p???- and o,p???-DDT isomer concentrations and o,p???- versus p,p???-isomer proportions in McIntosh bass indicated that DDT is moving off site from the facility and into the Tombigbee River. Concentrations of p,p???-DDT isomers in McIntosh bass remained unchanged from 1974 to 2004 and were four times greater than contemporary concentrations from a national program. Total DDT in McIntosh bass exceeded dietary effect concentrations developed for bald eagle and osprey. Hexachlorobenzene, PCBs, and toxaphene concentrations in bass from McIntosh also exceeded thresholds to protect fish and piscivorous wildlife. Whereas concentrations of DDT and most other organochlorine chemicals in fish have generally declined in the U.S. since their ban, concentrations of DDT in fish from McIntosh remain elevated and represent a threat to wildlife.

  2. Ecohealth Interventions Limit Triatomine Reinfestation following Insecticide Spraying in La Brea, Guatemala

    Science.gov (United States)

    Lucero, David E.; Morrissey, Leslie A.; Rizzo, Donna M.; Rodas, Antonieta; Garnica, Roberto; Stevens, Lori; Bustamante, Dulce M.; Monroy, Maria Carlota

    2013-01-01

    In this study, we evaluate the effect of participatory Ecohealth interventions on domestic reinfestation of the Chagas disease vector Triatoma dimidiata after village-wide suppression of the vector population using a residual insecticide. The study was conducted in the rural community of La Brea, Guatemala between 2002 and 2009 where vector infestation was analyzed within a spatial data framework based on entomological and socio-economic surveys of homesteads within the village. Participatory interventions focused on community awareness and low-cost home improvements using local materials to limit areas of refuge and alternative blood meals for the vector within the home, and potential shelter for the vector outside the home. As a result, domestic infestation was maintained at ≤ 3% and peridomestic infestation at ≤ 2% for 5 years beyond the last insecticide spraying, in sharp contrast to the rapid reinfestation experienced in earlier insecticide only interventions. PMID:23382173

  3. Organochlorine pesticides in the ambient air of Chiapas, Mexico.

    Science.gov (United States)

    Alegria, Henry; Bidleman, Terry F; Figueroa, Miguel Salvador

    2006-04-01

    Organochlorine (OC) pesticides were measured in the ambient air of Chiapas, Mexico during 2000-2001. Concentrations of some OC pesticides (DDTs, chlordanes, toxaphene) were elevated compared with levels in the Great Lakes region, while those of other pesticides were not (hexachlorocyclohexanes, dieldrin). While this suggests southern Mexico as a source region for the former group of chemicals, comparably high levels have also been reported in parts of the southern United States, where their suspected sources are soil emissions (DDTs, toxaphene) and termiticide usage (chlordane). Ratios of p,p'-DDT/p,p'-DDE and trans-chlordane/cis-chlordane/trans-nonachlor (TC/CC/TN) in Chiapas suggest a mixture of fresh and weathered sources, while congener profiles of toxaphene suggest emission of old residues from soils. This is supported by air parcel back trajectory analysis, which indicated that air masses over Chiapas at the time of sampling had previously passed over areas of continuing or recent use of some OC pesticides as well as areas of past use.

  4. Further studies on the use of enzyme profiles to monitor residue accumulation in wildlife: Plasma enzymes in starlings fed graded concentrations of morsodren, DDE, Aroclor 1254, and malathion

    Science.gov (United States)

    Dieter, M.P.

    1975-01-01

    Wild-trapped starlings (Sturnus vulgaris) were fed concentrations of Morsodren (2, 4, and 8 ppm), DDE or Aroclor 1254 (5, 25, and 100 ppm), or malathion (8, 35, and 160 ppm) that were found to be sublethal in pen-reared Coturnix quail fed these amounts for 12 weeks. Plasma enzymes had to be measured earlier than planned in starlings fed Morsodren (at three weeks) or the organochlorine compounds (at seven weeks) because of unexpected, subsequent mortality. Variations in enzyme response were greater in wild than in pen-reared birds, but not enough to mask the toxicant-induced changes in enzyme activity. Cholinesterase activities decreased in birds fed Morsodren or malathion, and increased in those fed the organochlorine compounds. Lactate dehydrogenase activities increased two-fold in starlings fed Morsodren and two- to four-fold in those fed the organochlorine compounds, but only 50% in those fed malathion. Further examination of enzyme profiles showed that creatine kinase and aspartate aminotransferase activities increased two-to four-fold in birds fed Morsodren or the organochlorine compounds but not at all in those fed malathion. Thus the classes of environmental contaminants fed to starlings could be easily distinguished by these enzymatic parameters. Evaluation of enzymatic profiles appears to be a potentially valuable technique to monitor the presence of toxicants in wild populations, especially if used to complement standard chemical residue analyses. Here the residue analyses showed, after three weeks feeding, that mercury in the carcasses reflected the concentrations fed daily, whereas accumulation in the livers was two- to four-fold greater. After seven weeks feeding, liver residues of either organochlorine compound were about three-fold higher than the concentrations fed daily. However, four times as much DDE as Aroclor 1254 had accumulated in the carcasses.

  5. Monitoring and remediation technologies of organochlorine pesticides in drainage water

    OpenAIRE

    Ismail Ahmed; Derbalah Aly; Shaheen Sabry

    2015-01-01

    This study was carried out to monitor the presence of organochlorine in drainage water in Kafr-El-Sheikh Governorate, Egypt. Furthermore, to evaluate the efficiencies of different remediation techniques (advanced oxidation processes [AOPs] and bioremediation) for removing the most frequently detected compound (lindane) in drainage water. The results showed the presence of several organochlorine pesticides in all sampling sites. Lindane was detected with high frequency relative to other detect...

  6. Inadvertent exposure to organochlorine pesticides DDT and derivatives in people from the Canary Islands (Spain)

    International Nuclear Information System (INIS)

    Zumbado, Manuel; Goethals, Muriel; Alvarez-Leon, Eva E.; Luzardo, Octavio P.; Cabrera, Felix; Serra-Majem, Lluis; Dominguez-Boada, Luis

    2005-01-01

    In 1998, one of the largest determinations of organochlorine pesticides in a representative sample of a Spanish population (682 serum samples from the Canary Islands) was made in the context of the 'Canary Islands Nutrition Survey' (ENCA). In the Canary Islands, extensive farming areas have been developed in these last decades, with greenhouses dedicated to intensive cultivation using DDT in huge amounts. In Spain, similarly to other European countries, DDT was banned in the late 1970s. The pesticide residues in human serum are indicative of past and present exposure to them. Our objective is to point out the differences of pesticide contamination between islands; and together with this, if a connection could be established with gender, age, or habitat of subjects. Concentration of selected persistent organochlorine pollutants (p,p'-DDT, o,p'-DDT, p,p'-DDE, o,p'-DDE, p,p'-DDD, and o,p'-DDD) was measured with gas chromatography-electron capture detector. Almost all of the samples (99.3%) presented detectable levels of some DDT-derivatives, being p,p'-DDE the most frequently detected organochlorine. The median concentration of total DDT body burden, expressed in ng/g fat, present in the Canary Islands (370 ng/g fat) was similar to that found in other European countries, although it was noteworthy that a fourth of the population showed a total DDT body burden higher than 715 ng/g. Interestingly, statistical significant differences were found in serum levels of organochlorine pesticides between islands, being these levels higher in people from Tenerife and Gran Canaria (415 and 612 ng/g fat, respectively), the islands that present both highest population and highest surface devoted to intensive agriculture. As expected, serum levels of both total DDT body burden and p,p'-DDE increased with age. Statistically significant differences were also found in relation to gender, women showing higher levels of these organochlorine pesticides than men. One of the most relevant

  7. Evaluation of new tools for malaria vector control in Cameroon: focus on long lasting insecticidal nets.

    Science.gov (United States)

    Etang, Josiane; Nwane, Philippe; Piameu, Michael; Manga, Blaise; Souop, Daniel; Awono-Ambene, Parfait

    2013-01-01

    From 2006 to 2011, biological activity of insecticides for Indoor Residual Spraying (IRS), conventional treatment of nets (CTNs) or long lasting insecticidal nets (LLINs) was evaluated before their approval in Cameroon. The objective of the study was to select the best tools for universal malaria vector control coverage. Bioassays were performed using WHO cones and the Kisumu susceptible strain of Anopheles gambiae s.s.. Among tested products, residual activity and wash resistance of Alpha-cypermethrin LLINs (Interceptor) and CTNs (Fendona) were assessed during 5 months in the Ntougou neighborhood. All the 14 tested products were found effective (95-100% knockdown and mortality rates), although a significant decrease of efficacy was seen with lambda-cyhalothrinWP IRS, alpha-cypermethrin CTNs and LLINs (peducation toward universal coverage of malaria vector control in Cameroon.

  8. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  9. Organochlorine pesticides, PCBs, dibenzodioxin, and furan concentrations in common snapping turtle eggs (Chelydra serpentina serpentina) in Akwesasne, Mohawk Territory, Ontario, Canada.

    Science.gov (United States)

    de Solla, S R; Bishop, C A; Lickers, H; Jock, K

    2001-04-01

    Subsamples of eight clutches of common snapping turtle eggs (Chelydra serpentina serpentina) were collected from four sites from the territory of the Mohawk Nation, Akwesasne, on the shore of the St. Lawrence River. Egg contents were analyzed for organochlorine pesticides, polychlorinated biphenyls (PCBs), dibenzodioxins, and furans. The sites were 2 to 13 km downstream from PCB-contaminated landfill sites. Maximum concentrations of total PCBs in snapping turtle clutches were extremely high, and ranged from 2 378.2 ng/g to 737 683 ng/g (wet weight) and are among the highest recorded in any tissue of a free-ranging animal. Similarly, in a pooled sample of eggs from all four sites, the summed concentrations of non-ortho PCBs (n = 6 congeners) was also very high at 54.54 ng/g and the summed dioxin and furan concentrations (n = 11 congeners) was 85.8 ng/g. Sum organochlorine pesticide levels varied from 28 to 2,264 ng/g among the four sites. The levels of PCBs found in turtle eggs exceed concentrations associated with developmental problems and reduced hatching success in snapping turtles and other species and also exceed the Canadian tissue residue guidelines for toxic equivalency concentrations. The extremely high levels of organochlorine contaminants demonstrate the high degree of contamination in the environment in the Akwesasne area.

  10. Assessment of herbicides and organochlorine pesticides contamination in agricultural soils using gas chromatography-mass spectrometry.

    Science.gov (United States)

    Wang, Wan-Hong; Wang, Shi-Cheng; Wang, Yan-Hong

    2008-01-01

    A rapid multi-residue method for the simultaneous analysis of 3 herbicides and 8 organochlorine pesticides (OCPs) in agricultural soils has been developed, using ultrasonic solvent extraction coupled with gas chromatography-mass spectrometry (GC-MS). The recoveries ranged from 81% to 117% with a relative standard deviation (R.S.D) lower than 15%. The limits of quantification (LOQs) ranged from 0.03 to 1.06 microg x kg(-1) dry weight for different pesticides studied. The proposed method has been applied to investigate the 11 pesticide residues in agricultural soils collected from Liaoning Province, northeast of China. 3 OCPs and 3 herbicides were identified. Acetochlor, atrazine, butachtor were measured in the relatively high level with values ranging from 0.53 to 203.18 microg x kg(-1), 0.14 to 21.20 microg x kg(-1), pesticides in this study was compared with the date of other countries reported and the corresponding limiting values used in Netherland, USA, Canada, Vietnam and Thailand. Among the herbicide residues, there was a significant relativity between soil utilizing types and their residue concentration. It seems that the monitoring action for soil contamination caused by commonly-used herbicides should be enhanced according to soil utilizing types, especially acetochlor in maize field.

  11. Susceptibility of different life stages of Tribolium confusum to pyrethrin aerosol: effects of a flour food source on insecticidal efficacy

    Science.gov (United States)

    Accumulated grain dust and flour residues in flour mills can potentially decrease the efficacy of contact insecticides used for control of adult and immature stages of stored product insects. A study was conducted to evaluate the effects of flour residues on the efficacy of synergized pyrethrin aero...

  12. In-silico determination of insecticidal potential of Vip3Aa-Cry1Ac fusion protein against Lepidopteran targets using molecular docking

    Directory of Open Access Journals (Sweden)

    Aftab eAhmad

    2015-12-01

    Full Text Available Study and research of Bt (Bacillus thuringiensis transgenic plants have opened new ways to combat insect pests. Over the decades, however, insect pests, especially the Lepidopteran, have developed tolerance against Bt delta-endotoxins. Such issues can be addressed through the development of novel toxins with greater toxicity and affinity against a broad range of insect receptors. In this computational study, functional domains of Bacillus thuringiensis crystal delta-endotoxin (Cry1Ac insecticidal protein and vegetative insecticidal protein (Vip3Aa have been fused to develop a broad-range Vip3Aa-Cry1Ac fusion protein. Cry1Ac and Vip3Aa are non-homologous insecticidal proteins possessing receptors against different targets within the midgut of insects. The insecticidal proteins were fused to broaden the insecticidal activity. Molecular docking analysis of the fusion protein against aminopeptidase-N (APN and cadherin receptors of five Lepidopteran insects (Agrotis ipsilon, Helicoverpa armigera, Pectinophora gossypiella, Spodoptera exigua and Spodoptera litura revealed that the Ser290, Ser293, Leu337, Thr340 and Arg437 residues of the fusion protein are involved in the interaction with insect receptors. The Helicoverpa armigera cadherin receptor, however, showed no interaction, which might be due to either loss or burial of interactive residues inside the fusion protein. These findings revealed that the Vip3Aa-Cry1Ac fusion protein has a strong affinity against Lepidopteran insect receptors and hence has a potential to be an efficient broad-range insecticidal protein.

  13. Dynamic plant uptake model applied for drip irrigation of an insecticide to pepper fruit plants

    DEFF Research Database (Denmark)

    Legind, Charlotte Nielsen; Kennedy, C. M.; Rein, Arno

    2011-01-01

    irrigation, its application for a soil-applied insecticide and a sensitivity analysis of the model parameters. RESULTS: The model predicted the measured increase and decline of residues following two soil applications of an insecticide to peppers, with an absolute error between model and measurement ranging...... from 0.002 to 0.034 mg kg fw—1. Maximum measured concentrations in pepper fruit were approximately 0.22 mg kg fw—1. Temperature was the most sensitive component for predicting the peak and final concentration in pepper fruit, through its influence on soil and plant degradation rates...

  14. Insecticide Treated Camouflage Sceening Reduces Sand Fly Numbers in Leishmania-Endemic Regions in Kenya

    Science.gov (United States)

    Current U.S. military operations in deserts face persistent threats from sand flies that transmit human Leishmania. In this study we investigated the efficacy of artificial barriers treated with residual insecticide to potentially reduce the risk of human infection from leishmaniasis by reducing the...

  15. Efficacy of Systemic Insecticides for Control of the Invasive Goldspotted Oak Borer (Coleoptera: Buprestidae) in California.

    Science.gov (United States)

    Coleman, Tom W; Smith, Sheri L; Jones, Michael I; Graves, Andrew D; Strom, Brian L

    2017-10-01

    From 2009 to 2013, we tested four systemic insecticide formulations and five application methods against the invasive goldspotted oak borer, Agrilus auroguttatus Schaeffer (Coleoptera: Buprestidae), in California. The insecticides were evaluated in three experiments: 1) 2009 remedial applications of emamectin benzoate (stem-injection) and imidacloprid (stem-injection and soil-injection); 2) 2009-2012 emamectin benzoate and imidacloprid initially applied at different times during the dormant season with varying injection technologies; and 3) 2013 dinotefuran applied to several tree diameter size classes. Adult leaf-feeding bioassays were used to assess the impact of systemic treatments against A. auroguttatus, whereas enzyme-linked immunosorbent assays determined the quantity of the active ingredient of insecticide residues in foliage. Imidacloprid (experiment 1) persisted at elevated levels in foliage of coast live oak, Quercus agrifolia Née, for 1.5 yr following stem injections. Stem injections of emamectin benzoate (experiment 2) sometimes significantly decreased survival in adults fed foliage from treated Q. agrifolia, and both the emamectin benzoate and imidacloprid treatments reduced adult feeding in some trials. Imidacloprid residues in Q. agrifolia and California black oak, Quercus kelloggii Newb., foliage remained at elevated levels (>10 µg/g) ∼2 yr postapplication. In 2013 (experiment 3), dinotefuran residues were highest in foliage collections 2 wk postapplication and greatest in smaller diameter oaks, but insecticide treatment had no effect on survival or frass production by adults fed foliage from treated trees. Systemic injections of emamectin benzoate and imidacloprid applied during the dormant season to uninfested or lightly infested oaks can reduce adult A. auroguttatus survival and maturation feeding. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by (a) US Government employee

  16. Estimation of dietary intake of PCB and organochlorine pesticides for children and adults

    DEFF Research Database (Denmark)

    Fromberg, Arvid; Granby, Kit; Højgård, A.

    2011-01-01

    Levels of organochlorine substances, including a number of organochlorine pesticides and PCB, are monitored in food, including meat, fish and dairy products. The substances are slowly degradable and therefore persist for long periods in the environment, where they accumulate in the fatty tissues...... pesticides and 0.9 μg/day for the indicator PCB-sum. People with a relatively high intake of these substances (the 95th percentile) are estimated to consume approximately twice as much. In general, the highest contributions to the intake of the organochlorine environmental contaminants are from fish, meat...

  17. Determination of Carbaryl residues in soybean and peanut plants

    International Nuclear Information System (INIS)

    Sumatra, M.; Soejono; Sisworo, W.H.

    1976-01-01

    Carbaryl is one of the insecticides used in large quantities in Indonesia. It is effective against soybean and peanut plant insects. The residues in the plants are determined by Colorimetry at the residues level up to 5 ppm and by thin layer chromatography at level up to 0,1 ppm. Both methods use coupling reaction between hydrolysis product of Carbaryl and diazo reagent to produce colour. (author)

  18. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  19. Application of dispersive Liquid-Liquid microextraction based on solidification of floating organic droplet multi-residue method for the simultaneous determination of polychlorinated biphenyls, organochlorine, and pyrethroid pesticides in aqueous sample

    International Nuclear Information System (INIS)

    Zuo, Mei; Li, Man-Liang; Cheng, Jing; Matsadiq, Guzalnur; Liu, Lu; Zhang, Miao

    2012-01-01

    Dispersive liquid-liquid microextraction based on solidification of floating organic droplet (DLLME-SFO) technique was successfully applied for simultaneous assay of eight polychlorinated biphenyls, two organochlorine, and four pyrethroid pesticides multi-residue in aqueous samples by using GC-electron capture detection. The effects of various parameters such as kind of extractant and dispersant and volume of them, extraction time, effect of salt addition, and pH were optimized. As a result, 5.0 μL 1-dodecanol was chosen as extraction solvent, 600 μL methanol were used as dispersive solvent without salt addition, pH was adjusted to 7. Under the optimized conditions, the limits of detection (LOD) were ranged from 1.4 to 8.3 ng L -1 . Satisfactory linear range was observed from 5.0 to 2000 ng L -1 with correlation coefficient better than 0.9909. Good precisions were also acquired with RSD better than 13.6% for all target analytes. The enrichment factors of the method were ranged from 786 to 1427. The method can be successfully applied to simultaneous separation and determination of three class residues in real water samples and good recoveries were obtained ranging from 76 to 130, 73 to 129, and 78 to 130% for tap water, lake water, and industrial waste water, respectively. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Validation of QuEChERS analytical technique for organochlorines and synthetic pyrethroids in fruits and vegetables using GC-ECD.

    Science.gov (United States)

    Dubey, J K; Patyal, S K; Sharma, Ajay

    2018-03-19

    In the present day scenario of increasing awareness and concern about the pesticides, it is very important to ensure the quality of data being generated in pesticide residue analysis. To impart confidence in the products, terms like quality assurance and quality control are used as an integral part of quality management. In order to ensure better quality of results in pesticide residue analysis, validation of analytical methods to be used is extremely important. Keeping in view the importance of validation of method, the validation of QuEChERS (quick, easy, cheap, effective, rugged, and safe) a multiresidue method for extraction of 13 organochlorines and seven synthetic pyrethroids in fruits and vegetables followed by GC ECD for quantification was done so as to use this method for analysis of samples received in the laboratory. The method has been validated as per the Guidelines issued by SANCO (French words Sante for Health and Consommateurs for Consumers) in accordance with their document SANCO/XXXX/2013. Various parameters analyzed, viz., linearity, specificity, repeatability, reproducibility, and ruggedness were found to have acceptable values with a per cent RSD of less than 10%. Limit of quantification (LOQ) for the organochlorines was established to be 0.01 and 0.05 mg kg -1 for the synthetic pyrethroids. The uncertainty of the measurement (MU) for all these compounds ranged between 1 and 10%. The matrix-match calibration was used to compensate the matrix effect on the quantification of the compounds. The overall recovery of the method ranged between 80 and 120%. These results demonstrate the applicability and acceptability of this method in routine estimation of pesticide residues of these 20 pesticides in the fruits and vegetables by the laboratory.

  1. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  2. Cyolane residues in milk of lactating goats

    International Nuclear Information System (INIS)

    Zayed, S.M.A.D.; Osman, A.; Fakhr, I.M.I.

    1981-01-01

    Consecutive feeding of lactating goats with 14 C-alkyl labelled cyolane for 5 days at dietary levels 8 and 16 ppm resulted in the appearance of measurable insecticide residues in milk (0.02-0.04 mg/kg). The residue levels were markedly reduced after a withdrawal period of 7 days. Analysis of urine and milk residues showed the presence of similar metabolites in addition to the parent compound. The major part of the residue consisted of mono-, diethyl phosphate and 2 hydrophilic unknown metabolites. The erythrocyte cholinesterase activity was reduced to about 50% after 24 hours whereas the plasma enzyme was only slightly affected. The animals remained symptom-free during the experimental period. (author)

  3. Implications of insecticide resistance for malaria vector control with long-lasting insecticidal nets: a WHO-coordinated, prospective, international, observational cohort study.

    Science.gov (United States)

    Kleinschmidt, Immo; Bradley, John; Knox, Tessa Bellamy; Mnzava, Abraham Peter; Kafy, Hmooda Toto; Mbogo, Charles; Ismail, Bashir Adam; Bigoga, Jude D; Adechoubou, Alioun; Raghavendra, Kamaraju; Cook, Jackie; Malik, Elfatih M; Nkuni, Zinga José; Macdonald, Michael; Bayoh, Nabie; Ochomo, Eric; Fondjo, Etienne; Awono-Ambene, Herman Parfait; Etang, Josiane; Akogbeto, Martin; Bhatt, Rajendra M; Chourasia, Mehul Kumar; Swain, Dipak K; Kinyari, Teresa; Subramaniam, Krishanthi; Massougbodji, Achille; Okê-Sopoh, Mariam; Ogouyemi-Hounto, Aurore; Kouambeng, Celestin; Abdin, Mujahid Sheikhedin; West, Philippa; Elmardi, Khalid; Cornelie, Sylvie; Corbel, Vincent; Valecha, Neena; Mathenge, Evan; Kamau, Luna; Lines, Jonathan; Donnelly, Martin James

    2018-04-09

    Scale-up of insecticide-based interventions has averted more than 500 million malaria cases since 2000. Increasing insecticide resistance could herald a rebound in disease and mortality. We aimed to investigate whether insecticide resistance was associated with loss of effectiveness of long-lasting insecticidal nets and increased malaria disease burden. This WHO-coordinated, prospective, observational cohort study was done at 279 clusters (villages or groups of villages in which phenotypic resistance was measurable) in Benin, Cameroon, India, Kenya, and Sudan. Pyrethroid long-lasting insecticidal nets were the principal form of malaria vector control in all study areas; in Sudan this approach was supplemented by indoor residual spraying. Cohorts of children from randomly selected households in each cluster were recruited and followed up by community health workers to measure incidence of clinical malaria and prevalence of infection. Mosquitoes were assessed for susceptibility to pyrethroids using the standard WHO bioassay test. Country-specific results were combined using meta-analysis. Between June 2, 2012, and Nov 4, 2016, 40 000 children were enrolled and assessed for clinical incidence during 1·4 million follow-up visits. 80 000 mosquitoes were assessed for insecticide resistance. Long-lasting insecticidal net users had lower infection prevalence (adjusted odds ratio [OR] 0·63, 95% CI 0·51-0·78) and disease incidence (adjusted rate ratio [RR] 0·62, 0·41-0·94) than did non-users across a range of resistance levels. We found no evidence of an association between insecticide resistance and infection prevalence (adjusted OR 0·86, 0·70-1·06) or incidence (adjusted RR 0·89, 0·72-1·10). Users of nets, although significantly better protected than non-users, were nevertheless subject to high malaria infection risk (ranging from an average incidence in net users of 0·023, [95% CI 0·016-0·033] per person-year in India, to 0·80 [0·65-0·97] per person

  4. Impact of planting dates and insecticide strategies for managing crucifer flea beetles (Coleoptera: Chrysomelidae) in spring-planted canola.

    Science.gov (United States)

    Knodel, Janet J; Olson, Denise L; Hanson, Bryan K; Henson, Robert A

    2008-06-01

    Integration of cultural practices, such as planting date with insecticide-based strategies, was investigated to determine best management strategy for flea beetles (Phyllotreta spp.) (Coleoptera: Chrysomelidae) in canola (Brassica napus L.). We studied the effect of two spring planting dates of B. napus and different insecticide-based management strategies on the feeding injury caused by fleabeetles in North Dakota during 2002-2003. Adult beetle peak emergence usually coincided with the emergence of the early planted canola, and this resulted in greater feeding injury in the early planted canola than later planted canola. Use of late-planted canola may have limited potential for cultural control of flea beetle, because late-planted canola is at risk for yield loss due to heat stress during flowering. Flea beetle injury ratings declined when 1) the high rate of insecticide seed treatment plus a foliar insecticide applied 21 d after planting was used, 2) the high rate of insecticide seed treatment only was used, or 3) two foliar insecticide sprays were applied. These insecticide strategies provided better protection than the low rates of insecticide seed treatments or a single foliar spray, especially in areas with moderate-to-high flea beetle populations. The foliar spray on top of the seed treatment controlled later-emerging flea beetles as the seed treatment residual was diminishing and the crop became vulnerable to feeding injury. The best insecticide strategy for management of flea beetle was the high rate of insecticide seed treatment plus a foliar insecticide applied at 21 d after planting, regardless of planting date.

  5. Isotopic tracer aided studies of fenvalerate residues in stored rice

    International Nuclear Information System (INIS)

    Varca, L.M.; Sanchez, T.E.; Magallona, E.D.

    1990-01-01

    Following application of 14 C-fenvalerate to milled rice and paddy rice at a concentration of 0.33 mg/kg, only insignificant losses were measured after 9 months. Distribution patterns in surface, methanol extractable and bound residues were studied. Paddy rice contained less extractable residues than milled rice, with the major part being found in the husk. Bound residues in both milled and paddy rice decreased also with length of storage; as much as 30% was found as bound residues after nine months. Cooking reduced the insecticide residues in milled rice by 33-40% and residues in paddy rice by 58%. (author). 8 refs, 1 fig., 4 tabs

  6. Acceptability and perceived side effects of insecticide indoor residual spraying under different resistance management strategies Aceptabilidad y efectos secundarios percibidos del rociado residual intradomiciliario de insecticidas bajo diferentes esquemas de manejo de resistencia

    Directory of Open Access Journals (Sweden)

    Américo David Rodríguez

    2006-08-01

    Full Text Available OBJECTIVE: To assess household acceptability and perceived side effects of residual indoor pyrethroid (PYR, carbamate and organophosphate insecticides sprayed by annual rotation (ROT, spatial mosaic (MOS, and a single insecticide (DDT or PYR in communities of the coastal plain of Chiapas, Mexico. MATERIAL AND METHODS: A questionnaire to assess the acceptability and perceived side effects of indoor insecticides was administered to one member of 30% of the families in eight villages of Chiapas. The association of different insecticide treatments with their responses was evaluated (Chi-square. The intensity of side effects indicated under different treatments was compared in an ordered logistic model, using a severity index as the response variable. RESULTS: Insecticide spraying as a probable cause of symptoms was identified by 2.1% of interviewees. A significantly high percentage of persons with blurred vision, dizziness, sneezing, coughing, numbness, watery eyes, and itching lived in villages under MOS and ROT and a high severity index was significantly associated with ROT treatment. Reduction of mosquito bites and cockroaches were the perceived main benefits, and most villagers that perceived no benefits lived in DDT treated villages. Most of the interviewees welcomed spraying (83.7%, but the smell and having to remove furniture from houses were the main arguments against it. CONCLUSIONS: Acceptability correlated with insecticide spray coverage, although the most frequent suggestion for improvement was to increase the understanding of the objectives of spraying in the communities. The frequency of side effects was low, but higher in localities where a combination of insecticides was applied. This is a limitation for the use of this type of resistance management strategy in public health.OBJETIVO: Evaluar la aceptabilidad y los efectos secundarios del rociado intradomiciliar de insecticidas pyrethroides (PYR, carbamato y organophosphato rociados

  7. Organochlorine chemical residues in Northern Cardinal (Cardinalis cardinalis) eggs from Greater Washington, DC USA

    Science.gov (United States)

    Schmitt, Christopher J.; Echols, Kathy R.; Peterman, Paul; Orazio, Carl; Grimm, Christiana; Tan, Shirlee; Diggs, Nora E.; Marra, Peter P.

    2018-01-01

    Northern Cardinal eggs from six neighborhoods near Washington DC were analyzed for organochlorine pesticides and PCBs. All compounds were detected more frequently and at higher concentrations in more heavily urbanized neighborhoods. DDT (mostly as p,pʹ-DDE) was detected in all neighborhoods. p,pʹ-DDT was typically 0.5‒16 ng/g (ww) in most suburban neighborhoods but was not detected (< 0.1 ng/g) in more rural areas; however, p,pʹ-DDT was 127‒1130 ng/g in eggs from two suburban Maryland nests and comprised 65.7% of total p,pʹ-DDT isomers in the most contaminated sample, indicating recent exposure to un-weathered DDT. Total chlordane (sum of 5 compounds) was 2‒70 ng/g; concentrations were greatest in older suburban neighborhoods. Total PCB (sum of detected congeners) was < 5‒21 ng/g. Congener patterns were similar in all neighborhoods and resembled those typical of weathered mixtures. Results indicate that wildlife remains exposed to low concentrations of legacy contaminants in suburban neighborhoods and that cardinal eggs can be used to monitor localized contamination.

  8. Monitoring and remediation technologies of organochlorine pesticides in drainage water

    Directory of Open Access Journals (Sweden)

    Ismail Ahmed

    2015-03-01

    Full Text Available This study was carried out to monitor the presence of organochlorine in drainage water in Kafr-El-Sheikh Governorate, Egypt. Furthermore, to evaluate the efficiencies of different remediation techniques (advanced oxidation processes [AOPs] and bioremediation for removing the most frequently detected compound (lindane in drainage water. The results showed the presence of several organochlorine pesticides in all sampling sites. Lindane was detected with high frequency relative to other detected organochlorine in drainage water. Nano photo-Fenton like reagent was the most effective treatment for lindane removal in drainage water. Bioremediation of lindane by effective microorganisms (EMs removed 100% of the lindane initial concentration. There is no remaining toxicity in lindane contaminated-water after remediation on treated rats relative to control with respect to histopathological changes in liver and kidney. Advanced oxidation processes especially with nanomaterials and bioremediation using effective microorganisms can be regarded as safe and effective remediation technologies of lindane in water.

  9. Mechanism of action of the insecticides, lindane and fipronil, on glycine receptor chloride channels.

    Science.gov (United States)

    Islam, Robiul; Lynch, Joseph W

    2012-04-01

    Docking studies predict that the insecticides, lindane and fipronil, block GABA(A) receptors by binding to 6' pore-lining residues. However, this has never been tested at any Cys-loop receptor. The neurotoxic effects of these insecticides are also thought to be mediated by GABA(A) receptors, although a recent morphological study suggested glycine receptors mediated fipronil toxicity in zebrafish. Here we investigated whether human α1, α1β, α2 and α3 glycine receptors were sufficiently sensitive to block by either compound as to represent possible neurotoxicity targets. We also investigated the mechanisms by which lindane and fipronil inhibit α1 glycine receptors. Glycine receptors were recombinantly expressed in HEK293 cells and insecticide effects were studied using patch-clamp electrophysiology. Both compounds completely inhibited all tested glycine receptor subtypes with IC(50) values ranging from 0.2-2 µM, similar to their potencies at vertebrate GABA(A) receptors. Consistent with molecular docking predictions, both lindane and fipronil interacted with 6' threonine residues via hydrophobic interactions and hydrogen bonds. In contrast with predictions, we found no evidence for lindane interacting at the 2' level. We present evidence for fipronil binding in a non-blocking mode in the anaesthetic binding pocket, and for lindane as an excellent pharmacological tool for identifying the presence of β subunits in αβ heteromeric glycine receptors. This study implicates glycine receptors as novel vertebrate toxicity targets for fipronil and lindane. Furthermore, lindane interacted with pore-lining 6' threonine residues, whereas fipronil may have both pore and non-pore binding sites. © 2011 The Authors. British Journal of Pharmacology © 2011 The British Pharmacological Society.

  10. Quantification of neonicotinoid insecticide residues in soils from cocoa plantations using a QuEChERS extraction procedure and LC-MS/MS

    DEFF Research Database (Denmark)

    Dankyi, Enock; Gordon, Christopher; Carboo, Derick

    2014-01-01

    The use of neonicotinoids as an insecticide group in Ghana has been quite significant particularly in cocoa production. The high usage has been mainly as a result of a government policy of free insecticide spraying on cocoa farms, in an effort to curb declining yields caused by pests and diseases...... and to prevent the use of unapproved or banned insecticides on cocoa farms. However the scale of cocoa farming, the frequency and intensity of usage coupled with the mode of application may result in large physical volumes of insecticides in the environment. This makes the knowledge of the concentration and fate...... of neonicotinoids in the environment extremely important. The present study was aimed at assessing the levels of five major neonicotinoids in soils from cocoa farmlands in Ghana. Extraction and cleanup of analytes were performed by use of a method based on the original QuEChERS procedure after optimizing salts...

  11. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  12. Organochlorine pesticides in lacustrine sediments and tilapias of Metztitlan, Hidalgo, Mexico.

    Science.gov (United States)

    Fernández-Bringas, Laura M; Ponce-Vélez, Guadalupe; Calva, Laura G; Salgado-Ugarte, Isaías Hazamamberth; Botello, Alfonso V; Díaz González, Gilberto

    2008-09-01

    The organochlorine pesticides (OP) are very stable molecules, due to this stability; they are very resistant in the environment and highly related to fat tissues with a wide diffusion property and an average time life higher then 10 years. We studied sediments (November 2001, April and June 2002) and organisms collected in April and July (2002) from the lacustric zone of Metzitlán, Hidalgo, Mexico. The analysis was performed according to UNEP/IAEA (1982) (sediments) and UNEP/FAO/IOC/IAEA (1986) (organisms) methods. Three chemical families of organochlorine pesticides were identified and analyzed to determine posible toxicological risk. The principal organochlorine compounds found in sediments were gamma-HCH, delta-HCH, p,p'-DDT and the endosulfan sulfate; these xenobiotics come from agriculture lands near the river and lake, used intensively, and most probably carried by the rain and rain flows into the main water body. In the tilapias tissue, p,p'-DDD y delta-HCH were detected. The average concentrations of organochlorine pesticides in sediments were within the internacional limits for freshwater benthonic fauna, although lindane (gamma-HCH) was near the limit. The fish were above the criteria established in the local legislation (NOM-027-SSA1-1993 y NOM-028-SSA1-1993).

  13. Organochlorine pesticides in lacustrine sediments and tilapias of Metztitlan, Hidalgo, Mexico

    International Nuclear Information System (INIS)

    Fernandez-Bringas, Laura M.; Ponce-Velez, Guadalupe; Botello, Alfonso V.; Calva B, Laura G.; Salgado-Ugarte, Isaias Hazamamberth; Diaz Gonzalez, Gilberto

    2008-01-01

    The organochlorine pesticides (OP) are very stable molecules, due to this stability; they are very resistant in the environment and highly related to fat tissues with a wide diffusion property and an average time life higher than 10 years. Sediments were studied in November 2001, April and June 2002 and organisms collected in April and July 2002, from the lacustric zone of Metzitlan, Hidalgo, Mexico. The analysis was performed according to UNEP/IAEA (1982) (sediments) and UNEP/FAO/IOC/IAEA (1986) (organisms) methods. Three chemical families of organochlorine pesticides were identified and analyzed to determine possible toxicological risk. The principal organochlorine compounds found in sediments were γ-HCH, δ-HCH, p,p'-DDT and the endosulfan sulfate; these xenobiotics come from agriculture lands near the river and lake, used intensively, and most probably carried by the rain and rain flows into the main water body. The p,p'-DDD and δ-HCH were detected in the tilapias tissue. The average concentrations of organochlorine pesticides in sediments were within the international limits for freshwater benthic fauna, although lindane, γ-HCH, was near the limit. The fish was above the criteria established in the local legislation (NOM-027-SSA1-1993 y NOM-028-SSA1-1993). (author)

  14. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  15. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    International Nuclear Information System (INIS)

    Weston, D.P.; Asbell, A.M.; Hecht, S.A.; Scholz, N.L.; Lydy, M.J.

    2011-01-01

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: → Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. → Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. → Two creeks contained concentrations acutely lethal to sensitive invertebrates. → Bifenthrin was of greatest concern, though less than in prior studies. → Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  16. Degradation dynamics of the insecticide: clothianidin (Dantop 50 % WDG) in a tea field ecosystem.

    Science.gov (United States)

    Chowdhury, Sutapa; Mukhopadhyay, Soumyadeep; Bhattacharyya, Anjan

    2012-08-01

    The fate of clothianidin [(E)-1-(2-chloro-1, 3-thiazol-5-ylmethyl)-3-methyl-2-nitroguanidine] applied to tea plant was studied at two location in West Bengal, India. The insecticide was applied in Tea field at two doses @30 and 60 g.a.i./ha during June-July 2009. Solid-phase extraction and liquid-liquid extraction was employed for the determination of this insecticide in tea samples. Clothianidin residues were analyzed and estimated quantitatively by HPLC at λ(max) 250 nm. The observed half life values of made tea and green tea leaf ranges from 3.71 to 4.07 days and 4.07 to 4.49 days respectively.

  17. Bioaccumulation of organochlorine pollutants in the fish community in Lake Arungen, Norway

    International Nuclear Information System (INIS)

    Sharma, Chhatra Mani; Rosseland, Bjorn Olav; Almvik, Marit; Eklo, Ole Martin

    2009-01-01

    Organochlorine pollutants in the major fish species (pike Esox lucius, perch Perca fluviatilis, and roach Rutilus rutilus) of Lake Arungen, Norway, were investigated after an extensive removal of large pike in 2004. The organochlorine pollutants detected in fish liver samples in 2005 were dichlorodiphenyltrichloroethane (DDTs), polychlorinated biphenyls (PCBs), hexachlorobenzene (HCB), and heptachlor epoxide (HCE). DDTs were the dominant among all analyzed OCs. ΣPCB and HCB, detected in fish from two clearly distinct trophic levels (prey and predators), give an indication of biomagnification. All OC concentrations in female pike were significantly lower compared to males, which might be due to the removal of high concentrations of pollutants in roe during spawning. - Organochlorine pollutants in fish tissues tend to magnify up the food chain

  18. Knowledge and perceptions about indoor residual spray for malaria ...

    African Journals Online (AJOL)

    Background: Malaria control and intervention tools usage and coverage in community depend on community acceptability and compliance. Indoor residual spray (IRS) and long lasting insecticide treated nets (LLINs) are the preferred and recommended intervention tools. This study assessed the knowledge and perceptions ...

  19. Effect of two organophosphorus insecticides on the growth, respiration and (14C)-glucose metabolism of Azobacter chroococcum Beij

    International Nuclear Information System (INIS)

    Balasubramanian, A.; Narayanan, R.

    1980-01-01

    The two organophosphorus insecticides, commonly applied to soil, viz., disulfoton (0,0-diethyl S-2-ethyl thio ethyl phosphorodithioate) and fensulfothion (0,0-diethyl 0-4-methyl sulphinyl phenyl phosphorothioate) did not affect the in vitro growth of Azotobacter chroococcum Beij., the free-living, nitrogen fixing soil bacterium, at 2 ppm (lower level), while the normal dose (5 ppm) and the higher level (10 ppm) suppressed the growth. Respiration of the organism (glucose oxidation) was adversely affected by the insecticides in the growth medium and the inhibition increased with the concentration of the chemical. Both the insecticides suppressed the assimilation of ( 14 C)-glucose in the cold-TCA soluble, hot-TCA soluble fractions and insoluble residue of the cells whereas the 14 C-incorporation in the alcohol soluble and alcohol-ether soluble fractions was enhanced indicating that the insecticides considerably altered the glucose metabolism of the bacterium. (author)

  20. Acute Toxicity of Fresh and Aged Residues of Pesticides to the Parasitoid Tamarixia radiata and to the HLB-Bacteria Vector Diaphorina citri.

    Science.gov (United States)

    Beloti, V H; Alves, G R; Moral, R A; Demétrio, C G B; Yamamoto, P T

    2018-06-01

    One method for controlling the Asian citrus psyllid (ACP) Diaphorina citri Kuwayama, the vector of the putative causal agent of Huanglongbing, uses the parasitoid Tamarixia radiata (Waterston). However, the general intensive use of insecticides has reduced the numbers of this parasitoid. This study evaluated the effect of the residual action of 24 insecticides on T. radiata and also determined the differential toxicity of insecticides to D. citri and T. radiata, using three bioassays. In the first, when adults of the parasitoid were exposed to residues of the 24 insecticides, ten were considered short-life (class 1), six slightly persistent (class 2), five moderately persistent (class 3), and three insecticides were considered persistent (class 4), under the IOBC/WPRS classification system. The second bioassay evaluated the sublethal concentrations of the persistent insecticides (formetanate, dimethoate, spinosad). Increasing the concentrations of the insecticides increased the number that were classified as persistent. In the third bioassay, evaluation of the differential toxicity of eight insecticides to the ACP and the parasitoid showed that chlorpyrifos and bifenthrin were more harmful to T. radiata. Therefore, these two insecticides are not recommended for application at the time of parasitoid release. Cypermethrin, imidacloprid, and dimethoate caused higher mortality of D. citri and are most often recommended in IPM programs. The choice of an insecticide for the control of citrus pests must be made with care, aiming to preserve the natural enemies in the ecosystem, and thereby contribute to the success of biological control.

  1. Concentration of organochlorines in human brain, liver, and adipose tissue autopsy samples from Greenland

    DEFF Research Database (Denmark)

    Dewailly, Éric; Mulvad, Gert; Pedersen, Henning S.

    1999-01-01

    Organochlorines are persistent lipophilic compounds that accumulate in Inuit people living in circumpolar countries. Organochlorines accumulate as a result of the Inuits' large consumption of sea mammal fat; however, available data are limited to blood lipids, milk fat, and adipose tissue. We rep...

  2. Assessment of persistence and residue of diazinon and malathion in three rivers (Mond, Shahpour and Dalaky of Bushehr Province 2004-2005

    Directory of Open Access Journals (Sweden)

    Mansooreh Shayeghi

    2007-09-01

    Full Text Available Background: Water contamination due to insecticides, often generates dangerous results for consumers. Immoderate consumption of insecticides in neighboring farms contaminates rivers. Assessment of residue of phosphorus insecticides which are used in farms near rivers can play a key role in preventing probable poisonings and aquatic ecosystems polution. Methods: In this case control study, water of three permanent rivers in Bushehr province and urban water pipe network of Bushehr city were assessed in different months in 2004-2005 and 216 samples were collected on the whole. In each river,three stations were used for sampling. After the sampling, extraction processes were accomplished using solvents such as: acetone, methylen-chloride and benzene. For detection and measurement of TLC Scanner apparatus was used. Results: Residues of diazinon and malathion were found in water of the three rivers in spring and summer. And in other seasons the rate of residues were very low or zero. The statistical analysis of the results through one-sidedanalysis variance, showed that diazinon and malathion residues in the water of the surveyed rivers in different months had significant difference (p 0.05, while malathion residue was significant (p <0.05. Conclusion: In the first and second months after applying the two insecticides, their residues level in all three rivers of Mond, Shahpour and Dalaky are more than acceptable contamination level, the higher levels belong to diazinon. Precautions must be considered in using the water for drinking purposes and also using aquatic foods which are provided from these rivers.

  3. Organochlorine pesticide levels in umbilical cord blood of newborn in Veracruz, Mexico.

    Science.gov (United States)

    Herrero-Mercado, Margarita; Waliszewski, S M; Caba, M; Martínez-Valenzuela, C; Hernández-Chalate, F

    2010-10-01

    Organochlorine pesticides accumulate in lipid rich compartments of organisms. During pregnancy, the compounds pass through the placental barrier appear in cord blood. The aim of this study was to monitor the levels of organochlorine pesticides in 70 umbilical cord blood samples taken during deliveries in Veracruz in 2009. For organochlorine pesticides, only the presence β-HCH (4%, 3.9 μg/L median concentration on wet weight), pp'DDE (100%, 0.7 μg/L) and pp'DDT (4%, 1.4 μg/L) were detected. The total pool of samples divided according to sex of new born babies, showed no statistical differences among median concentrations. The number of deliveries considered as a determinant contamination factor affirmed there were no statistical differences among median concentrations; however pp'DDE levels increased from the one to two childbirth groups. Age of pregnant women as a discriminate factor manifests in a significant increase in contamination levels among first, second and third tertile. In general, umbilical cord blood samples in Veracruz contained organochlorine pesticides, especially pp'DDE, confirming the presence of these compounds in the environment and their transfer from the mother to the developing fetus.

  4. Persistence of organochlorine chemical residues in fish from the Tombigbee River (Alabama, USA): Continuing risk to wildlife from a former DDT manufacturing facility

    International Nuclear Information System (INIS)

    Hinck, Jo Ellen; Norstrom, Ross J.; Orazio, Carl E.; Schmitt, Christopher J.; Tillitt, Donald E.

    2009-01-01

    Organochlorine pesticide and total polychlorinated biphenyl (PCB) concentrations were measured in largemouth bass from the Tombigbee River near a former DDT manufacturing facility at McIntosh, Alabama. Evaluation of mean p,p'- and o,p'-DDT isomer concentrations and o,p'- versus p,p'-isomer proportions in McIntosh bass indicated that DDT is moving off site from the facility and into the Tombigbee River. Concentrations of p,p'-DDT isomers in McIntosh bass remained unchanged from 1974 to 2004 and were four times greater than contemporary concentrations from a national program. Total DDT in McIntosh bass exceeded dietary effect concentrations developed for bald eagle and osprey. Hexachlorobenzene, PCBs, and toxaphene concentrations in bass from McIntosh also exceeded thresholds to protect fish and piscivorous wildlife. Whereas concentrations of DDT and most other organochlorine chemicals in fish have generally declined in the U.S. since their ban, concentrations of DDT in fish from McIntosh remain elevated and represent a threat to wildlife. - DDT persists in the environment near a former manufacturing facility that ceased production over 40 years ago, and concentrations represent a risk to fish and piscivorous birds in the area

  5. Pesticide residue assessment in three selected agricultural production systems in the Choluteca River Basin of Honduras

    International Nuclear Information System (INIS)

    Kammerbauer, J.; Moncada, J.

    1999-01-01

    There is a basic lack of information about the presence of pesticide residues in the environment in Central America. Over the period of February 1995 to June 1997, river, well, lagoon and spring water samples, as well as soil, fish tissue, lagoon bed sediments and some foodstuffs were taken from the greater Cholutecan River Basin of Honduras and analyzed for pesticide residues. These were collected at three separate sites (La Lima, Zamorano and Choluteca), each characterized by differing agricultural production systems. The main pesticide residues found in soil samples were dieldrin and p,p'-DDT, while river water samples were found to have detectable levels of heptachlor, endosulfan and chlorpyrifos, with lagoon and well water also being shown to contain heptachlor. These pesticides detected were in more than 20% of the samples assessed. In river water samples more pesticide residues at higher concentrations were found to be associated with areas of more intensive agricultural production. The fewest pesticides with lowest concentrations were found in the small subwatershed associated with traditional agricultural production. Although the pesticides found in the soils at the three sites were generally similar they tended to be higher in the southern part of the Cholutecan watershed, followed by the central zone, with the lowest concentrations being found in the more traditional production zone. In lagoon and well water samples more pesticides, but mostly in lower concentrations were detected at the traditional production site than at the others. Ten pesticide compounds were detected in fish tissue, mainly organochlorines, some of which were also found in lagoon sediments. In terms of food products, almost no pesticides were detected in vegetables, but the kidney adipose tissue taken from slaughtered cows was shown to have a tendency to contain some organochlorines. Spring water in the traditional agricultural production zone contained three organochlorine compounds

  6. Smoking as a Determinant of High Organochlorine Levels in Greenland

    DEFF Research Database (Denmark)

    Deutch, Bente; Pedersen, Henning Sloth; Bonefeld-Jørgensen, Eva Cecilie

    2003-01-01

    diet, and smoking or plasma cotinine in multiple linear-regression models (p smoking status. These findings confirm that the source of POPs among the Inuit in Greenland is diet, but smoking......The authors investigated the accumulation of organochlorines among smoking and nonsmoking Inuit hunters (n = 48) in Uummanaq, Greenland, a population with high dietary exposure to persistent organic pollutants (POPs). Human plasma organochlorine levels were positively correlated with age, marine...... is an important determinant of POP bioaccumulation. Smoking cessation may provide a means to lower the body burden of POPs....

  7. Phytoremediation of organochlorine and pyrethroid pesticides by aquatic macrophytes and algae in freshwater systems.

    Science.gov (United States)

    Riaz, Ghazala; Tabinda, Amtul Bari; Iqbal, Shakir; Yasar, Abdullah; Abbas, Mateen; Khan, Abdul Muqeet; Mahfooz, Yusra; Baqar, Mujtaba

    2017-10-03

    Extensive use of Pesticides in agriculture and its surface runoff in river water is a major environmental concern. The present study evaluated the phytoremediation potential of Eichornia crassipes, Pistia strateotes and algae (Chaetomorpha sutoria, Sirogonium sticticum and Zygnema sp.) for organochlorine and pyrethroid pesticides. Water and plant samples were extracted by liquid phase and solid phase extraction respectively and analyzed by high-performance liquid chromatography. Eleven treatments (T1-T11) with and without plants were used for phytoremediation of organochlorine and pyrethroid pesticides. During the experiment, P. strateotes, E. crassipes and algae (C. sutoria, S. sticticum and Zygnema sp.) showed the highest removal efficiency with 62 (71% root, 29% shoot), 60 (67% root, 33% shoot), and 58% respectively for organochlorine and 76 (76% root, 24% shoot), 68 (69% root, 31% shoot), and 70% respectively for pyrethroids for the respective aquatic plants. Dissipation rate constant of treatments with plants (T2, T3, T5, T6, T8, and T9) was significantly higher (p < 0.05) as compared to that of treatments without plants (T10 and T11, control) for both organochlorine and pyrethroid. The bioconcentration factor of pyrethroid treatments (T3, T6, and T9) was significantly higher (p < 0.05) as compared to that of organochlorine treatments (T2, T5 and T8). The removal efficiency of E. crassipes, P. strateotes and algae (C. sutoria, S. sticticum and Zygnema sp.) for pyrethroids was significantly higher (p < 0.01) as compared to that of organochlorine.

  8. Soil application of neonicotinoid insecticides for control of insect pests in wine grape vineyards.

    Science.gov (United States)

    Van Timmeren, Steven; Wise, John C; Isaacs, Rufus

    2012-04-01

    Soil application of systemic neonicotinoid insecticides can provide opportunities for long-term control of insect pests in vineyards, with minimal risk of pesticide drift or worker exposure. This study compared the effectiveness of neonicotinoid insecticides applied via irrigation injection on key early-season and mid-season insect pests of vineyards in the eastern United States. On vines trained to grow on drip irrigation, early-season application of imidacloprid, clothianidin, thiamethoxam and dinotefuran provided high levels of control against the potato leafhopper, Empoasca fabae. Protection of vines against Japanese beetle, Popillia japonica, and grape berry moth, Paralobesia viteana, was also observed after mid-season applications. Efficacy was poor in commercial vineyards when treatments were applied to the soil before irrigation or rain, indicating that vines must be grown with an irrigation system for efficient uptake of the insecticide. In drip-irrigated vineyards, soil-applied neonicotinoids can be used to provide long residual control of either early-season or mid- to late-season foliage pests of vineyards. This approach can reduce the dependence on foliar-applied insecticides, with associated benefits for non-target exposure to workers and natural enemies. Copyright © 2012 Society of Chemical Industry.

  9. Fate of the organophosphorus insecticide methoxy-14 C-Azinphos-methyl in baladi egyptian goats

    International Nuclear Information System (INIS)

    Hamdy, N.A.; Fakhr, I.M.I.; Abdalla, E.A.M.; Fouzy, A.S.M.; Hassan, M.N.A.

    1998-01-01

    Consecutive feeding of lactating goats with methoxy- 14 C-azinphos-methyl fo 4 days at dietary levels of 25 mg and 50 mg/goat per day resulted in the presence 0 the insecticide residues in milk 0.028ppm, 0.068ppm respectively at the end of the administration period. The residue levels were marckedly reduced after a withdrawa period of one week and completely disappeared after two weeks. Analysis of milk an urine residues showed similar metabolites in addition to a very small amount of the parent compound in the milk only. The major part of the residues consisted of mon demethylatedl azinophos-methyl, dimethyl phosphorohthioic, dimethyl phosphoro dithioic acids, dimethyl and mono-methyl phosphates. The animals remaine symptoms-frce during the experimental period

  10. Efficiency of the refining processes in removing 14C-dichlorvos residues in soybean oil

    International Nuclear Information System (INIS)

    Soliman, S.M.

    2006-01-01

    Crude soybean oil extracted from grains treated with 14 C-dichlorvos at a dose 24 mg insecticide / kg seeds and stored for 30 weeks was subjected to different refining processes such as alkali treatment, bleaching, winterization and deodorization. The effect of the refining processes on the nature and magnitude of the originally present residues was investigated. The insecticide residues in crude oil and cake amounted to 9.5% and 55% , respectively, of original residues inside the seeds. Extraction of the seeds with hexane gave crude oil with 9.5 % of original residues in seeds. The l4 C-activity in the crude stored Soya beans oil could be reduced by about 82% of radioactivity originally present in crude oil eliminated by simulated commercial processes locally used for oil refining. A high percentage of the residues (50-55%) were eliminated during alkali treatment and bleaching. Refining of soybeans oil fortified with '1 4 C-dichlorovos. The final refined oil had only 13% of the radioactivity originally present, mainly in the form of dichlorvos, dimethyl and monomethyl phosphate in addition to desmethyl dichlorvos in oil with aged residues

  11. Egg Hatch Rate and Nymphal Survival of the Bed Bug (Hemiptera: Cimicidae) After Exposure to Insecticide Sprays.

    Science.gov (United States)

    Hinson, K R; Benson, E P; Zungoli, P A; Bridges, W C; Ellis, B R

    2016-12-01

    Few studies have addressed the efficacy of insecticides used against eggs and first-instar nymphs of the bed bug, Cimex lectularius L. (Hemiptera: Cimicidae). Insect eggs are often resistant to insecticides; therefore, information on which products are effective is important. We evaluated the efficacy of four commonly used insecticide sprays applied directly to bed bug eggs. We also evaluated the efficacy of these insecticides to first-instar nymphs exposed to residuals resulting from directly spraying eggs. Temprid SC (beta-cyfluthrin, imidacloprid) was the most effective insecticide at preventing egg hatch (13% hatch rate) for pyrethroid-resistant, field-strain (Jersey City) bed bugs compared with a control (water [99% hatch rate]), Bedlam (MGK-264, sumithrin [84% hatch rate]), Demand CS (lambda-cyhalothrin [91% hatch rate]), and Phantom SC (chlorfenapyr [95% hatch rate]). Demand CS and Temprid SC were most effective at preventing egg hatch (0%) for an insecticide-susceptible (Harold Harlan) strain, followed by Bedlam (28%). Phantom SC produced a hatch rate similar to the control (97% and 96%, respectively). Harold Harlan-strain nymphs showed 100% survival for the control but 0% survival for Bedlam and Phantom SC. Jersey City-strain nymphs showed 100% survival for the control, 99% survival for Bedlam, 0% survival for Demand CS, 4% survival for Phantom SC, and 38% survival for Temprid SC. Demand CS was less effective at preventing hatch (91% hatch rate) of Jersey City-strain nymphs but was the only product to kill all nymphs (0% survival). One of the least effective products for preventing Jersey City-strain egg hatch (Phantom SC, 95% hatch rate) was the second most effective at killing nymphs, leaving only six of 141 alive. These findings indicate that survival of directly sprayed eggs and residually exposed, first-instar nymphs varies by strain, life stage, and product used. © The Authors 2016. Published by Oxford University Press on behalf of Entomological

  12. Organochlorine pesticides and polychlorinated biphenyls in various tissues of waterbirds in Nalabana bird sanctuary, Chilika Lake, Orissa, India.

    Science.gov (United States)

    Dhananjayan, V

    2012-07-01

    In order to understand whether organochlorine pesticides and polychlorinated biphenyls (PCBs) are responsible for the mortality of waterbirds in Nalaban bird sanctuary in Chilika Lake, the current investigation was carried out in tissues of 11 individuals comprising 7 species of birds. One or more residues were detected in all the tissues of birds analysed. Concentration of ∑HCH, ∑DDT, and ∑PCBs were ranged from below detectable level (BDL)-811 ng/g, BDL-1,987 ng/g and BDL-1,027 ng/g respectively. PCBs levels were less than the food and drug administration's (FDA) action limits. Although varying levels of residues were detected among tissues, they do not appear to be responsible for the mass mortality of waterfowl. However, the need for additional research is heightened when considering that some of the birds are classified as a globally protected species by the international bodies.

  13. Residual mosquito barrier treatments on U.S. military camouflage netting in a southern California desert environment

    Science.gov (United States)

    Treating perimeters of vegetation with residual insecticides for protection from mosquito vectors has potential for U.S. military force health protection. However, for current U.S. military operations in hot-arid environments with little or no vegetation, residual applications on portable artificial...

  14. Níveis de resíduos de praguicidas organoclorados em produtos cárneos sob inspeção federal Levels of organochlorine pesticide residue in meat products inspected by the federal government

    Directory of Open Access Journals (Sweden)

    João Pessoa de Paula Carvalho

    1980-09-01

    Full Text Available Com objetivo de evidenciar a freqüência e os níveis de resíduos de praguiddas organoclorados, foram analisadas 445 unidades amostrais de matéria prima (gordura bovina provenientes de carcaças de bovinos de frigoríficos e 132 unidades amostrais de carne bovina já processada (enlatados, tais como "corned beef" e "roast beef". Apresentaram-se com resíduos de praguicidas acima dos limites de tolerância estipulados, 77 unidades amostrais de gordura bovina e 5 de produto processado. Resíduos de praguiddas, sem contudo ultrapassar os limites de tolerância, foram identificados em, praticamente, todas as amostras, sendo que 27% das unidades amostrais de gordura bovina e 10,6% de produto processado apresentaram resíduos de praguicidas em violação aos limites estabelecidos na legislação. Heptacloro, BHC e Dieldrin foram os praguiddas mais freqüentes e Lindane e DDT os menos evidenciados.To bring attention to the frequency and the levels of organochlorine pesticide residue in meat, 445 samples of raw material (bovine fat from bovine carcasses collected from meat packing plants and 132 samples of preserved meat (canned, such as corned or roast beef were analyzed. Seventy-seven samples of bovine fat and 8 of preserved meat were discovered to have pesticide residue above the maximum acceptable limits. Pesticide residue was found in practically all the samples without, however, exceeding the acceptable limits. Twenty-seven percent of the bovine fat samples and 10.6% of the preserved meat contained residue above the legal tolerance levels. Heptachlor, BHC, and Dieldrin were the most frequent; Lindane and DDT, the least.

  15. Proof of concept for a novel insecticide bioassay based on sugar feeding by adult Aedes aegypti (Stegomyia aegypti).

    Science.gov (United States)

    Stell, F M; Roe, R M; Arellano, C; Kennedy, L; Thornton, H; Saavedra-Rodriguez, K; Wesson, D M; Black, W C; Apperson, C S

    2013-09-01

    Aedes aegypti L. (Stegomyia aegypti) (Diptera: Culicidae) is the principal vector of dengue and yellow fever viruses in tropical and subtropical regions of the world. Disease management is largely based on mosquito control achieved by insecticides applied to interior resting surfaces and through space sprays. Population monitoring to detect insecticide resistance is a significant component of integrated disease management programmes. We developed a bioassay method for assessing insecticide susceptibility based on the feeding activity of mosquitoes on plant sugars. Our prototype sugar-insecticide feeding bioassay system was composed of inexpensive, disposable components, contained minimal volumes of insecticide, and was compact and highly transportable. Individual mosquitoes were assayed in a plastic cup that contained a sucrose-permethrin solution. Trypan blue dye was added to create a visual marker in the mosquito's abdomen for ingested sucrose-permethrin solution. Blue faecal spots provided further evidence of solution ingestion. With the sugar-insecticide feeding bioassay, the permethrin susceptibility of Ae. aegypti females from two field-collected strains was characterized by probit analysis of dosage-response data. The field strains were also tested by forced contact of females with permethrin residues on filter paper. Dosage-response patterns were similar, indicating that the sugar-insecticide feeding bioassay had appropriately characterized the permethrin susceptibility of the two strains. © 2012 The Royal Entomological Society.

  16. Anopheles coluzzii larval habitat and insecticide resistance in the island area of Manoka, Cameroon.

    Science.gov (United States)

    Etang, Josiane; Mbida Mbida, Arthur; Ntonga Akono, Patrick; Binyang, Jerome; Eboumbou Moukoko, Carole Else; Lehman, Leopold Gustave; Awono-Ambene, Parfait; Talipouo, Abdou; Ekoko Eyisab, Wolfgang; Tagne, Darus; Tchoffo, Romeo; Manga, Lucien; Mimpfoundi, Remy

    2016-05-20

    The effectiveness of Long-Lasting Insecticidal Nets and Indoor Residual Spraying in malaria vector control is threatened by vector resistance to insecticides. Knowledge of mosquito habitats and patterns of insecticide resistance would facilitate the development of appropriate vector control strategies. Therefore, we investigated An. coluzzii larval habitats and resistance to insecticides in the Manoka rural island area compared with the Youpwe suburban inland area, in Douala VI and II districts respectively. Anopheline larvae and pupae were collected from open water bodies in December 2013 and April 2014 and reared until adult emergence. Two to four day old emerging females were morphologically identified as belonging to the An. gambiae complex and used for WHO susceptibility tests with 4 % DDT, 0.75 % permethrin, and 0.05 % deltamethrin, with or without piperonyl butoxide (PBO) synergist. Control and surviving specimens were identified down to the species using a PCR-RFLP method. Survivors were genotyped for kdr L1014 mutations using Hot Oligonucleotide Ligation Assay. In both study sites, ponds, residual puddles, boats, and drains were identified as the major An. gambiae s.l. larval habitats. A total of 1397 females, including 784 specimens from Manoka and 613 from Youpwe, were used for resistance testing. The two mosquito populations displayed resistance to DDT, permethrin and deltamethrin, with variable mortality rates from 1 % to 90 %. The knock-down times were also significantly increased (at least 2.8 fold). Pre-exposure of mosquitoes to PBO did not impact on their mortality to DDT, conversely the mortality rates to permethrin and deltamethrin were significantly increased (7.56 ≤ X(2) ≤ 48.63, df = 1, p habitats have been identified, larval source management strategies may be trialed in this area as complementary vector control interventions.

  17. Laboratory Evaluation of the Toxicity of Systemic Insecticides to Emerald Ash Borer Larvae.

    Science.gov (United States)

    Poland, Therese M; Ciaramitaro, Tina M; McCullough, Deborah G

    2016-04-01

    Emerald ash borer (Agrilus planipennis Fairmaire) (Coleoptera: Buprestidae), an invasive phloem-feeding insect native to Asia, threatens at least 16 North American ash (Fraxinus) species and has killed hundreds of millions of ash trees in landscapes and forests. We conducted laboratory bioassays to assess the relative efficacy of systemic insecticides to control emerald ash borer larvae in winter 2009 and 2010. Second- and third-instar larvae were reared on artificial diet treated with varying doses of emamectin benzoate (TREE-äge, Arborjet, Inc., Woburn, MA), imidacloprid (Imicide, J. J Mauget Co., Arcadia, CA), dinotefuran (Safari, Valent Professional Products, Walnut Creek, CA), and azadirachtin (TreeAzin, BioForest Technologies, Inc., Sault Ste. Marie, Ontario, and Azasol, Arborjet, Inc., Woburn, MA). All of the insecticides were toxic to emerald ash borer larvae, but lethal concentrations needed to kill 50% of the larvae (LC50), standardized by larval weight, varied with insecticide and time. On the earliest date with a significant fit of the probit model, LC50 values were 0.024 ppm/g at day 29 for TREE-äge, 0.015 ppm/g at day 63 for Imicide, 0.030 ppm/g at day 46 for Safari, 0.025 ppm/g at day 24 for TreeAzin, and 0.027 ppm/g at day 27 for Azasol. The median lethal time to kill 50% (LT50) of the tested larvae also varied with insecticide product and dose, and was longer for Imicide and Safari than for TREE-äge or the azadirachtin products. Insecticide efficacy in the field will depend on adult and larval mortality as well as leaf and phloem insecticide residues.

  18. Insecticide Exposures on Commercial Aircraft: A Literature Review and Screening Level Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Maddalena, Randy I.; McKone, Thomas E.

    2008-10-01

    The objective of this project was to provide initial estimates of the relationship between insecticide use on passenger aircraft and exposure levels present in the cabin environment. The work was initially divided into three tasks including 1) a review of insecticide application practices in commercial aircraft, 2) exploratory measurements of insecticide concentrations in treated aircraft and 3) screening level exposure modeling. Task 1 gathered information that is needed to assess the time-concentration history of insecticides in the airline cabin. The literature review focused on application practices, information about the cabin environment and existing measurements of exposure concentrations following treatment. Information from the airlines was not available for estimating insecticide application rates in the U.S. domestic fleet or for understanding how frequently equipment rotate into domestic routes following insecticide treatment. However, the World Health Organization (WHO) recommends several methods for treating aircraft with insecticide. Although there is evidence that these WHO guidelines may not always be followed, and that practices vary by airline, destination, and/or applicator company, the guidelines in combination with information related to other indoor environments provides a plausible basis for estimating insecticide loading rates on aircraft. The review also found that while measurements of exposure concentrations following simulated aerosol applications are available, measurements following residual treatment of aircraft or applications in domestic aircraft are lacking. Task 2 focused on developing an approach to monitor exposure concentrations in aircraft using a combination of active and passive sampling methods. An existing active sampling approach was intended to provide data immediately following treatment while a passive sampler was developed to provide wider coverage of the fleet over longer sampling periods. The passive sampler, based

  19. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  20. Effect of two organophosphorus insecticides on the growth, respiration and (/sup 14/C)-glucose metabolism of Azobacter chroococcum Beij

    Energy Technology Data Exchange (ETDEWEB)

    Balasubramanian, A; Narayanan, R [Tamil Nadu Agricultural Univ., Coimbatore (India)

    1980-01-01

    The two organophosphorus insecticides, commonly applied to soil, viz., disulfoton (0,0-diethyl S-2-ethyl thio ethyl phosphorodithioate) and fensulfothion (0,0-diethyl 0-4-methyl sulphinyl phenyl phosphorothioate) did not affect the in vitro growth of Azotobacter chroococcum Beij., the free-living, nitrogen fixing soil bacterium, at 2 ppm (lower level), while the normal dose (5 ppm) and the higher level (10 ppm) suppressed the growth. Respiration of the organism (glucose oxidation) was adversely affected by the insecticides in the growth medium and the inhibition increased with the concentration of the chemical. Both the insecticides suppressed the assimilation of (/sup 14/C)-glucose in the cold-TCA soluble, hot-TCA soluble fractions and insoluble residue of the cells whereas the /sup 14/C-incorporation in the alcohol soluble and alcohol-ether soluble fractions was enhanced indicating that the insecticides considerably altered the glucose metabolism of the bacterium.

  1. Exposure of women to organochlorine pesticides in Southern Spain

    International Nuclear Information System (INIS)

    Botella, B.; Crespo, Jorge; Rivas, Ana; Cerrillo, Isabel; Olea-Serrano, M.F.; Olea, N.

    2004-01-01

    Organochlorine pesticides are lipophilic compounds that persist in the environment. Because of their lipid solubility and resistance to metabolism, some of these chemicals accumulate in human tissues. The largest area of intensive greenhouse agriculture in Europe is near the Mediterranean coast of Southern Spain, where this type of farming has greatly expanded since the 1960s. We determined and compared the levels of 15 organochlorine pesticides in the adipose tissue and blood of 200 women living in Southern Spain. Aldrin, dieldrin, endrin, lindane, methoxychlor, endosulfans, and DDT and its metabolites were identified. Detectable concentrations of p,p'-DDE were found in 100% of adipose tissue and serum samples. Among the remaining DDTs, p,p'-DDT was the most common, being detected in 39% of adipose tissue and 76.5% of serum samples, followed by endosulfans I and II, which also were found in both adipose tissue and serum samples but at lower concentrations. Endosulfans were followed in frequency by lindane, aldrin, and dieldrin. Endrin and methoxychlor were present at a much lower frequency compared to those of the other organochlorines. Serum concentrations of p,p'-DDE o,p'-DDD, and endosulfan -I, -sulfate, -lactone, and -diol were significantly correlated with their adipose tissue concentrations. No significant relationships were found between the serum and adipose tissue concentrations of the remaining nine compounds determined, raising doubts about the equivalent use of fat/serum samples for the exposure assessment of some pesticides in epidemiological studies. The results suggested that women of reproductive age in Southern Spain have been and are currently exposed to organochlorine pesticides. Because many of these chemicals can mobilize during pregnancy and lactation, further research is warranted to interpret the health consequences for the children of such exposure

  2. Evaluation of Environmental Risks in the Use of Insecticide in Hashtgerd Area using EIQ

    Directory of Open Access Journals (Sweden)

    seyae jala yadollahi Nooshabadi

    2018-02-01

    Full Text Available Introduction Recently, there is an increasing concern about the effects of pesticides on non-target organisms. Residual of pesticides cause environmental pollution and put in danger the human health. The problem is always in contact with pesticides, there are numerous risks related to the environmental and human health threat at different levels of their cycle, including production, sale, use in the field and ultimately for residue in food occurs. This study consider the harmful effects of pesticides in Hashtgerd study area and their potential and environmental risks using EIQ index. Environmental Impact Quotient (EIQ is a model based on algebraic equations which by it can be classification chemical pesticides based on environmental hazards and risks to human health and toxins that cause minimal risk are selected. The ultimate purpose of this study was to determine 5 insecticide have been the highest consumption in the region Hashtgerd and then determine the potential environmental risks of them by EIQ index, so that eventually we can identify and eliminate hazardous insecticides. Materials and Methods Hashtgerd study area is one of 609 countries study area that is located in the Alborz province. This area with an extent of about 1170 square km because of the proximity to the metropolis of Tehran and focus a large number of agricultural, industrial and service units has an important economic and political position. The numerical value of the EIQ is average of the three main components include of the potential damage to the health of farm workers, the potential damage to consumers through the direct effect of toxic residues in food products or through ground water contamination and potential negative effects on the environment, including aquatic and terrestrial organisms show. The describes components of the EIQ are contains 11 variables. All input data for the impact of low, medium and high are judged to be harmful than, the one, three or five

  3. Insecticide exposure affects DNA and antioxidant enzymes activity in honey bee species Apis florea and A. dorsata: Evidence from Punjab, Pakistan.

    Science.gov (United States)

    Hayat, Khizar; Afzal, Muhammad; Aqueel, Muhammad Anjum; Ali, Sajjad; Saeed, Muhammad Farhan; Khan, Qaiser M; Ashfaq, Muhammad; Damalas, Christos A

    2018-04-23

    Insecticide exposure can affect honey bees in agro-ecosystems, posing behavioral stresses that can lead to population decline. In this study, insecticide incidence, DNA damage, and antioxidant enzyme activity were studied in Apis florea and A. dorsata honey bee samples collected from insecticide-treated and insecticide-free areas of Punjab, Pakistan. Seven insecticides: chlorpyrifos, dimethoate, imidacloprid, phorate, emamectin, chlorfenapyr, and acetamiprid were detected in seven samples of A. florea and five samples of A. dorsata. In total, 12 samples (22.2%) of honey bees were found positive to insecticide presence out of 54 samples. The most frequently detected insecticide was chlorpyrifos, which was found in four samples (7.4%), with a concentration ranging from 0.01 to 0.05 μg/g and an average concentration 0.03 μg/g. The comet assay or single cell gel electrophoresis assay, a simple way to measure DNA strand breaks in eukaryotic cells, was used to microscopically find damage of DNA at the level of a single cell. Comet tail lengths of DNA in A. florea and A. dorsata samples from insecticide-treated areas were significantly higher (P honey bee samples from insecticide-treated and insecticide-free areas, while glutathione S-transferase (GST) activity showed a significant reduction in response to insecticide exposure. Significant positive correlations were detected between enzyme activity and insecticide concentration in honey bee species from insecticide-treated areas compared with control groups. Toxicity from pesticide exposure at sub-lethal levels after application or from exposure to pesticide residues should not be underestimated in honey bees, as it may induce physiological impairment that can decline honey bees' health. Copyright © 2018. Published by Elsevier B.V.

  4. Contact toxicity and residual effects of selected insecticides against the adult Paederus fuscipes (Coleoptera: Staphylinidae).

    Science.gov (United States)

    Bong, Lee-Jin; Neoh, Kok-Boon; Jaal, Zairi; Lee, Chow-Yang

    2013-12-01

    The contact toxicity of four insecticide formulations (deltamethrin, fipronil, fenitrothion, and imidacloprid) applied on three different substrates (tile, plywood, and concrete) against the adult rove beetle, Paederus fuscipes Curtis, was evaluated. The relative order of speed of killing effects was as follows: deltamethrin > imidacloprid > fipronil > fenitrothion. Although deltamethrin showed the fastest action against P. fuscipes, the recovery rate of rove beetles at 48 h posttreatment was moderate (approximately 25%) on the tile surface to high (approximately 80%) on the plywood surface. Thus, it is likely that the insects did not pick up the lethal dose especially on porous surfaces. In contrast, fipronil demonstrated delayed toxicity that might promote maximal uptake by the insects. More than 80% mortality was registered for tile and plywood surfaces up to 4 wk after exposure. High mortality (almost 100%) was recorded for imidacloprid-exposed P. fuscipes at 48 h posttreatment, but only on the tile surface. Among the four insecticides tested, fenitrothion was the least effective against P. fuscipes because low percentage to no mortality was recorded in the fenitrothion treatment.

  5. Residual Toxicity of Abamectin, Chlorpyrifos, Cyromazine, Indoxacarb and Spinosad on Liriomyza trifolii (Burgess (Diptera: Agromyzidae in Greenhouse Conditions

    Directory of Open Access Journals (Sweden)

    Ghasem Askari Saryazdi

    2012-01-01

    Full Text Available Liriomyza trifolii is an important pest of vegetable crops in many parts of the worldincluding Iran. In this study potted bean plants were sprayed with recommended fieldrates of abamectin, chlorpyrifos, cyromazine, indoxacarb and spinosad. To assess the residualactivities of these insecticides, the plants were infested with L. trifolii adults 2 hours; 1, 3,5, 7, 10, 15, 20, 25 and 35 days after insecticidal treatments. The adults were allowed to stayon treated plants for eight hours. The treated plants were kept in a greenhouse. Numberof feeding stipples and larval mines on leaves, as well as pupation and adult eclosion rateswere assessed. Two-way ANOVA procedure of SAS was used for statistical analysis andthe treatment means were separated using Duncan’s multiple range test. Abamectin andspinosad severely affected egg hatching and embryonic development. Eggs oviposited inleaves with residues of chlorpyrifos up to 5 days old, had reduced hatching. Larval developmentwas also, affected by residues of chlorpyrifos up to four weeks old. Indoxacarbreduced larval development and adult eclosion in treatments with up to 20 days old residues.Cyromazine had no effect on the number of larval mines, but, pupation was severelyhampered and adult eclosion was completely ceased even in treatments with five weeksold residues. Determining the residual activity of insecticides used for controlling this pestis useful in avoiding unnecessary treatments.

  6. Dietary biomagnification of organochlorine contaminants in Alaskan polar bears

    Science.gov (United States)

    Bentzen, T.W.; Follmann, Erich H.; Amstrup, Steven C.; York, G.S.; Wooller, M.J.; Muir, D.C.G.; O'Hara, T. M.

    2008-01-01

    Concentrations of organochlorine contaminants in the adipose tissue of polar bears (Ursus maritimus Phipps, 1774) vary throughout the Arctic. The range in concentrations has not been explained fully by bear age, sex, condition, location, or reproductive status. Dietary pathways expose polar bears to a variety of contaminant profiles and concentrations. Prey range from lower trophic level bowhead whales (Balaena mysticetus L., 1758), one of the least contaminated marine mammals, to highly contaminated upper trophic level ringed seals (Phoca hispida (Schreber, 1775)). We used ??15N and ??13C signatures to estimate the trophic status of 42 polar bears sampled along Alaska's Beaufort Sea coast to determine the relationship between organochlorine concentration and trophic level. The ?? 15N values in the cellular portions of blood ranged from 18.2% to 20.7%. We found strong positive relationships between concentrations of the most recalcitrant polychlorinated biphenyls (PCBs) and ??15N values in models incorporating age, lipid content, and ??13C value. Specifically these models accounted for 67% and 76% of the variation in PCB153 and oxychlordane concentration in male polar bears and 85% and 93% in females, respectively. These results are strong indicators of variation in diet and biomagnification of organochlorines among polar bears related to their sex, age, and trophic position. ?? 2008 NRC.

  7. Studies of pirimiphos-methyl residues in stored rice, using 14C-pirimiphos-methyl

    International Nuclear Information System (INIS)

    Varca, L.M.; Sanchez, T.E.; Gambalan, N.; Magallona, E.D.

    1990-01-01

    The distribution and persistence of pirimiphos-methyl on rice (hulled and unhulled) stored over a period of 6 months at 30 deg. C and about 11% moisture were studied using 14 C labelled insecticide. The procedures used for preparing the labelled formulation, applying the insecticide and for the handling and analysis of the grain samples were similar to those described for fenvalerate, see Varca, Sanchez and Magallona, ''Isotopic tracer aided studies of fenvalerate residues in stored products'', these Proceedings. After applying the pirimiphos-methyl, a concentration equal to 0.87 ppm was found on the hulled rice immediately after application; this concentration declined to 0.60 ppm after 6 months of storage. Over 28% of the residue was present in the seed in the methanol extractable form, and 38% was found on the surface at the end of the storage period. For the unhulled rice, most of the residue was retained in the hull with no decrease in the overall level during the storage period. (author)

  8. Insecticide resistance in the West African malaria vector Anopheles gambiae and investigation of alternative tools for its delay

    NARCIS (Netherlands)

    N'Guessan, R.

    2009-01-01

    There is a current policy to eliminate malaria in the African continent. Pyrethroid-incorporated Long Lasting Insecticidal Nets (LLINs) and/or Indoor Residual Spraying (IRS) are the chemical weapons being deployed to achieve that goal. Rather worryingly, resistance to pyrethroids is well documented

  9. Impact of residual spraying on Rhodnius prolixus and Triatoma dimidiata in the department of Zacapa in Guatemala

    Directory of Open Access Journals (Sweden)

    J Nakagawa

    2003-03-01

    Full Text Available As a vector control program to control Chagas disease in Guatemala, residual spraying of Rhodnius prolixus and Triatoma dimidiata was performed, and its impact was measured in the department of Zacapa. In order to identify infested villages and determine the degree of infestation, a baseline entomological survey to identify municipalities infested with vectors followed by an additional vector survey in areas known to be infested was conducted. Residual spraying using pyrethroid insecticides was performed at all the villages identified as being infested with the vectors. The residual spraying was shown to be highly effective against both vectors by the decrease in infestation indices after spraying. Analysis of the cost-effectiveness of the spraying showed that the average cost of insecticides per house is high when compared with that in Southern Cone countries.

  10. Fate of leptophos residues in milk products

    International Nuclear Information System (INIS)

    Zayed, S.M.A.D.; Mohammed, S.I.

    1981-01-01

    The fate of leptophos residues in various milk products was studied using 14 C-phenyl labelled leptophos. Milk products were prepared from milk fortified with the radioactive insecticide by methods simulating those used in industry. The highest leptophos level was found in butter and the lowest in skim milk and whey. Analysis of the radioactive residues in all products showed the presence of leptophos alone. A trace of the oxon could be detected in whey. The results obtained in this investigation indicated that processing of milk did not affect the nature of leptophos to any appreciable extent. (author)

  11. Organochlorine contaminant and retinoid levels in blubber of common dolphins (Delphinus delphis) off northwestern Spain

    International Nuclear Information System (INIS)

    Tornero, Victoria; Borrell, Assumpcio; Aguilar, Alex; Forcada, Jaume; Lockyer, Christina

    2006-01-01

    The effect of age, sex, nutritive condition and organochlorine concentration on blubber retinoid concentrations was examined in 74 common dolphins incidentally caught off northwestern Spain. Age and blubber lipid content were strong determinants of the retinoid concentrations in males, while these variables did not account for the variation found in females. Retinoids were positively correlated with organochlorines in males and negatively in females. However, pollution levels were moderate and likely to be below threshold levels above that a toxicological response is to be expected. Thus, a cause-effect relationship between organochlorine and retinoid concentrations could not be properly established, and the observed correlation may be the result of an independent association of the two variables with age. Further research on the influence of the best predictor variables on retinoid dynamics is required to implement the use of retinoids as biomarkers of pollutant exposure in cetaceans. - Organochlorine contaminants and retinoids in common dolphins

  12. Organochlorine concentrations in breast milk and risk assessment in the urban and rural areas of Northern China

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, J.H.; Sun, S.U. [Jichi Medical School, Tochigi (Japan). Dept. of Environmental Medicine, Center for Community Medicine]|[CREST-JST, Kawaguchi, Saitama (Japan); Koga, M. [Prefectural Univ. of Kumamoto (Japan). Fac. of Environmental and Symbiotic Sciences] (and others)

    2004-09-15

    In China, during the past 40 years, organochlorine pesticides (OPs) with impurity were produced and used in a large quantity. However, little is known on the OPs contamination status of the residents in mainland of China. To elucidate body burden of organochlorine compounds and factors associated with organochlorine levels of the residents in North China, we performed life style questionnaire and collected breast milk specimens at Shijiazhuang urban and Tangshan rural area, Hebei Province, North China.

  13. Soil-air exchange of organochlorine pesticides in the Southern United States

    International Nuclear Information System (INIS)

    Bidleman, Terry F.; Leone, Andi D.

    2004-01-01

    Soil samples were collected from 30 farms in Alabama, Louisiana and Texas during 1999-2000 to determine residues of organochlorine pesticides (OCPs). One or more of the DDT compounds (p,p'-DDT, o,p'-DDT, p,p'-DDD, p,p'-DDE, o,p'-DDE) was above the quantitation limit (0.1 ng g -1 dry weight) in every soil, and toxaphene was above the quantitation limit (3 ng g -1 ) in 26 soils. Chlordanes, dieldrin and hexachlorocyclohexane (HCH) isomers occurred less frequently (quantitation limits 0.1 ng g -1 for dieldrin and 0.05 ng g -1 for chlordanes and HCHs). OCPs were measured in air at 40 cm above the soil at selected farms to investigate soil-air partitioning. Concentrations of OCPs in air were positively and significantly (P s and f a ) for samples with quantifiable residues in both compartments. The fugacity fraction ((f s )/(f s +f a ))=0.5 at equilibrium and is 0.5 for net deposition and net volatilisation, respectively. Fugacity fractions varied greatly for different soil-air pairs, reflecting generally disequilibrium conditions. Mean fugacity fractions indicated near-equilibrium for some OCPs (p,p'-DDE, chlordanes, trans-nonachlor and dieldrin) and net volatilisation for others (p,p'-DDT, o,p'-DDT, toxaphene, γ-HCH). Chiral analysis showed that enantioselective degradation of (+) or (-) o,p'-DDT in soil was accompanied by enrichment or depletion of the corresponding enantiomers in the overlying air, although there appeared to be some dilution by racemic o,p'-DDT from regional air transport. - Old pesticide residues in agricultural soils continue to be emitted into the atmosphere

  14. Assessing the effects of urbanization on the environment with soil legacy and current-use insecticides: a case study in the Pearl River Delta, China.

    Science.gov (United States)

    Wei, Yan-Li; Bao, Lian-Jun; Wu, Chen-Chou; He, Zai-Cheng; Zeng, Eddy Y

    2015-05-01

    To evaluate the impacts of anthropogenic events on the rapid urbanized environment, the levels of legacy organochlorine pesticides (OCPs) and current-use insecticides (CUPs), i.e., dichlorodiphenyltrichloroethane and its metabolites (DDTs), hexachlorocyclohexanes (HCHs), pyrethroids and organophosphates in soil of the Pearl River Delta (PRD) and surrounding areas were examined. Spatial concentration distributions of legacy OCPs and CUPs shared similar patterns, with higher concentrations occurred in the central PRD with more urbanization level than that in the PRD's surrounding areas. Furthermore, relatively higher concentrations of OCPs and CUPs were found in the residency land than in other land-use types, which may be attributed to land-use change under rapid urbanization. Moderate correlations between gross domestic production or population density and insecticide levels in fifteen administrative districts indicated that insecticide spatial distributions may be driven by economic prosperity. The soil-air diffusive exchanges of DDTs and HCHs demonstrated that soil was a sink of atmospheric o,p'-DDE, o,p'-DDD, p,p'-DDD and o,p'-DDT, and was a secondary source of HCHs and p,p'-DDT to atmosphere. The soil inventories of DDTs and HCHs (100 ± 134 and 83 ± 70 tons) were expected to decrease to half of their current values after 18 and 13 years, respectively, whereas the amounts of pyrethroids and organophosphates (39 and 6.2 tons) in soil were estimated to decrease after 4 and 2 years and then increase to 87 and 1.0 tons after 100 years. In this scenario, local residents in the PRD and surrounding areas will expose to the high health risk for pyrethroids by 2109. Strict ban on the use of technical DDTs and HCHs and proper training of famers to use insecticides may be the most effective ways to alleviate the health effect of soil contamination. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Toxicity of nine insecticides on four natural enemies of Spodoptera exigua

    Science.gov (United States)

    Liu, Yongqiang; Li, Xiangying; Zhou, Chao; Liu, Feng; Mu, Wei

    2016-01-01

    Spodoptera exigua, which feeds on various crops worldwide, has natural enemies that are susceptible to the insecticides used against S. exigua. We investigate the toxicity and residue risk of 9 insecticides on the development of H. axyridis, C. sinica, S. manilae and T. remus. S. manilae and T. remus adults were sensitive to all 9 insecticides (LC50 less than 2.75 mg a.i. liter−1), while H. axyridis and C. sinica adults were less sensitive (LC50 between 6 × 10−5 mg a.i. liter−1 and 78.95 mg a.i. liter−1). Emamectin benzoate, spinosad, indoxacarb, alpha-cypermethrin, chlorfenapyr and chlorantraniliprole showed no toxicity on H. axyridis, C. sinica, S. manilae and T. remus pupae with the recommended field concentrations. The risk analysis indicated that chlorantraniliprole is harmless to larvae of four natural enemies and adult of H. axyridis, C. sinica and S. manilae. Emamectin benzoate and spinosad had higher safety to the development of H. axyridis, C. sinica, S. manilae and T. remus with the risk duration less than 4d. Indoxacarb, tebufenozide, chlorfenapyr, methomyl, alpha-cypermethrin and chlorpyrifos showed dangerously toxic and long risk duration on S. manilae and T. remus adults. PMID:27958333

  16. Toxicity of nine insecticides on four natural enemies of Spodoptera exigua.

    Science.gov (United States)

    Liu, Yongqiang; Li, Xiangying; Zhou, Chao; Liu, Feng; Mu, Wei

    2016-12-13

    Spodoptera exigua, which feeds on various crops worldwide, has natural enemies that are susceptible to the insecticides used against S. exigua. We investigate the toxicity and residue risk of 9 insecticides on the development of H. axyridis, C. sinica, S. manilae and T. remus. S. manilae and T. remus adults were sensitive to all 9 insecticides (LC 50 less than 2.75 mg a.i. liter -1 ), while H. axyridis and C. sinica adults were less sensitive (LC 50 between 6 × 10 -5  mg a.i. liter -1 and 78.95 mg a.i. liter -1 ). Emamectin benzoate, spinosad, indoxacarb, alpha-cypermethrin, chlorfenapyr and chlorantraniliprole showed no toxicity on H. axyridis, C. sinica, S. manilae and T. remus pupae with the recommended field concentrations. The risk analysis indicated that chlorantraniliprole is harmless to larvae of four natural enemies and adult of H. axyridis, C. sinica and S. manilae. Emamectin benzoate and spinosad had higher safety to the development of H. axyridis, C. sinica, S. manilae and T. remus with the risk duration less than 4d. Indoxacarb, tebufenozide, chlorfenapyr, methomyl, alpha-cypermethrin and chlorpyrifos showed dangerously toxic and long risk duration on S. manilae and T. remus adults.

  17. Bioaccumulation dynamics of polychlorinated biphenyls (PCBs) and organochlorine pesticides

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bioaccumulation dynamics of polychlorinated biphenyls (PCBs) and organochlorine pesticides was examined in young-of-the-year bluefish from seven sub-estuaries of New...

  18. Phosphate-solubility and phosphatase activity in Gangetic alluvial soil as influenced by organophosphate insecticide residues.

    Science.gov (United States)

    Majumder, Shyam Prasad; Das, Amal Chandra

    2016-04-01

    An experiment was conducted under laboratory conditions to investigate the effect of four organophosphate insecticides, viz. monocrotophos, profenophos, quinalphos and triazophos at their field application rates (0.75, 1.0, 0.5 and 0.6 kg a.i.ha(-1), respectively), on the growth and activities of phosphate solubilizing microorganisms in relation to availability of insoluble phosphates in the Gangetic alluvial soil of West Bengal, India. The proliferation of phosphate solubilizing microorganisms was highly induced with profenophos (38.3%), while monocrotophos exerted maximum stimulation (20.8%) towards the solubility of insoluble phosphates in soil. The phosphatase activities of the soil (both acid phosphatase and alkaline phosphatase) were significantly increased due to the incorporation of the insecticides in general, and the augmentation was more pronounced with quinalphos (43.1%) followed by profenophos (27.6%) for acid phosphatase, and with monocrotophos (25.2%) followed by profenophos (16.1%) for alkaline phosphatase activity in soil. The total phosphorus was highly retained by triazophos (19.9%) followed by monocrotophos (16.5%), while incorporation of triazophos and quinalphos manifested greater availability of water soluble phosphorus in soil. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Microemulsion-enhanced remediation of soils contaminated with organochlorine pesticides.

    Science.gov (United States)

    Zhang, Yanlin; Wong, Jonathan W C; Zhao, Zhenyong; Selvam, Ammaiyappan

    2011-12-01

    Soil contaminated by organic pollutants, especially chlorinated aromatic compounds such as DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane), is an environmental concern because of the strong sorption of organochlorine pesticide onto the soil matrix and persistence in the environment. The remediation of organochlorine pesticide contaminated soils through microemulsion is an innovative technology to expedite this process. The remediation efficiency was evaluated by batch experiments through studying the desorption of DDT and hexachlorocyclohexane (y-HCH) and sorption of microemulsion composed of Triton X-100, 1-pentanol and linseed oil in the soil-surfactant-water suspension system. The reduction of desorption efficiency caused by the sorption loss of microemulsion components onto the soil could be corrected by the appropriate adjustment of C/S (Cosurfactant/Surfactant) and O/S (Oil/Surfactant) ratio. The C/S and O/S ratios of 1:2 and 3:20 were suitable to desorb DDT and gamma-HCH from the studied soils because of the lower sorption of Triton X-100 onto the soil. Inorganic salts added in microemulsion increased the pesticides desorption efficiency of pesticides and calcium chloride has a stronger ability to enhance the desorption of DDT than sodium chloride. From the remediation perspective, the balance of surfactant or cosurfactant sorbed to soil and desorption efficiency should be taken into consideration to enhance the remediation of soils contaminated by organochlorine pesticides.

  20. ORGANOCHLORINE PESTICIDES IN THE AMBIENT AIR OF MEXICO

    Science.gov (United States)

    Recent and past use of organochlorine pesticides (OCPs) in Mexico has resulted in concentrations in ambient air that are 1-2 orders of magnitude above levels in the Great Lakes region. Atmospheric transport from Mexico and Central America may be contributing significant amounts ...

  1. Is Bone Mineral Composition Disrupted by Organochlorines in East Greenland Polar Bears (Ursus maritimus)?

    DEFF Research Database (Denmark)

    Sonne, C.; Dietz, R.; Born, E. W.

    2004-01-01

    We analyzed bone mineral density (BMD) in skulls of polar bears (Ursus maritimus) (n = 139) from East Greenland sampled during 1892-2002. Our primary goal was to detect possible changes in bone mineral content (osteopenia) due to elevated exposure to organochlorine [polychlorinated biphenyls (PCBs.......04) and SigmaCHL (p polar...... bears may have been caused by organochlorine exposure. Udgivelsesdato: 2004-Dec...

  2. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  3. Occurrence of Natural Bacillus thuringiensis Contaminants and Residues of Bacillus thuringiensis-Based Insecticides on Fresh Fruits and Vegetables

    Science.gov (United States)

    Frederiksen, Kristine; Rosenquist, Hanne; Jørgensen, Kirsten; Wilcks, Andrea

    2006-01-01

    A total of 128 Bacillus cereus-like strains isolated from fresh fruits and vegetables for sale in retail shops in Denmark were characterized. Of these strains, 39% (50/128) were classified as Bacillus thuringiensis on the basis of their content of cry genes determined by PCR or crystal proteins visualized by microscopy. Random amplified polymorphic DNA analysis and plasmid profiling indicated that 23 of the 50 B. thuringiensis strains were of the same subtype as B. thuringiensis strains used as commercial bioinsecticides. Fourteen isolates were indistinguishable from B. thuringiensis subsp. kurstaki HD1 present in the products Dipel, Biobit, and Foray, and nine isolates grouped with B. thuringiensis subsp. aizawai present in Turex. The commercial strains were primarily isolated from samples of tomatoes, cucumbers, and peppers. A multiplex PCR method was developed to simultaneously detect all three genes in the enterotoxin hemolysin BL (HBL) and the nonhemolytic enterotoxin (NHE), respectively. This revealed that the frequency of these enterotoxin genes was higher among the strains indistinguishable from the commercial strains than among the other B. thuringiensis and B. cereus-like strains isolated from fruits and vegetables. The same was seen for a third enterotoxin, CytK. In conclusion, the present study strongly indicates that residues of B. thuringiensis-based insecticides can be found on fresh fruits and vegetables and that these are potentially enterotoxigenic. PMID:16672488

  4. Monitoring the operational impact of insecticide usage for malaria control on Anopheles funestus from Mozambique

    Directory of Open Access Journals (Sweden)

    Sharp Brian L

    2007-10-01

    Full Text Available Abstract Background Indoor residual spraying (IRS has again become popular for malaria control in Africa. This combined with the affirmation by WHO that DDT is appropriate for use in the absence of longer lasting insecticide formulations in some malaria endemic settings, has resulted in an increase in IRS with DDT as a major malaria vector control intervention in Africa. DDT was re-introduced into Mozambique's IRS programme in 2005 and is increasingly becoming the main insecticide used for malaria vector control in Mozambique. The selection of DDT as the insecticide of choice in Mozambique is evidence-based, taking account of the susceptibility of Anopheles funestus to all available insecticide choices, as well as operational costs of spraying. Previously lambda cyhalothrin had replaced DDT in Mozambique in 1993. However, resistance appeared quickly to this insecticide and, in 2000, the pyrethroid was phased out and the carbamate bendiocarb introduced. Low level resistance was detected by biochemical assay to bendiocarb in 1999 in both An. funestus and Anopheles arabiensis, although this was not evident in WHO bioassays of the same population. Methods Sentinel sites were established and monitored for insecticide resistance using WHO bioassays. These assays were conducted on 1–3 day old F1 offspring of field collected adult caught An. funestus females to determine levels of insecticide resistance in the malaria vector population. WHO biochemical assays were carried out to determine the frequency of insecticide resistance genes within the same population. Results In surveys conducted between 2002 and 2006, low levels of bendiocarb resistance were detected in An. funestus, populations using WHO bioassays. This is probably due to significantly elevated levels of Acetylcholinesterase levels found in the same populations. Pyrethroid resistance was also detected in populations and linked to elevated levels of p450 monooxygenase activity. One site had

  5. Organochlorine Pesticides and Degradation Products in Soil around ...

    African Journals Online (AJOL)

    The levels and compositions of organochlorine pesticides and degradation products in soil samples collected from a former formulation plant in Morogoro municipality, Tanzania, were determined. Extraction was performed by pressurized fluid extraction using n-hexane:acetone (75:25) mixture. Clean-up of extracts was ...

  6. Spatial gradients of polychlorinated biphenyls (PCBs) and organochlorine pesticides

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Spatial gradients of polychlorinated biphenyls (PCBs) and organochlorine pesticides were examined in the young-of-the-year (YOY) blueÂżsh collected in the vicinity...

  7. Skin diseases associated with Agent Orange and other organochlorine exposures.

    Science.gov (United States)

    Patterson, Andrew T; Kaffenberger, Benjamin H; Keller, Richard A; Elston, Dirk M

    2016-01-01

    Organochlorine exposure is an important cause of cutaneous and systemic toxicity. Exposure has been associated with industrial accidents, intentional poisoning, and the use of defoliants, such as Agent Orange in the Vietnam War. Although long-term health effects are systematically reviewed by the Institute of Medicine, skin diseases are not comprehensively assessed. This represents an important practice gap as patients can present with cutaneous findings. This article provides a systematic review of the cutaneous manifestations of known mass organochlorine exposures in military and industrial settings with the goal of providing clinically useful recommendations for dermatologists seeing patients inquiring about organochlorine effects. Patients with a new diagnosis of chloracne, porphyria cutanea tarda, cutaneous lymphomas (non-Hodgkin lymphoma), and soft-tissue sarcomas including dermatofibrosarcoma protuberans and leiomyosarcomas should be screened for a history of Vietnam service or industrial exposure. Inconclusive evidence exists for an increased risk of other skin diseases in Vietnam veterans exposed to Agent Orange including benign fatty tumors, melanomas, nonmelanoma skin cancers, milia, eczema, dyschromias, disturbance of skin sensation, and rashes not otherwise specified. Affected veterans should be informed of the uncertain data in those cases. Referral to Department of Veterans Affairs for disability assessment is indicated for conditions with established associations. Copyright © 2015 American Academy of Dermatology, Inc. All rights reserved.

  8. Effects of Botanical Insecticides on Hymenopteran Parasitoids: a Meta-analysis Approach.

    Science.gov (United States)

    Monsreal-Ceballos, R J; Ruiz-Sánchez, E; Ballina-Gómez, H S; Reyes-Ramírez, A; González-Moreno, A

    2018-02-10

    Botanical insecticides (BIs) are considered a valuable alternative for plant protection in sustainable agriculture. The use of both BIs and parasitoids are presumed to be mutually compatible pest management practices. However, there is controversy on this subject, as various studies have reported lethal and sublethal effects of BIs on hymenopteran parasitoids. To shed new light on this controversy, a meta-analytic approach of the effects of BIs on adult mortality, parasitism, and parasitoid emergence under laboratory conditions was performed. We show that BIs increased mortality, decreased parasitism, and decreased parasitoid emergence. Botanical insecticides derived from Nicotiana tabacum and Caceolaria andina were particulary lethal. Most of the parasitoid groups showed susceptibility to BIs, but the families Scelionidae and Ichneumonidae were not significantly affected. The negative effects of BIs were seen regardless of the type of exposure (topical, ingestion, or residual). In conclusion, this meta-analysis showed that under laboratory conditions, exposure of hymenopteran parasitoids to BIs had significant negative effects on adult mortality, parasitism, and parasitoid emergence.

  9. Organochlorine pesticide level differences among female inhabitants from Veracruz, Puebla and Tabasco, Mexico.

    Science.gov (United States)

    Waliszewski, Stefan M; Caba, M; Saldarriaga-Noreña, H; Martínez, A J; Meza, E; Valencia Quintana, R; Zepeda, R

    2014-08-01

    Organochlorine pesticides have been used in Mexico in malaria control programs and against ectoparasites. The objective of this study was to compare the levels of organochlorine pesticides: HCB, α-β-γ-HCH, pp'-DDE, op'-DDT and pp'-DDT in adipose tissue of female inhabitants from three Mexican states: Veracruz, Puebla and Tabasco. Data analyses indicated higher β-HCH levels in Puebla inhabitants. When comparing the mean values of the pp'-DDE concentrations among the three states, no statistically significant differences were noted. A trend of increasing concentrations of op'-DDT from Veracruz to Puebla and Tabasco was observed. Significantly higher pp'-DDT concentrations in Veracruz as compared to Puebla and Tabasco were determined. Using factorial analysis of three age categories (>30, 31-50, pesticide concentrations increases with age of participants, indicating time of exposure as a principal factor of organochlorine pesticides accumulation in adipose tissue.

  10. Organochlorine contaminants and reproductive success of double-crested cormorants from Green Bay, Wisconsin, USA

    Science.gov (United States)

    Custer, T.W.; Custer, Christine M.; Hines, R.K.; Gutreuter, S.; Stromborg, K.L.; Allen, P. David; Melancon, M.J.

    1999-01-01

    In 1994 and 1995, nesting success of double-crested cormorants (Phalacrocorax auritus) was measured at Cat Island, in southern Green Bay, Lake Michigan, Wisconsin, USA. Sample eggs at pipping and unhatched eggs were collected and analyzed for organochlorines (including total polychlorinated biphenyls [PCBs] and DDE), hepatic microsomal ethoxyresorufin-O-dealkylase (EROD) activity in embryos, and eggshell thickness. Of 1,570 eggs laid, 32% did not hatch and 0.4% had deformed embryos. Of 632 chicks monitored from hatching to 12 d of age, 9% were missing or found dead; no deformities were observed. The PCB concentrations in sample eggs from clutches with deformed embryos (mean = 10.2 μg/g wet weight) and dead embryos (11.4 μg/g) were not significantly higher than concentrations in sample eggs from nests where all eggs hatched (12.1 μg/g). A logistic regression of hatching success versus DDE, dieldrin, and PCB concentrations in sibling eggs identified DDE and not dieldrin or PCBs as a significant risk factor. A logistic regression of hatching success versus DDE and eggshell thickness implicated DDE and not eggshell thickness as a significant risk factor. Even though the insecticide DDT was banned in the early 1970s, we suggest that DDE concentrations in double-crested cormorant eggs in Green Bay are still having an effect on reproduction in this species.

  11. Sequestration of organochlorine pesticides in soils of distinct organic carbon content

    International Nuclear Information System (INIS)

    Zhang Na; Yang Yu; Tao Shu; Liu Yan; Shi Kelu

    2011-01-01

    In the present study, five soil samples with organic carbon contents ranging from 0.23% to 7.1% and aged with technical dichlorodiphenyltrichloroethane (DDT) and hexachlorocyclohexane (HCH) for 15 months were incubated in a sealed chamber to investigate the dynamic changes of the OCP residues. The residues in the soils decreased over the incubation period and finally reached a plateau. Regression analysis showed that degradable fractions of OCPs were negatively correlated with soil organic carbon (SOC) except for α-HCH, while no correlation was found between degradation rate and SOC, which demonstrated that SOC content determines the OCP sequestration fraction in soil. Analysis of the ratio of DDT and its primary metabolites showed that, since it depends on differential sequestration among them, magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. - Research highlights: → Soil organic carbon content determines the OCP sequestration fraction in soil. → Magnitude of (p,p'-DDE + p,p'-DDD)/p,p'-DDT is not a reliable criterion for the identification of new DDT sources. → The more hydrophobic compounds have relatively higher sequestration fractions in soils with SOC contents >2%. → DDD may have higher sorption by soil organic matter than DDE. - The effect of soil organic matter on the sequestration of organochlorine pesticides (HCHs and DDTs) in soils was investigated in an innovative microcosm chamber.

  12. Degradation of bifenthrin and pirimiphos-methyl residues in stored wheat grains (Triticum aestivum L.) by ozonation.

    Science.gov (United States)

    Savi, Geovana D; Piacentini, Karim C; Bortolotto, Tiago; Scussel, Vildes M

    2016-07-15

    Pesticide insecticides are used on wheat grains in storage units but their efficiency is hindered by persistent residues in the grains. Therefore, this study aims to evaluate the effectiveness of ozone (O3) gas treatment on the degradation of residual bifenthrin and pirimiphos-methyl insecticides commonly used in storage wheat grains, as well as to evaluate degradation of their by-products. The residues of bifenthrin decreased after 180 min of exposure in a concentration of 60 μmol/mol (a 37.5 ± 7.4% reduction) with 20% moisture content and 0.9 water activity. On the other hand, under the same experimental conditions, the pirimiphos-methyl residues significantly decreased in the wheat grains (71.1 ± 8.6%) after 30 min of exposure. After O3 gas treatment, three by-products of pirimiphos-methyl (m/z=306.1) containing different molecular mass to charge ratios (m/z=278.1, 301.1 and 319.2) were identified by LC-MS. O3 is a strong oxidizer that has shown the potential to reduce pesticide residues in stored grain in order to ensure food quality and safety. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. In-coupled syringe assisted octanol-water partition microextraction coupled with high-performance liquid chromatography for simultaneous determination of neonicotinoid insecticide residues in honey.

    Science.gov (United States)

    Vichapong, Jitlada; Burakham, Rodjana; Srijaranai, Supalax

    2015-07-01

    A simple and fast method namely in-coupled syringe assisted octanol-water partition microextraction combined with high performance liquid chromatography (HPLC) has been developed for the extraction, preconcentration and determination of neonicotinoid insecticide residues (e.g. imidacloprid, acetamiprid, clothianidin, thiacloprid, thiamethoxam, dinotefuran, and nitenpyram) in honey. The experimental parameters affected the extraction efficiency, including kind and concentration of salt, kind of disperser solvent and its volume, kind of extraction solvent and its volume, shooting times and extraction time were investigated. The extraction process was carried out by rapid shooting of two syringes. Therefore, rapid dispersion and mass transfer processes was created between phases, and thus affects the extraction efficiency of the proposed method. The optimum extraction conditions were 10.00 mL of aqueous sample, 10% (w/v) Na2SO4, 1-octanol (100µL) as an extraction solvent, shooting 4 times and extraction time 2min. No disperser solvent and centrifugation step was necessary. Linearity was obtained within the range of 0.1-3000 ngmL(-1), with the correlation coefficients greater than 0.99. The high enrichment factor of the target analytes was 100 fold and low limit of detection (0.25-0.50 ngmL(-1)) could be obtained. This proposed method has been successfully applied in the analysis of neonicotinoid residues in honey, and good recoveries in the range of 96.93-107.70% were obtained. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Effects of organic-farming-compatible insecticides on four aphid natural enemy species.

    Science.gov (United States)

    Jansen, Jean P; Defrance, Thibaut; Warnier, Anne M

    2010-06-01

    The toxicities of pyrethrins + rapeseed oil, pyrethrins + piperonyl butoxide (PBO), potassium salts of fatty acids and linseed oil were assessed in the laboratory on the parasitic wasp Aphidius rhopalosiphi (Destefani-Perez), the ladybird Adalia bipunctata (L.), the rove beetle Aleochara bilineata (Gyll.) and the carabid beetle Bembidion lampros (Herbst.). The methods selected were residual contact toxicity tests on inert and natural substrates. Both the pyrethrin products led to 100% mortality in the adult parasitic wasps and ladybird larvae on glass plates and plants. The pyrethrins + PBO formulation was toxic for B. lampros on sand and natural soil, but the pyrethrins + rapeseed oil formulation was harmless for this species. Insecticidal soaps were harmless for all these beneficial species. None of the tested products significantly affected the parasitism of the onion fly pupae by A. bilineata. The results indicated the potentially high toxicity of natural pyrethrins for beneficial arthropods. Although this toxicity needs to be confirmed in field conditions, the toxicity levels obtained in the laboratory were similar to or higher than those of several synthetic insecticides known to be toxic in the field. Insecticidal soaps could be considered as an alternative for aphid control in organic farming in terms of selectivity.

  15. Simultaneous determination of neonicotinoid insecticides and insect growth regulators residues in honey using LC-MS/MS with anion exchanger-disposable pipette extraction.

    Science.gov (United States)

    Song, Shiming; Zhang, Cuifang; Chen, Zhaojie; He, Fengmei; Wei, Jie; Tan, Huihua; Li, Xuesheng

    2018-07-06

    In this study, we developed an anion exchanger-disposable pipette extraction (DPX) method to detect the residual concentrations of eight neonicotinoid insecticides (dinotefuran, acetamiprid, clothianidin, thiacloprid, imidachloprid, imidaclothiz, nitenpyram, and thiamethoxam) and eight insect growth regulators (IGRs; triflumuron, cyromazine, buprofezin, methoxyfenozide, tebufenozide, chromafenozide, fenoxycarb, and RH 5849) in Chinese honey samples collected from different floral sources and different geographical regions using liquid chromatography tandem mass spectrometry (LC-MS/MS). QAE Sephadex A-25 was used as the anion exchanger in the DPX column for the purification and cleanup of honey samples. Analytes were eluted with a mixture of acetonitrile and 0.1 M HCl, and the elution was subjected to LC analysis. This method was thoroughly validated for its reproducibility, linearity, trueness, and recovery. Satisfactory recovery of pesticides was obtained ranging from 72% to 111% with intraday RSDs (n = 5) of 1%-10%. High linearity (R 2  ≥ 0.9987) was observed for all 16 pesticides. Limits of detection and quantification for all 16 compounds ranged from 0.3 to 3 μg/kg and from 1 to 10 μg/kg, respectively. Pesticide residues (9-113 μg/kg) were found in Chinese honey samples. The anion exchanger-DPX method was effective for removing sugars and retaining target analytes. Moreover, this method was highly reliable and sensitive for detecting neonicotinoids and IGRs in different floral sources of honey and will be applicable to matrixes with high sugar content. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Removal and treatment of radioactive, organochlorine, and heavy metal contaminants from solid surfaces

    International Nuclear Information System (INIS)

    Grieco, S.A.; Neubauer, E.D.

    1996-01-01

    The U.S. Department of Energy (DOE) is defining decontamination and decommissioning (D ampersand D) obligations at its sites. Current D ampersand D activities are generally labor intensive, use chemical reagents that are difficult to treat, and may expose workers to radioactive and hazardous chemicals. Therefore, new technologies are desired that minimize waste, allow much of the decommissioned materials to be reused rather than disposed of as waste, and produce wastes that will meet disposal criteria. The O'Brien ampersand Gere companies tested a scouring decontamination system on concrete and steel surfaces contaminated with radioactive and hazardous wastes under the sponsorship of Martin Marietta Energy Systems, Inc. (MMES) at DOE's K-25 former gaseous diffusion plant in Oak Ridge, Tennessee. The scouring system removes fixed radioactive and hazardous contamination yet leaves the surface intact. Blasting residuals are treated using physical/chemical processes. Bench- and pilot-scale testing of the system was conducted on surfaces contaminated with uranium, technetium, heavy metals, and PCBs. Areas of concrete and metal surfaces were blasted. Residuals were dissolved in tap water and treated for radioactive, hazardous, and organochlorine constituents. The treatment system comprised pH adjustment, aeration, solids settling, filtration, carbon adsorption, and ion exchange. This system produced treated water and residual solid waste. Testing demonstrated that the system is capable of removing greater than 95% of radioactive and PCB surface contamination to below DOE's unrestricted use release limits; aqueous radionuclides, heavy metals, and PCBs were below DOE and USEPA treatment objectives after treatment. Waste residuals volume was decreased by 71 %. Preliminary analyses suggest that this system provides significant waste volume reduction and is more economical than alternative surface decontamination techniques that are commercially available or under development

  17. Enhanced degradation of spiro-insecticides and their leacher enol derivatives in soil by solarization and biosolarization techniques.

    Science.gov (United States)

    Fenoll, José; Garrido, Isabel; Vela, Nuria; Ros, Caridad; Navarro, Simón

    2017-04-01

    The leaching potential of three insecticides (spirodiclofen, spiromesifen, and spirotetramat) was assessed using disturbed soil columns. Small quantities of spirodiclofen and spiromesifen were detected in leachate fraction, while spirotetramat residues were not found in the leachates. In addition, the transformation products (enol derivatives) are relatively more mobile than the parent compounds and may leach into groundwater. Moreover, the use of disinfection soil techniques (solarization and biosolarization) to enhance their degradation rates in soil was investigated. The results show that both practices achieved a reduction in the number of juvenile nematodes, enhancing in a parallel way degradation rates of the insecticides and their enol derivatives as compared with the non-disinfected soil. This behavior can be mainly attributed to the increase in soil temperature and changes in microbial activity. All insecticides showed similar behavior under solarization and biosolarization conditions. As a consequence, both agronomic techniques could be considered as suitable strategies for detoxification of soils polluted with the studied pesticides.

  18. Polychlorinated biphenyls and organochlorine pesticides in various bird species from northern China

    International Nuclear Information System (INIS)

    Chen Da; Zhang Xiulan; Mai Bixian; Sun Quanhui; Song Jie; Luo Xiaojun; Zeng, Eddy Y.; Hale, Robert C.

    2009-01-01

    Little data are available on organochlorine contamination in Chinese terrestrial birds of prey. This study examined the presence of PCBs, DDTs and other organochlorine pesticides in various raptors from northern China. DDE exhibited the highest concentrations among targeted compounds. Greatest levels (23.5-1020 mg/kg lipid weight) were observed in Eurasian sparrowhawks. This may be due to their stopover in southeastern China, where high DDT and dicofol applications have been documented. Residential kestrels exhibited much lower DDE, but similar PCB and HCH concentrations. ΣTEQs and PCB-126/-77 concentration ratios exhibited significant positive correlations with ΣPCB concentrations, respectively. Similar results were also demonstrated by a meta-analysis of previously published data across avian species. Possible hepatic sequestration of coplanar PCB-77, -126, -169 and -118 was observed as liver TEQs increased in Eurasian sparrowhawks. These observations may indicate an induction of CYP1A enzymes, as a result of elevated contamination in some species. - Substantial bioaccumulation of organochlorine contaminants may cause toxic effects (i.e., an induction of Cytochrome P450 enzymes) in birds of prey from the northern China.

  19. Polychlorinated biphenyls and organochlorine pesticides in various bird species from northern China

    Energy Technology Data Exchange (ETDEWEB)

    Chen Da [Department of Environmental and Aquatic Animal Health, Virginia Institute of Marine Science, College of William and Mary, 1208 Greate Road, Gloucester Point, VA 23062 (United States); Zhang Xiulan; Mai Bixian [State Key Laboratory of Organic Chemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Sun Quanhui [Beijing Raptor Rescue Center, International Fund for Animal Welfare, Beijing 100875 (China); Song Jie [Key Laboratory for Biodiversity Science and Ecological Engineering, College of Life Sciences, Beijing Normal University, Beijing 100875 (China); Luo Xiaojun; Zeng, Eddy Y. [State Key Laboratory of Organic Chemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Hale, Robert C., E-mail: hale@vims.ed [Department of Environmental and Aquatic Animal Health, Virginia Institute of Marine Science, College of William and Mary, 1208 Greate Road, Gloucester Point, VA 23062 (United States)

    2009-07-15

    Little data are available on organochlorine contamination in Chinese terrestrial birds of prey. This study examined the presence of PCBs, DDTs and other organochlorine pesticides in various raptors from northern China. DDE exhibited the highest concentrations among targeted compounds. Greatest levels (23.5-1020 mg/kg lipid weight) were observed in Eurasian sparrowhawks. This may be due to their stopover in southeastern China, where high DDT and dicofol applications have been documented. Residential kestrels exhibited much lower DDE, but similar PCB and HCH concentrations. SIGMATEQs and PCB-126/-77 concentration ratios exhibited significant positive correlations with SIGMAPCB concentrations, respectively. Similar results were also demonstrated by a meta-analysis of previously published data across avian species. Possible hepatic sequestration of coplanar PCB-77, -126, -169 and -118 was observed as liver TEQs increased in Eurasian sparrowhawks. These observations may indicate an induction of CYP1A enzymes, as a result of elevated contamination in some species. - Substantial bioaccumulation of organochlorine contaminants may cause toxic effects (i.e., an induction of Cytochrome P450 enzymes) in birds of prey from the northern China.

  20. Homology modelling of Drosophila cytochrome P450 enzymes associated with insecticide resistance.

    Science.gov (United States)

    Jones, Robert T; Bakker, Saskia E; Stone, Deborah; Shuttleworth, Sally N; Boundy, Sam; McCart, Caroline; Daborn, Phillip J; ffrench-Constant, Richard H; van den Elsen, Jean M H

    2010-10-01

    Overexpression of the cytochrome P450 gene Cyp6g1 confers resistance against DDT and a broad range of other insecticides in Drosophila melanogaster Meig. In the absence of crystal structures of CYP6G1 or complexes with its substrates, structural studies rely on homology modelling and ligand docking to understand P450-substrate interactions. Homology models are presented for CYP6G1, a P450 associated with resistance to DDT and neonicotinoids, and two other enzymes associated with insecticide resistance in D. melanogaster, CYP12D1 and CYP6A2. The models are based on a template of the X-ray structure of the phylogenetically related human CYP3A4, which is known for its broad substrate specificity. The model of CYP6G1 has a much smaller active site cavity than the template. The cavity is also 'V'-shaped and is lined with hydrophobic residues, showing high shape and chemical complementarity with the molecular characteristics of DDT. Comparison of the DDT-CYP6G1 complex and a non-resistant CYP6A2 homology model implies that tight-fit recognition of this insecticide is important in CYP6G1. The active site can accommodate differently shaped substrates ranging from imidacloprid to malathion but not the pyrethroids permethrin and cyfluthrin. The CYP6G1, CYP12D1 and CYP6A2 homology models can provide a structural insight into insecticide resistance in flies overexpressing P450 enzymes with broad substrate specificities.

  1. Non-target toxicity of synthetic insecticides on the biological performance and population growth of Bracon hebetor Say.

    Science.gov (United States)

    Muslim, Mohammad; Ansari, M Shafiq; Hasan, Fazil

    2018-05-24

    Bracon hebetor Say (Hymenoptera: Braconidae) is an important biological control agent of various species of order Lepidoptera and extensively used in biological control program worldwide. Present study evaluated the lethal and sublethal effects of insecticides on B. hebetor using demographic and population growth parameters. Doses of all the tested insecticides were within a maximum range of their recommended field dosages and adults were treated using residual glass vials method. For control experiments adults were treated with distilled water. Among the tested insecticides, the survivorship of various stages of B. hebetor was considerably prolonged on cyantraniliprole followed by chlorantraniliprole and shortest on chlorpyrifos and profenofos treated group. Total immature development time was prolonged in chlorpyrifos and profenofos treated group. Population growth parameters like intrinsic rate of natural increase (r m ), net reproductive rate (R 0 ), finite rate of increase (λ) and mean generation time (T c ) were considerably reduced in B. hebetor groups treated with chlorpyrifos and profenofos. However, B. hebetor groups treated with chlorantraniliprole and cyantraniliprole showed a little or no much difference in population growth parameters when compared with untreated group. It was also observed that chlorpyrifos and profenofos modified the sex ratio, thereby female emergence get reduced. On the basis of present findings it can be concluded that all tested insecticides caused considerable ecotoxic effects on B. hebetor compared to control. However, comparisons among the tested insecticides on the basis of IOBC criteria showed that chlorantraniliprol and cyntraniliprol was less toxic as compared to other insecticides tested on this biological control agent.

  2. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  3. Selected trace elements and organochlorines: some findings in blood and eggs of nesting common eiders (Somateria mollissima) from Finland

    Science.gov (United States)

    Franson, J. Christian; Hollmen, Tuula E.; Poppenga, Robert H.; Hario, Martti; Kilpi, Mikael; Smith, Milton R.

    2000-01-01

    In 1997 and 1998, we collected blood samples from nesting adult female common eiders (Somateria mollissima) at five locations in the Baltic Sea near coastal Finland and analyzed them for lead, selenium, mercury, and arsenic. Eggs were collected from three locations in 1997 for analysis of selenium, mercury, arsenic, and 17 organochlorines (OCs). Mean blood lead concentrations varied by location and year and ranged from 0.02 ppm (residues in blood on wet weight basis) to 0.12 ppm, although one bird had 14.2 ppm lead in its blood. Lead residues in the blood of eiders were positively correlated with the stage of incubation, and lead inhibited the activity of the enzyme delta-aminolevulinic acid dehydratase (ALAD) in the blood. Selenium concentrations in eider blood varied by location, with means of 1.26 to 2.86 ppm. Median residues of selenium and mercury in eider eggs were 0.55 and 0.10 ppm (residues in eggs on fresh weight basis), respectively, and concentrations of both selenium and mercury in eggs were correlated with those in blood. Median concentrations of p,pa??-dichlorodiphenyldichloroethylene in eggs ranged from 13.1 to 29.6 ppb, but all other OCs were below detection limits. The residues of contaminants that we found in eggs were below concentrations generally considered to affect avian reproduction. The negative correlation of ALAD activity with blood lead concentrations is evidence of an adverse physiological effect of lead exposure in this population.

  4. Role of neonicotinyl insecticides in Washington apple integrated pest management. Part I. Control of lepidopteran pests

    Science.gov (United States)

    Brunner, J. F.; Beers, E. H.; Dunley, J. E.; Doerr, M.; Granger, K.

    2005-01-01

    Three neonicotinyl insecticides, acetamiprid, thiacloprid and clothianidin, were evaluated for their impact on four species of lepidopteran pests of apple in Washington, the codling moth, Cydia pomonella (L.), the Pandemis leafroller, Pandemis pyrusana Kearfott, and the obliquebanded leafroller, Choristoneura rosaceana (Harris), and Lacanobia subjuncta (Grote & Robinson). None of the neonicotinyl insecticides demonstrated sufficient activity against P. pyrusana, C. rosaceana, or L. subjuncta to warrant field trials. Conversely, all had some activity against one or more stages of C. pomonella. Acetamiprid was highly toxic to larvae in laboratory bioassays, and had relatively long activity of field-aged residues (21 days). It also showed some toxicity to C. pomonella eggs (via topical exposure) and adults. Acetamiprid provided the highest level of fruit protection from C. pomonella attack in field trials conducted over five years in experimental orchards with extremely high codling moth pressure. Thiacloprid performed similarly in bioassays, but fruit protection in field trials was slightly lower than acetamiprid. Clothianidin showed moderate to high toxicity in bioassays, depending on the C. pomonella stage tested, but poor fruit protection from attack in field trials. None of the neonicotinyl insecticides were as toxic to larvae or effective in protecting fruit as the current standard organophosphate insecticide used for C. pomonella control, azinphosmethyl. However, both acetamiprid and thiacloprid should provide acceptable levels of C. pomonella control in commercial orchards where densities are much lower than in the experimental orchards used for our trials. The advantages and disadvantages of the neonicotinyl insecticides as replacements for the organophosphate insecticides and their role in a pest management system for Washington apple orchards are discussed. Abbreviation: MFR Maximum field rate PMID:16341246

  5. Association between serum organochlorines and global methylation level of leukocyte DNA among Japanese women: a cross-sectional study

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Hiroaki [Department of Epidemiology and Environmental Health, Juntendo University Faculty of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113–8421 Japan (Japan); Iwasaki, Motoki, E-mail: moiwasak@ncc.go.jp [Epidemiology Division, Research Center for Cancer Prevention and Screening, National Cancer Center, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan); Kasuga, Yoshio [Department of Surgery, Nagano Matsushiro General Hospital, 183 Matsushiro, Matsushiro-cho, Nagano City, Nagano Prefecture 381–1231 Japan (Japan); Yokoyama, Shiro; Onuma, Hiroshi [Department of Breast and Thyroid Surgery, Nagano Red Cross Hospital, 5-22-1 Wakasato, Nagano City, Nagano Prefecture 380–8582 Japan (Japan); Nishimura, Hideki [Department of Respiratory Surgery and Breast Surgery, Nagano Municipal Hospital, 1333–1 Tomitake, Nagano City, Nagano Prefecture 381–8551 Japan (Japan); Kusama, Ritsu [Department of Surgery, Hokushin General Hospital, 1-5-63 Nishi, Nakano City, Nagano Prefecture 383–8505 Japan (Japan); Yoshida, Teruhiko [Division of Genetics, National Cancer Center Research Institute, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan); Yokoyama, Kazuhito [Department of Epidemiology and Environmental Health, Juntendo University Faculty of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113–8421 Japan (Japan); Tsugane, Shoichiro [Dierctor Research Center for Cancer Prevention and Screening, National Cancer Center, 5-1-1 Tsukiji, Chuo-ku, Tokyo 104–0045 Japan (Japan)

    2014-08-15

    While the global methylation level of leukocyte DNA may be a suitable biomarker for cancer risk, the level may be influenced by multiple factors, both environmental and host-related, one of which is exposure to environmental pollutants. To date, three epidemiologic studies have examined associations between serum organochlorine levels and global DNA methylation level, but their findings are not fully consistent, and the associations thus require confirmation in other well-characterized populations. We tested the association between organochlorine exposure and the global DNA methylation level of leukocytes in Japanese women. We conducted a cross-sectional study using the control group of a breast cancer case–control study in Japan. Subjects were 403 Japanese women who provided blood samples. Serum polychlorinated biphenyls (PCBs) and nine pesticide-related organochlorines were measured by gas chromatography isotope-dilution high-resolution mass spectrometry. Further, global methylation level of peripheral leukocyte DNA among 399 women was measured by luminometric methylation assay. Linear trends in the association between methylation and quartile levels of organochlorines were evaluated by regression coefficients in a multivariable linear regression model. We found significant inverse associations between the global methylation level in leukocyte DNA and many of the organochlorine levels measured. Global methylation level was significantly decreased by 0.33–0.83% per quartile category for serum o,p′-dichlorodiphenyltrichloroethane (o,p′-DDT), p,p′-DDT, p,p′-dichlorodiphenyldichloroethylene, trans-nonachlor, oxychlordane, hexachlorobenzene, β-hexachlorocyclohexane, PCB17, PCB52/69, PCB74, PCB114, and PCB183. Serum organochlorine levels were inversely associated with the global methylation level of leukocyte DNA in a relatively large sample of Japanese women. - Highlights: • Many serum organochlorine pesticides were inversely associated with the global

  6. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  7. Gut microbial degradation of organophosphate insecticides-induces glucose intolerance via gluconeogenesis.

    Science.gov (United States)

    Velmurugan, Ganesan; Ramprasath, Tharmarajan; Swaminathan, Krishnan; Mithieux, Gilles; Rajendhran, Jeyaprakash; Dhivakar, Mani; Parthasarathy, Ayothi; Babu, D D Venkatesh; Thumburaj, Leishman John; Freddy, Allen J; Dinakaran, Vasudevan; Puhari, Shanavas Syed Mohamed; Rekha, Balakrishnan; Christy, Yacob Jenifer; Anusha, Sivakumar; Divya, Ganesan; Suganya, Kannan; Meganathan, Boominathan; Kalyanaraman, Narayanan; Vasudevan, Varadaraj; Kamaraj, Raju; Karthik, Maruthan; Jeyakumar, Balakrishnan; Abhishek, Albert; Paul, Eldho; Pushpanathan, Muthuirulan; Rajmohan, Rajamani Koushick; Velayutham, Kumaravel; Lyon, Alexander R; Ramasamy, Subbiah

    2017-01-24

    Organophosphates are the most frequently and largely applied insecticide in the world due to their biodegradable nature. Gut microbes were shown to degrade organophosphates and cause intestinal dysfunction. The diabetogenic nature of organophosphates was recently reported but the underlying molecular mechanism is unclear. We aimed to understand the role of gut microbiota in organophosphate-induced hyperglycemia and to unravel the molecular mechanism behind this process. Here we demonstrate a high prevalence of diabetes among people directly exposed to organophosphates in rural India (n = 3080). Correlation and linear regression analysis reveal a strong association between plasma organophosphate residues and HbA1c but no association with acetylcholine esterase was noticed. Chronic treatment of mice with organophosphate for 180 days confirms the induction of glucose intolerance with no significant change in acetylcholine esterase. Further fecal transplantation and culture transplantation experiments confirm the involvement of gut microbiota in organophosphate-induced glucose intolerance. Intestinal metatranscriptomic and host metabolomic analyses reveal that gut microbial organophosphate degradation produces short chain fatty acids like acetic acid, which induces gluconeogenesis and thereby accounts for glucose intolerance. Plasma organophosphate residues are positively correlated with fecal esterase activity and acetate level of human diabetes. Collectively, our results implicate gluconeogenesis as the key mechanism behind organophosphate-induced hyperglycemia, mediated by the organophosphate-degrading potential of gut microbiota. This study reveals the gut microbiome-mediated diabetogenic nature of organophosphates and hence that the usage of these insecticides should be reconsidered.

  8. Insecticide resistance of Anopheles sinensis and An. vagus in Hainan Island, a malaria-endemic area of China.

    Science.gov (United States)

    Qin, Qian; Li, Yiji; Zhong, Daibin; Zhou, Ning; Chang, Xuelian; Li, Chunyuan; Cui, Liwang; Yan, Guiyun; Chen, Xiao-Guang

    2014-03-03

    Malaria is one of the most important public health problems in Southeast Asia, including Hainan Island, China. Vector control is the main malaria control measure, and insecticide resistance is a major concern for the effectiveness of chemical insecticide control programs. The objective of this study is to determine the resistance status of the main malaria vector species to pyrethroids and other insecticides recommended by the World Health Organization (WHO) for indoor residual sprays. The larvae and pupae of Anopheles mosquitoes were sampled from multiple sites in Hainan Island, and five sites yielded sufficient mosquitoes for insecticide susceptibility bioassays. Bioassays of female adult mosquitoes three days after emergence were conducted in the two most abundant species, Anopheles sinensis and An. vagus, using three insecticides (0.05% deltamethrin, 4% DDT, and 5% malathion) and following the WHO standard tube assay procedure. P450 monooxygenase, glutathione S-transferase and carboxylesterase activities were measured. Mutations at the knockdown resistance (kdr) gene and the ace-1 gene were detected by DNA sequencing and PCR-RFLP analysis, respectively. An. sinensis and An. vagus were the predominant Anopheles mosquito species. An. sinensis was found to be resistant to DDT and deltamethrin. An. vagus was susceptible to deltamethrin but resistant to DDT and malathion. Low kdr mutation (L1014F) frequency (P450 monooxygenase and carboxylesterase activities were detected in deltamethrin-resistant An. sinensis, and significantly higher P450 monooxygenase, glutathione S-transferase and carboxylesterase activities were found in malathion-resistant An. vagus mosquitoes. Multiple insecticide resistance was found in An. sinensis and An. vagus in Hainan Island, a malaria-endemic area of China. Cost-effective integrated vector control programs that go beyond synthetic insecticides are urgently needed.

  9. Partition distribution of selected organochlorine pesticides in water ...

    African Journals Online (AJOL)

    Organochlorine pesticides (OCPs) were analysed in surface water, pore water and surface sediment samples collected from the uMngeni River, which is one of the largest rivers in the province of KwaZulu-Natal, South Africa. Liquid-liquid extraction was used to extract the analytes from water and pore water samples and ...

  10. Effectiveness and Cost of Insecticide-Treated Bed Nets and Indoor Residual Spraying for the Control of Cutaneous Leishmaniasis: A Cluster-Randomized Control Trial in Morocco

    Science.gov (United States)

    Faraj, Chafika; Yukich, Joshua; Adlaoui, El Bachir; Wahabi, Rachid; Mnzava, Abraham Peter; Kaddaf, Mustapha; El Idrissi, Abderrahmane Laamrani; Ameur, Btissam; Kleinschmidt, Immo

    2016-01-01

    Cutaneous leishmaniasis (CL) remains an important public health problem in Morocco. A cluster-randomized trial was conducted with the following three study arms: 1) long-lasting insecticide-treated nets (LLINs) plus standard of care environmental management (SoC-EM), 2) indoor residual spraying (IRS) with α-cypermethrin plus SoC-EM, and 3) SoC-EM alone. Incidence of new CL cases by passive and active case detection, sandfly abundance, and cost and cost-effectiveness was compared between study arms over 5 years. Incidence of CL and sandfly abundance were significantly lower in the IRS arm compared with SoC-EM (CL incidence rate ratio = 0.32, 95% confidence interval [CI] = 0.15–0.69, P = 0.005 and sandfly abundance ratio = 0.39, 95% CI = 0.18–0.85, P = 0.022). Reductions in the LLIN arm of the study were not significant, possibly due to poor compliance. IRS was effective and more cost-effective for the prevention of CL in Morocco. PMID:26811431

  11. Investigation about the presence of organochlorine pollutants in mussels from the Black Sea, Bulgaria

    Directory of Open Access Journals (Sweden)

    Georgieva Stanislava

    2016-06-01

    Full Text Available The aim of this study was to investigate the presence of polychlorinated biphenyls (PCBs, organochlorine pesticides (HCB, DDT and its metabolites and HCBD in mussels from Bulgarian Black Sea coast. Mussels (Mytilus galloprovincialis are aquatic organisms which are immobile so that the concentration of pollutants should primarily be considered as an indication of local levels of organochlorine compounds. Samples were collected from three areas of Black Sea coast of Bulgaria in summer 2015.

  12. Persistence of malathion residues in stored wheat

    International Nuclear Information System (INIS)

    Farghaly, M.; Zayed, S.M.A.D.

    1990-01-01

    The persistence of succinate- 14 C-malathion in stored wheat was investigated under local conditions during a storage period of 32 weeks. The insecticide penetrated readily into the seed and up to 16% of the applied dose was found to be bound after 32 weeks in storage. Total terminal residues declined to 9.3 and 21.0 mg/kg from initially applied doses of 12.2 and 24.4 mg/kg respectively. A small percentage of malaoxon was detected only during the early weeks after treatment (3-5%). Malathion was the major constituent of the extractable residues. In addition, seven degradation products were detected and identified. (author). 6 refs, 2 figs, 2 tabs

  13. Potential for sublethal insecticide exposure to impact vector competence of Aedes albopictus (Diptera: Culicidae for dengue and Zika viruses

    Directory of Open Access Journals (Sweden)

    Richards SL

    2017-05-01

    Full Text Available Stephanie L Richards, Avian V White, Jo Anne G Balanay Department of Health Education and Promotion, College of Health and Human Performance, East Carolina University, Greenville, NC, USA Abstract: Chikungunya, dengue, and Zika viruses (CHIKV, family Togaviridae, genus Alphavirus; DENV and ZIKV, family Flaviviridae, genus Flavivirus are arboviruses that cause human epidemics. Due to the lack of vaccines for many mosquito-borne diseases, there is a need for mosquito control. In the US and other regions, residual barrier insecticide sprays are applied to foliage where female mosquitoes rest and/or sugar feed between blood meals. Residual sprays are an important control method for anthropogenic day-active sylvan mosquitoes such as Aedes albopictus (vector of CHIKV, DENV, and ZIKV that are difficult to control using ultralow-volume sprays applied only at dusk or dawn when these mosquitoes are not active. In this exploratory study, we analyzed the extent to which ingestion of a sublethal dose of the active ingredient bifenthrin affected vector competence (i.e., infection, dissemination, and transmission of Ae. albopictus for DENV and ZIKV. Two incubation periods (IPs; 7 and 14 d were tested at 28°C for insecticide-fed and sugar-fed mosquitoes. We show that mosquitoes that were fed bifenthrin (0.128 µg/mL mixed with sucrose solution exhibited significantly lower DENV infection rates and body titers after a 14-d IP. During the 7-d IP, one mosquito (sugar group transmitted ZIKV. During the 14-d IP, 100% of mosquitoes showed body and leg ZIKV infections, and one mosquito (sugar+bifenthrin group transmitted ZIKV. This is a preliminary communication, and more studies will be required to further investigate these findings. We expect the findings of this small-scale study to spur larger-scale investigations of the impacts of insecticides on mechanisms regulating vector competence, and exposure to other active ingredients, and aid in development of new

  14. Evaluation of Liquid and Bait Insecticides against the Dark Rover Ant (Brachymyrmex patagonicus

    Directory of Open Access Journals (Sweden)

    Javier G. Miguelena

    2014-11-01

    Full Text Available Dark rover ants (Brachymyrmex patagonicus, Mayr are an exotic ant species native to South America that has recently spread through the southern US. We evaluated the residual activity of three liquid insecticides (indoxacarb, fipronil and lambda-cyhalothrin as potential barrier treatments against these ants. The factors we considered include the use of a porous or non-porous surface, a short or long exposure time and the changes in insecticide activity after treatment during a 90 day period. We also tested the effect of baits containing three different active ingredients (imidacloprid, sodium tetraborate and indoxacarb on colony fragments of this species for a 15 day period. Both lambda-cyhalothrin® and indoxacarb® resulted in high levels of ant mortality up to 90 days after application. The results of exposure to fipronil® resembled those from the control treatment. Application of insecticides on a porous surface and the shorter exposure time generally resulted in greater ant survival. Of the baits tested, only the imidacloprid based one decreased ant survival significantly during the evaluation period. Within three days, the imidacloprid bait produced over 50% mortality which increased to over 95% by the end of the experiment. Results from the other two bait treatments were not significantly different from the control.

  15. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  17. Evaluation of new tools for malaria vector control in Cameroon: focus on long lasting insecticidal nets.

    Directory of Open Access Journals (Sweden)

    Josiane Etang

    Full Text Available BACKGROUND: From 2006 to 2011, biological activity of insecticides for Indoor Residual Spraying (IRS, conventional treatment of nets (CTNs or long lasting insecticidal nets (LLINs was evaluated before their approval in Cameroon. The objective of the study was to select the best tools for universal malaria vector control coverage. METHODOLOGY: Bioassays were performed using WHO cones and the Kisumu susceptible strain of Anopheles gambiae s.s.. Among tested products, residual activity and wash resistance of Alpha-cypermethrin LLINs (Interceptor and CTNs (Fendona were assessed during 5 months in the Ntougou neighborhood. PRINCIPAL FINDINGS: All the 14 tested products were found effective (95-100% knockdown and mortality rates, although a significant decrease of efficacy was seen with lambda-cyhalothrinWP IRS, alpha-cypermethrin CTNs and LLINs (p< 0.05. However, the efficacy of Interceptor nets did not decrease during the 5 months evaluation, even after 25 washes (0.07

  18. Vectorial status and insecticide resistance of Anopheles funestus from a sugar estate in southern Mozambique.

    Science.gov (United States)

    Kloke, R Graham; Nhamahanga, Eduardo; Hunt, Richard H; Coetzee, Maureen

    2011-02-09

    The dual problems of rising insecticide resistance in the malaria vectors and increasing human malaria cases since 2001 in southern Mozambique are cause for serious concern. The selection of insecticides for use in indoor residual spraying (IRS) programmes is highly dependent on the extent to which local mosquitoes are susceptible to the approved classes of insecticides. The insecticide resistance status and role in malaria transmission of Anopheles funestus was evaluated at the Maragra Sugar Estate in southern Mozambique where an IRS vector control programme has been in operation for seven years using the carbamate insecticide bendiocarb. No Anopheles species were captured inside the sugar estate control area. Anopheles funestus group captured outside of the estate represented 90% (n = 475) of the total collections. Of the specimens identified to species by PCR (n = 167), 95% were An. funestus s.s. One An. rivulorum was identified and seven specimens did not amplify. The Anopheles gambiae complex was less abundant (n = 53) and of those identified (n = 33) 76% were An. arabiensis and 24% An. merus. Insecticide susceptibility tests showed that wild-caught and F-1 family An. funestus were resistant to deltamethrin (32.5% mortality) and lambda-cyhalothrin (14.6% mortality), less so to bendiocarb (71.5% mortality) and fully susceptible to both malathion and DDT (100%). Bendiocarb and pyrethroid resistance was nullified using 4% piperonyl butoxide (Pbo), strongly suggesting that both are mediated by P450 monooxygenase detoxification. ELISA tests of An. funestus for Plasmodium falciparum, gave a sporozoite rate of 6.02% (n = 166). One unidentified member of the An. gambiae complex tested positive for P. falciparum sporozoites. Anopheles funestus was found to be the most abundant and principle vector of malaria in this area, with members of the An. gambiae complex being secondary vectors. Despite the continual use of bendiocarb within the estate for seven years and the

  19. Vectorial status and insecticide resistance of Anopheles funestus from a sugar estate in southern Mozambique

    Directory of Open Access Journals (Sweden)

    Nhamahanga Eduardo

    2011-02-01

    Full Text Available Abstract Background The dual problems of rising insecticide resistance in the malaria vectors and increasing human malaria cases since 2001 in southern Mozambique are cause for serious concern. The selection of insecticides for use in indoor residual spraying (IRS programmes is highly dependent on the extent to which local mosquitoes are susceptible to the approved classes of insecticides. The insecticide resistance status and role in malaria transmission of Anopheles funestus was evaluated at the Maragra Sugar Estate in southern Mozambique where an IRS vector control programme has been in operation for seven years using the carbamate insecticide bendiocarb. Results No Anopheles species were captured inside the sugar estate control area. Anopheles funestus group captured outside of the estate represented 90% (n = 475 of the total collections. Of the specimens identified to species by PCR (n = 167, 95% were An. funestus s.s. One An. rivulorum was identified and seven specimens did not amplify. The Anopheles gambiae complex was less abundant (n = 53 and of those identified (n = 33 76% were An. arabiensis and 24% An. merus. Insecticide susceptibility tests showed that wild-caught and F-1 family An. funestus were resistant to deltamethrin (32.5% mortality and lambda-cyhalothrin (14.6% mortality, less so to bendiocarb (71.5% mortality and fully susceptible to both malathion and DDT (100%. Bendiocarb and pyrethroid resistance was nullified using 4% piperonyl butoxide (Pbo, strongly suggesting that both are mediated by P450 monooxygenase detoxification. ELISA tests of An. funestus for Plasmodium falciparum, gave a sporozoite rate of 6.02% (n = 166. One unidentified member of the An. gambiae complex tested positive for P. falciparum sporozoites. Conclusion Anopheles funestus was found to be the most abundant and principle vector of malaria in this area, with members of the An. gambiae complex being secondary vectors. Despite the continual use of

  20. Effects of permethrin treated wood on the subterranean termite Reticulitermes flavipes (Kollar) and comparison of solvent extraction for HPLC analysis of permethrin in wood

    Science.gov (United States)

    Mark Mankowski; Blossie Boyd; Geoffrey Webb

    2016-01-01

    Permethrin is a common insecticide used in wood preservation. It is an effective synthetic pyrethroid that is considered to be less toxic to higher organisms than organochlorine insecticides. In wood preservation, it can be used in combination with fungicides such as 3-iodo-2-propynyl butyl carbamate (IPBC). Permethrin has a dual mode of action as it is a repellent and...

  1. Plant Essential Oils from Apiaceae Family as Alternatives to Conventional Insecticides

    Directory of Open Access Journals (Sweden)

    Asgar Ebadollahi

    2013-06-01

    Full Text Available Main method to control insect pest is using synthetic insecticides, but the development of insect resistance to this products, the high operational cost, environmental pollution, toxicity to humans and harmful effect on non-target organisms have created the need for developing alternative approaches to control insect pest. Furthermore, the demand for organic crops, especially vegetables for the fresh market, has greatly increased worldwide. The ideal insecticide should control target pests adequately and should be target-specific, rapidly degradable, and low in toxicity to humans and other mammals. Plant essential oils could be an alternative source for insect pest control because they constitute a rich source of bioactive chemicals and are commonly used as flavoring agents in foods. These materials may be applied to food crops shortly before harvest without leaving excessive residues. Moreover, medically safe of these plant derivatives has emphasized also. For these reasons, much effort has been focused on plant essential oils or their constituents as potential sources of insect control agents. In this context, Apiaceae (Umbelliferae family would rank among the most important families of plants. In the last few years more and more studies on the insecticidal properties of essential oils from Apiaceae family have been published and it seemed worthwhile to compile them. The focus of this review lies on the lethal (ovicidal, larvicidal, pupicidal and adulticidal and sublethal (antifeedant, repellent, oviposition deterrent, Growth inhibitory and progeny production activities of plant essential oils and theirmain components from Apiaceae family. These features indicate that pesticides based on Apiaceae essential oils could be used in a variety of ways to control a large number of pests. It can be concluded that essential oils and phytochemicals isolated from Apiaceae family may be efficacious and safe replacements for conventional synthetic

  2. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  3. Toxicity of Insecticides Targeting Rice Planthoppers to Adult and Immature Stages of Trichogramma chilonis (Hymenoptera: Trichogrammatidae).

    Science.gov (United States)

    Ko, Ko; Liu, Yudi; Hou, Maolin; Babendreier, Dirk; Zhang, Feng; Song, Kai

    2015-02-01

    Planthopper-targeting insecticides, pymetrozine, thiamethoxam, buprofezin, and nitenpyram, were tested under laboratory conditions for toxicity to adults and immatures of Trichogramma chilonis Ishii, using standard tests described by International Organization for Biological Control (IOBC). In the dry film residue test, all insecticides resulted in >90% mortality in T. chilonis adults and were ranked as moderately harmful. Persistent toxicity tests revealed that nitenpyram was short-lived and the other three insecticides were of slightly persistent toxicity to the wasp adults. Effects of the insecticides on egg, larval, and prepupal stages of T. chilonis were investigated with striped stem borer as host. At the three stages of T. chilonis (within the host egg), all the insecticides reduced parasitism rate, but nitenpyram and pymetrozine applied at egg stage, buprofezin and nitenpyram at larval stage, and buprofezin and thiamethoxam at prepupal stage of T. chilonis reduced parasitism by buprofezin at prepupal stage resulted in >30% reduction in emergence rate as compared with the control and were categorized as harmful. Immature duration of T. chilonis was only significantly extended by nitenpyram applied to egg stage than the control. Sex ratio of emerged wasps was not affected by the treatment to immature stages. The data are of significance for IPM programs incorporating inundative release of T. chilonis for control of lepidopteran rice pests where there is heavy co-occurrence of planthoppers. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. An Insecticide Further Enhances Experience-Dependent Increased Behavioural Responses to Sex Pheromone in a Pest Insect.

    Directory of Open Access Journals (Sweden)

    Antoine Abrieux

    Full Text Available Neonicotinoid insecticides are widely used to protect plants against pest insects, and insecticide residues remaining in the environment affect both target and non-target organisms. Whereas low doses of neonicotinoids have been shown to disturb the behaviour of pollinating insects, recent studies have revealed that a low dose of the neonicotinoid clothianidin can improve behavioural and neuronal sex pheromone responses in a pest insect, the male moth Agrotis ipsilon, and thus potentially improve reproduction. As male moth behaviour depends also on its physiological state and previous experience with sensory signals, we wondered if insecticide effects would be dependent on plasticity of olfactory-guided behaviour. We investigated, using wind tunnel experiments, whether a brief pre-exposure to the sex pheromone could enhance the behavioural response to this important signal in the moth A. ipsilon at different ages (sexually immature and mature males and after different delays (2 h and 24 h, and if the insecticide clothianidin would interfere with age effects or the potential pre-exposure-effects. Brief pre-exposure to the pheromone induced an age-independent significant increase of sex pheromone responses 24 h later, whereas sex pheromone responses did not increase significantly 2 h after exposure. However, response delays were significantly shorter compared to naïve males already two hours after exposure. Oral treatment with clothianidin increased sex pheromone responses in sexually mature males, confirming previous results, but did not influence responses in young immature males. Males treated with clothianidin after pre-exposure at day 4 responded significantly more to the sex pheromone at day 5 than males treated with clothianidin only and than males pre-exposed only, revealing an additive effect of experience and the insecticide. Plasticity of sensory systems has thus to be taken into account when investigating the effects of sublethal doses

  5. An Insecticide Further Enhances Experience-Dependent Increased Behavioural Responses to Sex Pheromone in a Pest Insect.

    Science.gov (United States)

    Abrieux, Antoine; Mhamdi, Amel; Rabhi, Kaouther K; Egon, Julie; Debernard, Stéphane; Duportets, Line; Tricoire-Leignel, Hélène; Anton, Sylvia; Gadenne, Christophe

    2016-01-01

    Neonicotinoid insecticides are widely used to protect plants against pest insects, and insecticide residues remaining in the environment affect both target and non-target organisms. Whereas low doses of neonicotinoids have been shown to disturb the behaviour of pollinating insects, recent studies have revealed that a low dose of the neonicotinoid clothianidin can improve behavioural and neuronal sex pheromone responses in a pest insect, the male moth Agrotis ipsilon, and thus potentially improve reproduction. As male moth behaviour depends also on its physiological state and previous experience with sensory signals, we wondered if insecticide effects would be dependent on plasticity of olfactory-guided behaviour. We investigated, using wind tunnel experiments, whether a brief pre-exposure to the sex pheromone could enhance the behavioural response to this important signal in the moth A. ipsilon at different ages (sexually immature and mature males) and after different delays (2 h and 24 h), and if the insecticide clothianidin would interfere with age effects or the potential pre-exposure-effects. Brief pre-exposure to the pheromone induced an age-independent significant increase of sex pheromone responses 24 h later, whereas sex pheromone responses did not increase significantly 2 h after exposure. However, response delays were significantly shorter compared to naïve males already two hours after exposure. Oral treatment with clothianidin increased sex pheromone responses in sexually mature males, confirming previous results, but did not influence responses in young immature males. Males treated with clothianidin after pre-exposure at day 4 responded significantly more to the sex pheromone at day 5 than males treated with clothianidin only and than males pre-exposed only, revealing an additive effect of experience and the insecticide. Plasticity of sensory systems has thus to be taken into account when investigating the effects of sublethal doses of insecticides

  6. Organochlorine pesticide distribution in an organic production system for cow's milk in Chiapas, Mexico.

    Science.gov (United States)

    Murga, María N; Gutiérrez, Rey; Vega, Salvador; Pérez, José J; Ortiz, Rutilio; Schettino, Beatriz; Yamasaki, Alberto; Ruíz, Jorge L

    2016-09-01

    The objective of this study was to evaluate the presence of organochlorine pesticides in samples of forage, soil, water, and milk in four units of an organic production system for cow´s milk (samples of forage, milk, soil, and water) in Tecpatan, Chiapas, Mexico. The organochlorine pesticides were extracted from forage, soil and water based on the USEPA (2005) guideline and from milk based on the IDF 1991 guideline. The pesticides were identified and quantified by gas chromatography with electron capture detector (CG-ECD). In general, the highest average concentration of total pesticides was found in the samples of milk and forage (311 ± 328 and 116.5 ±77 ng g(-1) respectively). Although, the production systems analyzed are organic, organochlorine pesticides were detected in all environmental samples (forage, soil, water, and organic milk). Although no values surpassed the defined limits of Mexican and International regulation it is advisable that a monitoring program of contaminants in these production systems is continued.

  7. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Resurgence of Malaria Following Discontinuation of Indoor Residual Spraying of Insecticide in an Area of Uganda With Previously High-Transmission Intensity.

    Science.gov (United States)

    Raouf, Saned; Mpimbaza, Arthur; Kigozi, Ruth; Sserwanga, Asadu; Rubahika, Denis; Katamba, Henry; Lindsay, Steve W; Kapella, Bryan K; Belay, Kassahun A; Kamya, Moses R; Staedke, Sarah G; Dorsey, Grant

    2017-08-01

    Indoor residual spraying (IRS) and long-lasting insecticidal nets (LLINs) are the primary tools for malaria prevention in Africa. It is not known whether reductions in malaria can be sustained after IRS is discontinued. Our aim in this study was to assess changes in malaria morbidity in an area of Uganda with historically high transmission where IRS was discontinued after a 4-year period followed by universal LLIN distribution. Individual-level malaria surveillance data were collected from 1 outpatient department and 1 inpatient setting in Apac District, Uganda, from July 2009 through November 2015. Rounds of IRS were delivered approximately every 6 months from February 2010 through May 2014 followed by universal LLIN distribution in June 2014. Temporal changes in the malaria test positivity rate (TPR) were estimated during and after IRS using interrupted time series analyses, controlling for age, rainfall, and autocorrelation. Data include 65 421 outpatient visits and 13 955 pediatric inpatient admissions for which a diagnostic test for malaria was performed. In outpatients aged malaria morbidity to pre-IRS levels. © The Author 2017. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail: journals.permissions@oup.com

  9. Fate and persistence of 14C pesticide residues in different soils: effects of 14C pesticide contaminated run-off soil water on biological systems. Part of a coordinated programme on isotopic-tracer-aided studies of agrochemical residue - soil biota interactions

    International Nuclear Information System (INIS)

    Lichtenstein, E.

    1982-09-01

    The interaction of selected fungicides, herbicides and N-fertilizers with microorganisms in cranberry soils and their effects on the degradation of 14 C-phenyl-parathion were investigated. Incubation of soils with parathion of p-nitrophenol for 4 days, followed by the addition of 14 C-parathion resulted after 24 h in an enhanced degradation of the insecticide to 14 CO 2 (34-39% of the applied radiocarbon as opposed to 2% in controls) and also in an increased binding of 14 C to the soil. The fungicide captafol inhibited the degradation of soil-applied 14 C-parathion as evidenced by a reduction of both 14 CO 2 evolution and 14 C-bound residues. Maneb and benomyl suppressed the degradation of 14 C-parathion to 14 CO 2 but not the formation of bound residues. Addition of 2,4-D to 14 C-parathion treated soil also resulted in an increased persistence of the insecticide. Studies conducted with the insecticide and (NH 4 ) 2 SO 4 , NH 4 NO 3 , KNO 3 or urea showed that under all experimental conditions the total amounts of 14 C recovered were similar, yet the distribution of 14 C-compounds into benzene-soluble, water-soluble and bound residues was not. This possibly indicated a change in the pathway of 14 C-parathion degradation. The insecticide was most persistent in soils containing (NH 4 ) 2 SO 4 , as demonstrated by a recovery of 29% of the applied radiocarbon in benzene-soluble form. Analyses by TIC of this benzene extraction phase revealed the presence of 14 C-parathion, 14 C-p-aminophenol and 14 C-aminoparathion

  10. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  11. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  12. Persistent organochlorines in high-Antarctic fish; Persistente chlororganische Verbindungen in hochantarktischen Fischen

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, S.

    1997-11-01

    24 chlorinated hydrocarbons from different classes (PCB, HCH, DDT, Chlordane, Hexachlorobenzene and Octachlorostyrene) were analyzed in four species of high-Antarctic fish (Aethotaxis mitopteryx, Pleuragramma antarcticum, Trematomus lepidorhinus, and Chinodraco myersi). The concentrations were in the order of 1 {mu}g/kg wet weight or 10 {mu}g/kg lipid weight, respectively. Highest concentrations were measured for HCB in all species. The species showed different distribution patterns for the organochlorines studied. Compared with concentrations in fish from other regions the organochlorine levels measured in Antarctic fish are rather low. It is unlikely that the burden of organochlorines will cause any toxic effects in high-Antarctic fish yet. Nevertheless, with regard to the sensitive Antarctic ecosystem, even small concentrations carry a high risk of harm for Antarctic life. Environmental pollution in Antarctica should be observed with a monitoring program using standardized methods. For this purpose, the fish species studied are very useful as bioindicators for organochlorine contamination. (orig.) [Deutsch] 24 persistente Chlorkohlenwasserstoffe verschiedener Schadstoffgruppen (PCB, HCH, DDT, Chlordan, Hexachlorbenzol und Octachlorstyrol) wurden in vier hochantarktischen Fischarten (Aethotaxis mitopteryx, Pleuragramma antarcticum, Trematomus lepidorhinus und Chionodraco myersi). Die Konzentrationen der nachgewiesenen Schadstoffe im Ganzfisch liegen jeweils in der Groessenordnung von 1 {mu}g/kg Feuchtgewicht bzw. 10 {mu}g/kg Lipidgewicht mit erheblichen Schwankungen je nach Schadstoff und Art. Die Spezies zeigen artspezifische Schadstoffverteilungsmuster. Die Konzentrationen sind gegenueber denen in Fischen aus Gebieten mit staerkerem zivilisatorischem Einfluss eher niedrig. Die Fremstoffbelastungen der hochantarktischen Fische fuehren wahrscheinlich noch nicht zu messbaren toxischen Effekten bei den Fischen. Dennoch geht von den Schadstoffen in Hinblick auf das

  13. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  14. Occurrence of organochlorine pesticides in indoor dust

    DEFF Research Database (Denmark)

    Bräuner, Elvira Vaclavik; Mayer, Philipp; Gunnarsen, Lars Bo

    2011-01-01

    Organochlorine pesticides are present in the environment and suspected of causing serious health effects. Diet has been the main exposure source, but indoor source release is gaining focus. Within a monitoring study of polychlorinated biphenyls of Danish buildings built during the 1960s and 1970s......, we coincidently determined extreme levels of dichlorodiphenyltrichloroethane (DDT) levels in two of ten random samples. This raises concern and further large scale investigations are warranted to confirm this....

  15. Studies of 14C-methamidophos residues and their binding to Costa Rican vegetables and soils

    International Nuclear Information System (INIS)

    Carazo, E.; Constenla, M.A.; Fuentes, G.; Moza, P.N.

    1984-01-01

    Studies of 14 C-methamidophos residues in tomato, lettuce and two soils were made under greenhouse conditions. Residues in tomato fruits were 4.5 ppm 35 days after the last application. Total residues in lettuce were also high and present mainly in the edible leaves (9.7 and 12.8 ppm after 3 and 5 applications of the insecticide, respectively). The non-extractable residues constituted a significant part of the total residues in plant tissues. Recovery of the extractable residues decreased with time more rapidly in a loamy clay than in a clay soil. Bound residue levels were about 8% of the applied 14 C in loamy clay after 10 days. Residues in the clay soil were higher and continued to decline throughout a 65-day period. (author)

  16. Comparative organochlorine accumulation in two ecologically similar shark species (Carcharodon carcharias and Carcharhinus obscurus) with divergent uptake based on different life history.

    Science.gov (United States)

    Beaudry, Marina C; Hussey, Nigel E; McMeans, Bailey C; McLeod, Anne M; Wintner, Sabine P; Cliff, Geremy; Dudley, Sheldon F J; Fisk, Aaron T

    2015-09-01

    Trophic position and body mass are traits commonly used to predict organochlorine burdens. Sharks, however, have a variety of feeding and life history strategies and metabolize lipid uniquely. Because of this diversity, and the lipid-association of organochlorines, the dynamics of organochlorine accumulation in sharks may be predicted ineffectively by stable isotope-derived trophic position and body mass, as is typical for other taxa. The present study compared ontogenetic organochlorine profiles in the dusky shark (Carcharhinus obscurus) and white shark (Carcharodon carcharias), which differ in metabolic thermoregulation and trophic position throughout their ontogeny. Although greater organochlorine concentrations were observed in the larger bodied and higher trophic position white shark (e.g., p,p'-dichlorodiphenyldichloroethylene: 20.2 ± 2.7 ng/g vs 9.3 ± 2.2 ng/g in the dusky shark), slopes of growth-dilution corrected concentrations with age were equal to those of the dusky shark. Similar ontogenetic trophic position increases in both species, less frequent white shark seal predation than previously assumed, or inaccurate species-specific growth parameters are possible explanations. Inshore habitat use (indicated by δ(13)C values) and mass were important predictors in white and dusky sharks, respectively, of both overall compound profiles and select organochlorine concentrations. The present study clarified understanding of trophic position and body mass as reliable predictors of interspecific organochlorine accumulation in sharks, whereas regional endothermy and diet shifting were shown to have less impact on overall rates of accumulation. © 2015 SETAC.

  17. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  18. Monitoring of Pesticide Residues in Commonly Used Fruits and Vegetables in Kuwait.

    Science.gov (United States)

    Jallow, Mustapha F A; Awadh, Dawood G; Albaho, Mohammed S; Devi, Vimala Y; Ahmad, Nisar

    2017-07-25

    The presence of pesticide residues in primary and derived agricultural products raises serious health concerns for consumers. The aim of this study was to assess the level of pesticide residues in commonly consumed fruits and vegetables in Kuwait. A total of 150 samples of different fresh vegetables and fruits were analyzed for the presence of 34 pesticides using the quick easy cheap effective rugged and safe (QuEChERS) multi-residue extraction, followed by gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-tandem mass spectrometry (LC - MS / MS). Pesticide residues above the maximum residue limits (MRL) were detected in 21% of the samples and 79% of the samples had no residues of the pesticides surveyed or contained residues below the MRL. Multiple residues were present in 40% of the samples with two to four pesticides, and four samples were contaminated with more than four pesticide residues. Of the pesticides investigated, 16 were detected, of which imidacloprid, deltamethrin, cypermethrin, malathion, acetamiprid, monocrotophos, chlorpyrifos-methyl, and diazinon exceeded their MRLs. Aldrin, an organochlorine pesticide, was detected in one apple sample, with residues below the MRL. The results indicate the occurrence of pesticide residues in commonly consumed fruits and vegetables in Kuwait, and pointed to an urgent need to develop comprehensive intervention measures to reduce the potential health risk to consumers. The need for the regular monitoring of pesticide residues and the sensitization of farmers to better pesticide safety practices, especially the need to adhere to recommended pre-harvest intervals is recommended.

  19. Monitoring of Pesticide Residues in Commonly Used Fruits and Vegetables in Kuwait

    Directory of Open Access Journals (Sweden)

    Mustapha F. A. Jallow

    2017-07-01

    Full Text Available The presence of pesticide residues in primary and derived agricultural products raises serious health concerns for consumers. The aim of this study was to assess the level of pesticide residues in commonly consumed fruits and vegetables in Kuwait. A total of 150 samples of different fresh vegetables and fruits were analyzed for the presence of 34 pesticides using the quick easy cheap effective rugged and safe (QuEChERS multi-residue extraction, followed by gas chromatography-mass spectrometry (GC-MS or liquid chromatography-tandem mass spectrometry (LC-MS/MS. Pesticide residues above the maximum residue limits (MRL were detected in 21% of the samples and 79% of the samples had no residues of the pesticides surveyed or contained residues below the MRL. Multiple residues were present in 40% of the samples with two to four pesticides, and four samples were contaminated with more than four pesticide residues. Of the pesticides investigated, 16 were detected, of which imidacloprid, deltamethrin, cypermethrin, malathion, acetamiprid, monocrotophos, chlorpyrifos-methyl, and diazinon exceeded their MRLs. Aldrin, an organochlorine pesticide, was detected in one apple sample, with residues below the MRL. The results indicate the occurrence of pesticide residues in commonly consumed fruits and vegetables in Kuwait, and pointed to an urgent need to develop comprehensive intervention measures to reduce the potential health risk to consumers. The need for the regular monitoring of pesticide residues and the sensitization of farmers to better pesticide safety practices, especially the need to adhere to recommended pre-harvest intervals is recommended.

  20. Boiaccumulation of selected organochlorines in bats and tits: influence of chemistry and biology

    Energy Technology Data Exchange (ETDEWEB)

    Streit, B. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution; Winter, S. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution; Nagel, A. [Frankfurt Univ. (Germany). Dept. of Ecology and Evolution

    1995-12-01

    We analyzed six organochlorine compounds (HCB, lindane, p,p`-DDE, PCB nr. 138, nr. 153, and nr. 180) from populations of the European great tit (Parus major) and from five species of bats (Pipistrellus pipistrellus, Nyctalus noctula, Plecotus auritus, Plecotus austriacus, Myotis myotis). A weak positive correlation between K{sub ow} (n-octanol/water partition coefficient) and bioaccumulation (measured as residue values) was found within each species. However, the ratio of the concentrations in bats compared to titmice increased significantly with increasing K{sub ow}. We argue that this is explained by the intensive juvenile feeding through long-term lactation and thus by the more intensive transfer of strongly lipophilic xenobiotics from mother to juvenile in mammals compared to birds. Further, there were clear variations between bat species with ranges of up to 11 times the lowest value for a single compound. These differences are related to different feeding habits of the adults and to different species-specific life history traits, such as age at maturity and number of offspring. (orig.)

  1. Organochlorine pesticides in soils of Mexico and the potential for soil-air exchange.

    Science.gov (United States)

    Wong, Fiona; Alegria, Henry A; Bidleman, Terry F

    2010-03-01

    The spatial distribution of organochlorine pesticides (OCs) in soils and their potential for soil-air exchange was examined. The most prominent OCs were the DDTs (Geometric Mean, GM=1.6 ng g(-1)), endosulfans (0.16 ng g(-1)), and toxaphenes (0.64 ng g(-1)). DDTs in soils of southern Mexico showed fresher signatures with higher FDDTe=p,p'-DDT/(p,p'-DDT+p,p'-DDE) and more racemic o,p'-DDT, while the signatures in the central and northern part of Mexico were more indicative of aged residues. Soil-air fugacity fractions showed that some soils are net recipients of DDTs from the atmosphere, while other soils are net sources. Toxaphene profiles in soils and air showed depletion of Parlar 39 and 42 which suggests that soil is the source to the atmosphere. Endosulfan was undergoing net deposition at most sites as it is a currently used pesticide. Other OCs showed wide variability in fugacity, suggesting a mix of net deposition and volatilization. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

  2. Risk assessment of insecticides used in rice on miridbug, Cyrtorhinus lividipennis Reuter, the important predator of brown planthopper, Nilaparvata lugens (Stal.).

    Science.gov (United States)

    Preetha, G; Stanley, J; Suresh, S; Samiyappan, R

    2010-07-01

    The green miridbug, Cyrtorhinus lividipennis, an important natural enemy of the rice brown planthopper (BPH), Nilaparvata lugens plays a major role as a predator in suppressing the pest population. The study assessed the impact of certain potential insecticides used in the rice ecosystem on the miridbug predator and brown planthopper through contact toxicity. Eleven insecticides, including neonicotinoids, diamides, azomethine pyridines, carbamates, pyrethroids, organophosphates and cyclodienes were selected to test their toxicities against the nymphs of C. lividipennis and N. lugens. Median lethal concentration (LC(50)) was determined for each insecticide using an insecticide-coated vial (scintillation) residue bioassay, which revealed BPMC as the highly toxic chemical with an LC(50) of 0.003mga.iL(-1) followed by ethofenprox and clothianidin with LC(50) of 0.006mga.iL(-1) at 48 HAT against C. lividipennis and ethofenprox as the highly toxic chemical with an LC(50) of 0.009mga.iL(-1) followed by clothianidin with an LC(50) of 0.211mga.iL(-1) at 48h after treatment (HAT) against N. lugens. Among the insecticides tested, the cyclodiene compound, endosulfan had the lowest acute contact toxicity (LC(50)=66.65mga.iL(-1) at 48 HAT) to C. lividipennis. Among the insecticides tested, endosulfan, chlorpyriphos, acephate and methyl parathion are regarded as safer to C. lividipennis based on selectivity ratio, hazard quotient and probit substitution method of risk assessments. 2010 Elsevier Ltd. All rights reserved.

  3. Functional characterization of carboxylesterase gene mutations involved in Aphis gossypii resistance to organophosphate insecticides.

    Science.gov (United States)

    Gong, Y-H; Ai, G-M; Li, M; Shi, X-Y; Diao, Q-Y; Gao, X-W

    2017-12-01

    Carboxylesterases (CarEs) play an important role in detoxifying insecticides in insects. Over-expression and structural modification of CarEs have been implicated in the development of organophosphate (OP) insecticide resistance in insects. A previous study identified four nonsynonymous mutations (resulting in four amino acid residue substitutions) in the open reading frame of the carboxylesterase gene of resistant cotton aphids compared to the omethoate susceptible strain, which has possibly influenced the development of resistance to omethoate (a systemic OP insecticide). The current study further characterized the function of these mutations, both alone and in combination, in the hydrolysis of OP insecticides. The metabolism results suggest that the combination of four mutations, mainly existing in the laboratory-selected OP-resistant cotton aphid population, increased the OP hydrolase activity (approximately twofold) at the cost of detectable carboxylesterase activity. The functional studies of single or multiple mutations suggest the positive effect of H104R, A128V and T333P on the acquisition of OP hydrolase activity, especially the combination of H104R with A128V or T333P. K484R substitution decreased both the OP hydrolase activity and the CarE activity, indicating that this mutation primarily drives the negative effect on the acquisition of OP hydrolase activity amongst these four mutations in the resistant strain. The modelling and docking results are basically consistent with the metabolic results, which strongly suggest that the structural gene modification is the molecular basis for the OP resistance in this laboratory-selected cotton aphid strain. © 2017 The Royal Entomological Society.

  4. Organochlorine Pesticides in the Ferruginous Pygmy Owl (Glaucidium brasilianum) in Chiapas, Mexico.

    Science.gov (United States)

    Arrona-Rivera, Alicia E; Enríquez, Paula L; García-Feria, Luis M; Orellana, Sergio Alvarado; von Osten, Jaime Rendón

    2016-09-01

    Concentrations of organochlorine pesticides were quantified in samples of feathers (n = 17) and blood (n = 15) of the ferruginous pygmy owl (Glaucidium brasilianum). The individuals were captured near the Protected Natural Area Cerro Sonsonate, Chiapas, Mexico, between February and June 2014. In both tissues, pesticides belonging to seven organochlorine chemical families were detected. However, the organochlorine pesticide concentrations differed between feathers and blood. The highest concentrations of hexachlorocyclohexanes were found in feathers (0.63 ± 0.89 μg/g), whereas the highest concentrations of ΣDrines were found in blood (0.31 ± 0.47 μg/mL). By using the summed concentrations for each of the seven families of pesticides found in feathers, we did not find any significant correlation between the pesticides and pectoral muscle or body weight (p > 0.15). The ΣDDT group was the only pesticide family that showed a positive correlation with owl body weight (r = 0.60, p = 0.05); the concentrations of these pesticides were also high in feather and blood tissues (r = 0.87, p = 0.02). Our results confirm that ferruginous pygmy owls in the study area are exposed to these pesticides.

  5. Insecticide resistance and role in malaria transmission of Anopheles funestus populations from Zambia and Zimbabwe.

    Science.gov (United States)

    Choi, Kwang S; Christian, Riann; Nardini, Luisa; Wood, Oliver R; Agubuzo, Eunice; Muleba, Mbanga; Munyati, Shungu; Makuwaza, Aramu; Koekemoer, Lizette L; Brooke, Basil D; Hunt, Richard H; Coetzee, Maureen

    2014-10-08

    Two mitochondrial DNA clades have been described in Anopheles funestus populations from southern Africa. Clade I is common across the continent while clade II is known only from Mozambique and Madagascar. The specific biological status of these clades is at present unknown. We investigated the possible role that each clade might play in the transmission of Plasmodium falciparum and the insecticide resistance status of An. funestus from Zimbabwe and Zambia. Mosquitoes were collected inside houses from Nchelenge District, Zambia and Honde Valley, Zimbabwe in 2013 and 2014. WHO susceptibility tests, synergist assays and resistance intensity tests were conducted on wild females and progeny of wild females. ELISA was used to detect Plasmodium falciparum circumsporozoite protein. Specimens were identified to species and mtDNA clades using standard molecular methods. The Zimbabwean samples were all clade I while the Zambian population comprised 80% clade I and 20% clade II in both years of collection. ELISA tests gave an overall infection rate of 2.3% and 2.1% in 2013, and 3.5% and 9.2% in 2014 for Zimbabwe and Zambia respectively. No significant difference was observed between the clades. All populations were resistant to pyrethroids and carbamates but susceptible to organochlorines and organophosphates. Synergist assays indicated that pyrethroid resistance is mediated by cytochrome P450 mono-oxygenases. Resistance intensity tests showed high survival rates after 8-hrs continuous exposure to pyrethroids but exposure to bendiocarb gave the same results as the susceptible control. This is the first record of An. funestus mtDNA clade II occurring in Zambia. No evidence was found to suggest that the clades are markers of biologically separate populations. The ability of An. funestus to withstand prolonged exposure to pyrethroids has serious implications for the use of these insecticides, either through LLINs or IRS, in southern Africa in general and resistance management

  6. Toxicity and residual control of Plutella xylostella L. (Lepidoptera: Plutellidae with Bacillus thuringiensis Berliner and insecticides Toxicidade e controle residual de Plutella xylostella L. (Lepidoptera: Plutellidae com Bacillus thuringiensis Berliner e inseticidas

    Directory of Open Access Journals (Sweden)

    Carla Pedroso de Moraes

    2012-08-01

    Full Text Available Plutella xylostella L. is the most important worldwide pest of cruciferous plants and indiscriminate use of insecticides has led to the resistance of the species to different groups. This research was conducted to compare the toxicity and persistence of two strains of Bacillus thuringiensis to P. xylostella larvae. Concentrations between 125 and 500g 100L-1 of water of the commercial products were evaluated and compared to the insect growth inhibitor diflubenzuron and to the neurotoxic pyrethroid deltamethrin. The efficacy of the insecticides was compared between treated plants kept indoor greenhouse and outdoor. Third instar larvae were more susceptible to B. thuringiensis than first instar ones. Agree and Dipel showed similar control rates of third instars until 10 days after treatment, but on the 15th day, Agree was significantly more efficient than Dipel. Both B. thuringiensis formulations showed a reduction in mortality after 10 days when the treated plants were exposed to natural weather conditions in comparison to the same treatments kept inside greenhouse. Dimilin (100g 100L-1 of water and deltamethrin (30ml of commercial product 100L-1 of water were not efficient to control third instar larvae of P. xylostella. This inefficiency cannot be attributed to a resistant population of P. xylostella since the larval population used in the experiments was not subjected to insecticide pressure, once the crop was organically cultivated all year round. The results showed that both formulations of B. thuringiensis are sound alternatives for the control of the diamondback moth in organically conducted cruciferous crops, considering the high residual control provided under subtropical weather conditions.Larvas de Plutella xylostella L. são as principais pragas de crucíferas cultivadas e o uso excessivo e indiscriminado de inseticidas tem levado a resistência da espécie para diferentes grupos de inseticidas. Este trabalho foi conduzido para

  7. Fate of the insecticide lambda-cyhalothrin in ditch enclosures differing in vegetation density.

    Science.gov (United States)

    Leistra, Minze; Zweers, Anton J; Warinton, Jacqui S; Crum, Steven J H; Hand, Laurence H; Beltman, Wim H J; Maund, Stephen J

    2004-01-01

    Use of the insecticide lambda-cyhalothrin in agriculture may result in the contamination of water bodies, for example by spray drift. Therefore, the possible exposure of aquatic organisms to this insecticide needs to be evaluated. The exposure of the organisms may be reduced by the strong sorption of the insecticide to organic materials and its susceptibility to hydrolysis at the high pH values in the natural range. In experiments done in May and August, formulated lambda-cyhalothrin was mixed with the water body of enclosures in experimental ditches containing a bottom layer and macrophytes (at different densities) or phytoplankton. Concentrations of lambda-cyhalothrin in the water body and in the sediment layer, and contents in the plant compartment, were measured by gas-liquid chromatography at various times up to 1 week after application. Various water quality parameters were also measured. Concentrations of lambda-cyhalothrin decreased rapidly in the water column: 1 day after application, 24-40% of the dose remained in the water, and by 3 days it had declined to 1.8-6.5%. At the highest plant density, lambda-cyhalothrin residue in the plant compartment reached a maximum of 50% of the dose after 1 day; at intermediate and low plant densities, this maximum was only 3-11% of the dose (after 1-2 days). The percentage of the insecticide in the ditch sediment was 12% or less of the dose and tended to be lower at higher plant densities. Alkaline hydrolysis in the water near the surface of macrophytes and phytoplankton is considered to be the main dissipation process for lambda-cyhalothrin.

  8. Bound residues of 14C-carbofuran and 14C-malathion in stored soybean seeds and their toxicological effects on mice

    International Nuclear Information System (INIS)

    Mahdy, F.; Taha, H.

    2005-01-01

    Soybeans treated with 1 4C -carbofuran or 1 4C -malathion at a dose of 30 mg/kg and stored for 30 weeks showed that the organophosphorus insecticide malathion had a higher binding tendency to soybean seeds than the carbamate insecticide carbofuran. The amount of malathion bound 1 4C -residues were almost three times higher (as percentage of applied dose) than carbofuran bound residues. Sub-chronic feeding experiments on mice for 90 days with a diet containing the bound 1 4C -residues at a dose of 0.91 and 2.39 ppm/day/mouse for carbofuran and malathion, respectively, caused non-significant symptoms of toxicity during the period of the experiment. A slight inhibition in plasma and erythrocyte choline esterase activities was observed during the second and third months in both treated mice fed on carbofuran or malathion. Liver enzymes, total protein, albumin, cholesterol, triglycerides and kidney functions showed non-significant differences from control values in case of mice fed on 1 4C -bound carbofuran residues. However, these mentioned blood parameters showed only slight increase, as compared with controls, in treated mice fed on 1 4C -bound malathion residues

  9. Undisturbed dust as a metric of long-term indoor insecticide exposure: Residential DDT contamination from indoor residual spraying and its association with serum levels in the VHEMBE cohort.

    Science.gov (United States)

    Gaspar, Fraser W; Chevrier, Jonathan; Bornman, Riana; Crause, Madelein; Obida, Muvhulawa; Barr, Dana Boyd; Bradman, Asa; Bouwman, Henk; Eskenazi, Brenda

    2015-12-01

    Although approximately 123 million people may be exposed to high levels of insecticides through the use of indoor residual spraying (IRS) for malaria control, few studies exist on indoor insecticide contamination due to IRS and its relationship with human exposure. In the present study, we developed a sampling method to collect undisturbed dust from 50 homes in Limpopo, South Africa, a region where dichlorodiphenyltrichloroethane (DDT) has been used in IRS programs to prevent malaria for ~70years. We quantified DDT and its degradation products, dichlorodiphenyldichloroethylene (DDE), and dichlorodiphenyldichloroethane (DDD) in dust samples to determine dust loading levels and compared these levels to paired serum concentrations of p,p'-DDT and p,p'-DDE in women residents. p,p'-DDT and p,p'-DDE had the highest detection frequencies in both dust (58% and 34% detection, respectively) and serum samples (98% and 100% detection, respectively). Significantly higher detection frequencies for o,p'-DDT, p,p'-DDE, and p,p'-DDD were observed in dust samples collected in buildings that had been previously sprayed for malaria control. We also observed a significant, positive association between dust loading and serum concentrations of p,p'-DDT and p,p'-DDE (Spearman's rho=0.68 and 0.54, respectively). Despite the low detection frequency in dust, our results indicate that undisturbed dust may be a good metric to quantify long-term home exposure to DDT-related compounds and that contamination of the home environment may be an important determinant/source of DDT and DDE exposure. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Occurrence and exposure assessment of polychlorinated biphenyls and organochlorine pesticides from homemade baby food in Korea.

    Science.gov (United States)

    Jeong, Yunsun; Lee, Sunggyu; Kim, Sunmi; Choi, Sung-Deuk; Park, Jeongim; Kim, Hai-Joong; Lee, Jeong Jae; Choi, Gyuyeon; Choi, Sooran; Kim, Sungjoo; Kim, Su Young; Kim, Young Don; Cho, Geumjoon; Suh, Eunsook; Kim, Sung Koo; Eun, So-Hee; Eom, Soyong; Kim, Seunghyo; Kim, Gun-Ha; Choi, Kyungho; Kim, Sungkyoon; Moon, Hyo-Bang

    2014-02-01

    Data on the residue levels of persistent organic pollutants (POPs) in baby food samples are scarce. This is the first study to explore current contamination status and exposure assessment of organochlorines (OCs), including polychlorinated biphenyls (PCBs) and organochlorine pesticides (OCPs), in baby food from Korea. In this study, the concentrations of OCs were determined in homemade baby food samples (n=100) collected from 6-, 9-, 12- and 15-month-old infant groups. The average concentrations of PCBs, dichloro-diphenyl-trichloroethanes (DDTs), hexachlorocyclohexanes (HCHs) and chlordanes (CHLs) in baby food samples were 37.5, 96.6, 26.0, and 13.2 pg/g fresh weight, respectively. The major compounds were CBs 28, 153, 52, and 33 for PCBs and p,p'-DDE, p,p'-DDT and β-HCH for OCPs. The contribution of DDTs to the total OC concentrations increased from 30% (6-month-old infants) to 67% (15-month-old infants) with increasing infant age, while the concentrations of PCBs, HCHs and CHLs gradually decreased with increasing infant age, suggesting that highest priority for risk reduction of DDTs. The estimated daily intakes (EDIs) of OCs in Korean infants from baby food consumption were lower than the thresholds proposed by the United States Environmental Protection Agency and Health Canada, implying limited potential health risks. However, considering simultaneous exposure from baby food and breast milk consumption, chlordanes and heptachlor epoxide posed potential health risks. Considering the importance of early development and the vulnerability of infants, it is essential to perform systematic monitoring and management programs of OCs in baby food for risk reduction in Korean infants. © 2013 Elsevier B.V. All rights reserved.

  11. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  12. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  13. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  14. Assessing insecticide hazard to bumble bees foraging on flowering weeds in treated lawns.

    Directory of Open Access Journals (Sweden)

    Jonathan L Larson

    Full Text Available Maintaining bee-friendly habitats in cities and suburbs can help conserve the vital pollination services of declining bee populations. Despite label precautions not to apply them to blooming plants, neonicotinoids and other residual systemic insecticides may be applied for preventive control of lawn insect pests when spring-flowering weeds are present. Dietary exposure to neonicotinoids adversely affects bees, but the extent of hazard from field usage is controversial. We exposed colonies of the bumble bee Bombus impatiens to turf with blooming white clover that had been treated with clothianidin, a neonicotinoid, or with chlorantraniliprole, the first anthranilic diamide labeled for use on lawns. The sprays were applied at label rate and lightly irrigated. After residues had dried, colonies were confined to forage for six days, and then moved to a non-treated rural site to openly forage and develop. Colonies exposed to clothianidin-treated weedy turf had delayed weight gain and produced no new queens whereas those exposed to chlorantraniliprole-treated plots developed normally compared with controls. Neither bumble bees nor honey bees avoided foraging on treated white clover in open plots. Nectar from clover blooms directly contaminated by spray residues contained 171±44 ppb clothianidin. Notably, neither insecticide adversely impacted bee colonies confined on the treated turf after it had been mown to remove clover blooms present at the time of treatment, and new blooms had formed. Our results validate EPA label precautionary statements not to apply neonicotinoids to blooming nectar-producing plants if bees may visit the treatment area. Whatever systemic hazard through lawn weeds they may pose appears transitory, however, and direct hazard can be mitigated by adhering to label precautions, or if blooms inadvertently are contaminated, by mowing to remove them. Chlorantraniliprole usage on lawns appears non-hazardous to bumble bees.

  15. Assessing Insecticide Hazard to Bumble Bees Foraging on Flowering Weeds in Treated Lawns

    Science.gov (United States)

    Larson, Jonathan L.; Redmond, Carl T.; Potter, Daniel A.

    2013-01-01

    Maintaining bee-friendly habitats in cities and suburbs can help conserve the vital pollination services of declining bee populations. Despite label precautions not to apply them to blooming plants, neonicotinoids and other residual systemic insecticides may be applied for preventive control of lawn insect pests when spring-flowering weeds are present. Dietary exposure to neonicotinoids adversely affects bees, but the extent of hazard from field usage is controversial. We exposed colonies of the bumble bee Bombus impatiens to turf with blooming white clover that had been treated with clothianidin, a neonicotinoid, or with chlorantraniliprole, the first anthranilic diamide labeled for use on lawns. The sprays were applied at label rate and lightly irrigated. After residues had dried, colonies were confined to forage for six days, and then moved to a non-treated rural site to openly forage and develop. Colonies exposed to clothianidin-treated weedy turf had delayed weight gain and produced no new queens whereas those exposed to chlorantraniliprole-treated plots developed normally compared with controls. Neither bumble bees nor honey bees avoided foraging on treated white clover in open plots. Nectar from clover blooms directly contaminated by spray residues contained 171±44 ppb clothianidin. Notably, neither insecticide adversely impacted bee colonies confined on the treated turf after it had been mown to remove clover blooms present at the time of treatment, and new blooms had formed. Our results validate EPA label precautionary statements not to apply neonicotinoids to blooming nectar-producing plants if bees may visit the treatment area. Whatever systemic hazard through lawn weeds they may pose appears transitory, however, and direct hazard can be mitigated by adhering to label precautions, or if blooms inadvertently are contaminated, by mowing to remove them. Chlorantraniliprole usage on lawns appears non-hazardous to bumble bees. PMID:23776667

  16. Toxicity of Insecticides on Various Life Stages of Two Tortricid Pests of Cranberries and on a Non-Target Predator.

    Science.gov (United States)

    Rodriguez-Saona, Cesar; Wanumen, Andrea Carolina; Salamanca, Jordano; Holdcraft, Robert; Kyryczenko-Roth, Vera

    2016-04-15

    Laboratory and extended laboratory bioassays were conducted to determine the residual toxicities of various insecticides against two key pests of cranberries, Sparganothis sulfureana and Choristoneura parallela (Lepidoptera: Tortricidae), and their non-target effects on the predatory Orius insidiosus (Hemiptera: Anthocoridae). The effects of nine insecticides with different modes of action on S. sulfureana and Ch. parallela eggs, larvae, and adults were tested in the laboratory, while the efficacy of a post-bloom application on larval mortality and mass of these pests and on adult O. insidiosus was evaluated in extended laboratory experiments. The organophosphate chlorpyrifos and the spinosyn spinetoram provided long-lasting (seven-day) control against all stages of both pests. The growth regulator methoxyfenozide and the diamides chlorantraniliprole and cyantraniliprole had strong (1-7 days) larvicidal, particularly on young larvae, and growth inhibitory activity, but only the diamides were adulticidal. Among neonicotinoids, acetamiprid had stronger ovicidal and adulticidal activity than thiamethoxam, showing within-insecticide class differences in toxicities; however, both were weak on larvae. Lethality of novaluron and indoxacarb was inconsistent, varying depending on species and stage. Chlorpyrifos was most toxic to O. insidiosus. These results show species- and stage-specific toxicities, and greater compatibility with biological control, of the newer reduced-risk classes of insecticides than older chemistries.

  17. Toxicity of Insecticides on Various Life Stages of Two Tortricid Pests of Cranberries and on a Non-Target Predator

    Directory of Open Access Journals (Sweden)

    Cesar Rodriguez-Saona

    2016-04-01

    Full Text Available Laboratory and extended laboratory bioassays were conducted to determine the residual toxicities of various insecticides against two key pests of cranberries, Sparganothis sulfureana and Choristoneura parallela (Lepidoptera: Tortricidae, and their non-target effects on the predatory Orius insidiosus (Hemiptera: Anthocoridae. The effects of nine insecticides with different modes of action on S. sulfureana and Ch. parallela eggs, larvae, and adults were tested in the laboratory, while the efficacy of a post-bloom application on larval mortality and mass of these pests and on adult O. insidiosus was evaluated in extended laboratory experiments. The organophosphate chlorpyrifos and the spinosyn spinetoram provided long-lasting (seven-day control against all stages of both pests. The growth regulator methoxyfenozide and the diamides chlorantraniliprole and cyantraniliprole had strong (1–7 days larvicidal, particularly on young larvae, and growth inhibitory activity, but only the diamides were adulticidal. Among neonicotinoids, acetamiprid had stronger ovicidal and adulticidal activity than thiamethoxam, showing within-insecticide class differences in toxicities; however, both were weak on larvae. Lethality of novaluron and indoxacarb was inconsistent, varying depending on species and stage. Chlorpyrifos was most toxic to O. insidiosus. These results show species- and stage-specific toxicities, and greater compatibility with biological control, of the newer reduced-risk classes of insecticides than older chemistries.

  18. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  19. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  20. Insecticide Resistance and Metabolic Mechanisms Involved in Larval and Adult Stages of Aedes aegypti Insecticide-Resistant Reference Strains from Cuba.

    Science.gov (United States)

    Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario

    2014-12-01

    Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.

  1. Effect of cooking on14 C-tetrachlorvinphos residues in faba beans

    International Nuclear Information System (INIS)

    Farghaly, M.; Zayed, S.M.A.D.

    1986-01-01

    The effect of cooking on 14 C-tetrachlorvinphos in stored vicia faba beans was studied. The results indicated that over 50% of the dose originally present inside the grains (37 ppm), could be recovered in the aqueous extract of the cooked grains. Considerable portion of radioactivity (About 22%) was associated with the grains in a non-extractable from. Residues in cooked beans included, in addition to a small amount of the parent insecticide, desmethyl tetrachlorvinphos, mono methyl phosphate and dimethyl phosphate. The results obtained indicate that tetrachlorvinphos residues are not appreciably affected by cooking. 1 tab

  2. Evidence for Dual Binding Sites for 1,1,1-Trichloro-2,2-bis(p-chlorophenyl)ethane (DDT) in Insect Sodium Channels*

    Science.gov (United States)

    Du, Yuzhe; Nomura, Yoshiko; Zhorov, Boris S.; Dong, Ke

    2016-01-01

    1,1,1-Trichloro-2,2-bis(p-chlorophenyl)ethane (DDT), the first organochlorine insecticide, and pyrethroid insecticides are sodium channel agonists. Although the use of DDT is banned in most of the world due to its detrimental impact on the ecosystem, indoor residual spraying of DDT is still recommended for malaria control in Africa. Development of resistance to DDT and pyrethroids is a serious global obstacle for managing disease vectors. Mapping DDT binding sites is necessary for understanding mechanisms of resistance and modulation of sodium channels by structurally different ligands. The pioneering model of the housefly sodium channel visualized the first receptor for pyrethroids, PyR1, in the II/III domain interface and suggested that DDT binds within PyR1. Previously, we proposed the second pyrethroid receptor, PyR2, at the I/II domain interface. However, whether DDT binds to both pyrethroid receptor sites remains unknown. Here, using computational docking of DDT into the Kv1.2-based mosquito sodium channel model, we predict that two DDT molecules can bind simultaneously within PyR1 and PyR2. The bulky trichloromethyl group of each DDT molecule fits snugly between four helices in the bent domain interface, whereas two p-chlorophenyl rings extend into two wings of the interface. Model-driven mutagenesis and electrophysiological analysis confirmed these propositions and revealed 10 previously unknown DDT-sensing residues within PyR1 and PyR2. Our study proposes a dual DDT-receptor model and provides a structural background for rational development of new insecticides. PMID:26637352

  3. Polychlorinated biphenyls, organochlorine pesticides and polycyclic aromatic hydrocarbons in a one-off global survey of bivalves

    DEFF Research Database (Denmark)

    Vorkamp, Katrin; Strand, Jakob; Christensen, Jan H.

    2010-01-01

    During the Danish Galathea 3 expedition, bivalve samples were collected at the Faroe Islands, Greenland, Ghana, South Africa, Australia, Solomon Islands, New Zealand, Chile, US Virgin Islands, Boston, Newfoundland and Shetland Islands and analysed for organochlorines and PAHs. Concentration...... in terms of PCB and PAH levels, while other Greenland samples came closest to representing PAH background levels. Several locations had undetectable organochlorine levels, including Hobart and Chile, which had the lowest Sigma PAH concentrations (group the stations...

  4. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  5. Insecticide resistance in Anopheles gambiae from south-western Chad, Central Africa

    Directory of Open Access Journals (Sweden)

    Etang Josiane

    2008-09-01

    Full Text Available Abstract Background Indoor residual spraying and insecticide-treated nets (ITN are essential components of malaria vector control in Africa. Pyrethroids are the only recommended compounds for nets treatment because they are fast-acting insecticides with low mammalian toxicity. However, there is growing concern that pyrethroid resistance may threaten the sustainability of ITN scaling-up programmes. Here, insecticide susceptibility was investigated in Anopheles gambiae sensu lato from an area of large scale ITN distribution programme in south-western Chad. Methods Susceptibility to 4% DDT, 0.05% deltamethrin, 0.75% permethrin, 0.1% bendiocarb and 5% malathion was assessed using the WHO standard procedures for adult mosquitoes. Tests were carried out with two to four days-old, non-engorged female mosquitoes. The An. gambiae Kisumu strain was used as a reference. Knockdown effect was recorded every 5 min and mortality scored 24 h after exposure. Mosquitoes were identified to species and molecular form by PCR-RFLP and genotypes at the kdr locus were determined in surviving specimens by Hot Oligonucleotide Ligation Assay (HOLA. Results During this survey, full susceptibility to malathion was recorded in all samples. Reduced susceptibility to bendiocarb (mortality rate of 96.1% was found in one sample out of nine assayed. Increased tolerance to pyrethroids was detected in most samples (8/9 with mortality rates ranging from 70.2 to 96.6% for deltamethrin and from 26.7 to 96.3% for permethrin. Pyrethroid tolerance was not associated with a significant increase of knock-down times. Anopheles arabiensis was the predominant species of the An. gambiae complex in the study area, representing 75 to 100% of the samples. Screening for kdr mutations detected the L1014F mutation in 88.6% (N = 35 of surviving An. gambiae sensu stricto S form mosquitoes. All surviving An. arabiensis (N = 49 and M form An. gambiae s.s. (N = 1 carried the susceptible allele

  6. Dynamic plant uptake model applied for drip irrigation of an insecticide to pepper fruit plants.

    Science.gov (United States)

    Legind, Charlotte N; Kennedy, Coleen M; Rein, Arno; Snyder, Nathan; Trapp, Stefan

    2011-05-01

    Drip application of insecticides is an effective way to deliver the chemical to the plant that avoids off-site movement via spray drift and minimizes applicator exposure. The aim of this paper is to present a cascade model for the uptake of pesticide into plants following drip irrigation, its application for a soil-applied insecticide and a sensitivity analysis of the model parameters. The model predicted the measured increase and decline of residues following two soil applications of an insecticide to peppers, with an absolute error between model and measurement ranging from 0.002 to 0.034 mg kg fw(-1). Maximum measured concentrations in pepper fruit were approximately 0.22 mg kg fw(-1). Temperature was the most sensitive component for predicting the peak and final concentration in pepper fruit, through its influence on soil and plant degradation rates. Repeated simulations of pulse inputs with the cascade model adequately describe soil pesticide applications to an actual cropped system and reasonably mimic it. The model has the potential to be used for the optimization of practical features, such as application rates and waiting times between applications and before harvest, through the integrated accounting of soil, plant and environmental influences. Copyright © 2011 Society of Chemical Industry.

  7. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  8. A Microsatellite-Based Analysis of House Infestation With Triatoma Infestans (Hemiptera: Reduviidae) After Insecticide Spraying in the Argentine Chaco.

    Science.gov (United States)

    Piccinali, Romina V; Gaunt, Michael W; Gürtler, Ricardo E

    2018-05-04

    Prevention of vector-borne transmission of Chagas disease mainly relies on residual insecticide spraying. Despite significant success at a regional scale, house infestation with Triatoma infestans (Klug) (Hemiptera: Reduviidae) still persists in the Gran Chaco ecoregion. One key aspect is the identification of the sources of reinfestant triatomines. After detecting fine-scale genetic structure in two rural villages of Pampa del Indio, Argentine Chaco, we tested hypotheses on the putative origins of the triatomines collected at 4, 8, and 12 mo after insecticide house spraying. We genotyped 10 microsatellite loci in 262 baseline and 83 postspraying triatomines from different houses. Genetic variability was similar between baseline and postspraying populations, but 13 low-frequency alleles were not detected at postspraying. FSTs were not significant between insects collected before and after insecticide spraying at the same house in all but one case, and they clustered together in a neighbor-joining tree. A clustering algorithm detected seven genetic groups, four of them mainly composed of baseline and postspraying insects from the same house. Assignment tests suggested multiple putative sources (including the house of collection) for most postspraying insects but excluded a house located more than 9 km from the study area. The origin of three triatomines was attributed to immigration from other unaccounted sources. Our study is compatible with the hypothesis that house reinfestations in the Argentine Chaco are mostly related to residual foci (i.e., survival of insects within the same community), in agreement with field observations, spatial analysis, and morphometric studies previously published.

  9. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  10. Organophosphate insecticide poisoning of Canada geese in the Texas panhandle

    Science.gov (United States)

    White, D.H.; Mitchell, C.A.; Wynn, L.D.; Flickinger, Edward L.; Kolbe, E.J.

    1982-01-01

    Sixteen hundred waterfowl, mostly Canada Geese, died near Etter, Texas, in late January 1981 from anticholinesterase poisoning. Winter wheat in the area of the die-off had been treated with organophosphate insecticides to control greenbugs. Cholinesterase (ChE) levels in brains of a sample of geese found dead were 75% below normal, enough to account for death (Ludke et al. 1975). The gastrointestinal (G I) tracts of geese found dead were packed with winter wheat; gas chromatography techniques identified parathion and methyl parathion in the GI tract contents. Residues of both chemicals were confirmed by mass spectrometry. We recommend that less toxic materials, such as malathion, be used on grain crops when waterfowl are in the vicinity of treatment.

  11. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  12. Review on Sources and Handling Method of Pesticide Residues in Animal Products

    Directory of Open Access Journals (Sweden)

    Indraningsih

    2006-06-01

    Full Text Available Field studies and literature search showed that some pesticide residues either organochlorines (OC or organophosphates (OP were detected in animal products (meat and milk . Pesticide residues in meat collected from West Java were detected at the level of 0 .8 ppb lindane and 62 ppb diazinon . While in meat from Lampung was detected at the level of 7 ppb lindane . 2 .7 heptachlor, 0 .8 endosulfan and 0 .5 ppb aldrin . Furthermore, pesticide residues were also detected in the milk collected from West, Central and East Java . The levels of lindane were 2,3 ; 15,9 ; 0,2 ppb ; heptachlor 8 ; 0 .4 and 0,05 ppb; diazinon 8 ; 0 and 1,8 ppb; CPM 0,4 ; 0,8 and 0 ppb ; endosulfan 0,1 ; 0,04 and 0,05 ppb for West, Central and East Java, respectively . The source of pesticide contamination in animal products is generally originated from feed materials, fodders . contaminated soils and water around the farm areas . Minimalization approach of pesticide residues in animal products could be conducted integratedly, such as through chemical process, biodegradation using microorganisms . Organic farming system is recognised as an alternative that may be applied to minimise contamination on agricultural land, eventually reducing pesticide residues in the agricultural products . Feeding with organic agricultural by-products with low pesticide residues appears to reduce pesticide residues in animal products . In order to eliminate pesticide contamination in soil, it has to be conducted progressively by implementing sustainable organic farming .

  13. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. CYP polymorphisms and pathological conditions related to chronic exposure to organochlorine pesticides

    Directory of Open Access Journals (Sweden)

    Anca Oana Docea

    Full Text Available The association between genetic variations in the cytochrome P450 (CYP family genes and pathological conditions related to long-term exposure to organochlorine compounds (OCs deserves further elucidation. OCs are persistent organic pollutants with bioaccumulative and lipophilic characteristics. They can act as endocrine disruptors and perturb cellular mechanisms. Prolonged exposure to OCs has been associated with different pathological manifestations. CYP genes are responsible for transcribing enzymes essential in xenobiotic metabolism. Therefore, polymorphisms in these genetic sequences a. alter the metabolic pathways, b. induce false cellular responses, and c. may provoke pathological conditions. The main aim of this review is to define the interaction between parameters a, b and c at a mechanistic/molecular level, with references in clinical cases. Keywords: Organochlorine compounds, Cytochrome P450, Genetic polymorphisms, Pathogenesis, Environmental pollutants

  15. Vertical distribution of organochlorine pesticides in humus along Alpine altitudinal profiles in relation to ambiental parameters

    Energy Technology Data Exchange (ETDEWEB)

    Kirchner, M., E-mail: kirchner@helmholtz-muenchen.d [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany); Faus-Kessler, T.; Jakobi, G.; Levy, W.; Henkelmann, B.; Bernhoeft, S.; Kotalik, J.; Zsolnay, A. [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany); Bassan, R. [Regional Agency for Environmental Prevention and Protection of Veneto (Italy); Belis, C. [Regional Agency for Environmental Protection of Lombardy (Italy); Kraeuchi, N. [Swiss Federal Institute for Forest, Snow and Landscape Research (Switzerland); Moche, W. [Federal Environment Agency Ltd. (Austria); Simoncic, P. [Slovenian Forestry Institute (Slovenia); Uhl, M.; Weiss, P. [Federal Environment Agency Ltd. (Austria); Schramm, K.-W. [Helmholtz Zentrum Muenchen, GmbH, Institutes of Ecological Chemistry, Developmental Genetics and Soil Ecology, Ingolstaedter Landstrasse 1, D-85764 Neuherberg (Germany)

    2009-12-15

    In forest soils along vertical profiles located in different parts of the Alps, concentrations of persistent organic pollutants (POPs), namely organochlorine pesticides (OCPs) like dichlorodiphenyltrichloroethanes (DDTs), hexachlorobenzene (HCB), hexachlorocyclohexanes (HCH), heptachlor, aldrin, dieldrin and mirex, were measured. Though local characteristics of the sites are influenced by numerous factors like orographic and meteorological parameters, forest stand characteristics and humus parameters, we ascertained a marked vertical increase of concentrations of some organochlorine compounds in the soil. On the basis of climatological values of each site, we found that the contamination increase with altitude can be ascribed to a certain 'cold condensation effect'. In addition, the perennial atmospheric deposition of POPs is controlled by precipitation. Other key parameters explaining the accumulation of POPs are the soil organic carbon stocks, the turnover times, the re-volatilisation and degradation processes, which vary with altitude. - Caused by temperature-dependent processes regarding deposition, re-volatilization and decomposition of POPs, the concentration of organochlorine pesticides varies in the Alpine region with altitude.

  16. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  17. Crystal structure of ryanodine receptor N-terminal domain from Plutella xylostella reveals two potential species-specific insecticide-targeting sites.

    Science.gov (United States)

    Lin, Lianyun; Liu, Chen; Qin, Juan; Wang, Jie; Dong, Shengjie; Chen, Wei; He, Weiyi; Gao, Qingzhi; You, Minsheng; Yuchi, Zhiguang

    2018-01-01

    Ryanodine receptors (RyRs) are large calcium-release channels located in sarcoplasmic reticulum membrane. They play a central role in excitation-contraction coupling of muscle cells. Three commercialized insecticides targeting pest RyRs generate worldwide sales over 2 billion U.S. dollars annually, but the structure of insect RyRs remains elusive, hindering our understanding of the mode of action of RyR-targeting insecticides and the development of insecticide resistance in pests. Here we present the crystal structure of RyR N-terminal domain (NTD) (residue 1-205) at 2.84 Å resolution from the diamondback moth (DBM), Plutella xylostella, a destructive pest devouring cruciferous crops all over the world. Similar to its mammalian homolog, DBM RyR NTD consists of a beta-trefoil folding motif and a flanking alpha helix. Interestingly, two regions in NTD interacting with neighboring domains showed distinguished conformations in DBM relative to mammalian RyRs. Using homology modeling and molecular dynamics simulation, we created a structural model of the N-terminal three domains, showing two unique binding pockets that could be targeted by potential species-specific insecticides. Thermal melt experiment showed that the stability of DBM RyR NTD was higher than mammalian RyRs, probably due to a stable intra-domain disulfide bond observed in the crystal structure. Previously DBM NTD was shown to be one of the two critical regions to interact with insecticide flubendiamide, but isothermal titration calorimetry experiments negated DBM NTD alone as a major binding site for flubendiamide. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Partitioning of organochlorine pesticides from water to polyethylene passive samplers

    International Nuclear Information System (INIS)

    Hale, Sarah E.; Martin, Timothy J.; Goss, Kai-Uwe; Arp, Hans Peter H.; Werner, David

    2010-01-01

    The mass transfer rates and equilibrium partitioning behaviour of 14 diverse organochlorine pesticides (OCP) between water and polyethylene (PE) passive samplers, cut from custom made PE sheets and commercial polyethylene plastic bags, were quantified. Overall mass transfer coefficients, k O , estimated PE membrane diffusion coefficients, D PE , and PE-water partitioning coefficients, K PE-water, are reported. In addition, the partitioning of three polycyclic aromatic hydrocarbons (PAHs) from water to PE is quantified and compared with literature values. K PE-water values agreed mostly within a factor of two for both passive samplers and also with literature values for the reference PAHs. As PE is expected to exhibit similar sorption behaviour to long-chain alkanes, PE-water partitioning coefficients were compared to hexadecane-water partitioning coefficients estimated with the SPARC online calculator, COSMOtherm and a polyparameter linear free energy relationship based on the Abraham approach. The best correlation for all compounds tested was with COSMOtherm estimated hexadecane-water partitioning coefficients. - The partitioning of organochlorine pesticides between single phase polyethylene passive samplers and water is quantified.

  19. Exposición prenatal a los plaguicidas organoclorados y criptorquidia Prenatal exposure to organochlorine pesticides and cryptorchidism

    Directory of Open Access Journals (Sweden)

    Lília Patrícia Bustamante Montes

    2010-06-01

    Full Text Available Los productos en desarrollo y los niños son particularmente vulnerables a los tóxicos ambientales. Nuestro objetivo es determinar los niveles de plaguicidas organoclorados (HCB, ß-HCH, pp'DDT, op'DDT y pp'DDE en lípidos séricos de madres de niños con criptorquidia y comparar los niveles con un grupo control de madres de niños con testículos descendidos. El grupo de los casos fue constituido por recién nacidos con diagnóstico de criptorquidia (n=41. El grupo control (n=41 se conformó por niños con testículos descendidos. A las madres de ambos grupos se les determinaron los niveles de plaguicidas organoclorados. La criptorquidia fue diagnosticada al nacimiento por neonatólogo. Residuos de plaguicidas organoclorados fueron encontrados en lípidos séricos de ambos grupos. Los niveles de la mediana (mgkg-1 en base lipídica fueron mayores para los metabolitos pp'DDT (0.464 vs. 0.269 y ß-HCH (0.263 vs. 0.192 en el grupo con criptorquidia comparado con el grupo control. (pFetuses and children are more susceptible to the effects of environmental toxins. The objective of this article is to determine the levels of organochlorine pesticides (HCB, ß-HCH, pp'DDT, op'DDT and pp'DDE in the serum lipids of mothers of newborns with cryptorchidism and compare the levels to a control group of mothers of newborns with descended testicles. The cases were composed of newborns with cryptorchidism (n=41, and the controls (n=41 newborns with descended testicles. Blood samples from both groups of mothers were used to determine the organochlorine pesticide levels. Cryptorchidism was diagnosed at birth by a neonatologist. The results showed that the organochlorine pesticide residues were found in the serum lipids of both groups of mothers. The median serum lipid levels (mgkg-1 lipid-based were statistically higher for the metabolites pp'DDT (0.464 vs. 0.269 and ß-HCH (0.263 vs. 0.192 in the cryptorchidism group compared to the control group (p<0.01. It

  20. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  1. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  2. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  3. Enhanced protection against malaria by indoor residual spraying in addition to insecticide treated nets: is it dependent on transmission intensity or net usage?

    Directory of Open Access Journals (Sweden)

    Philippa A West

    Full Text Available Insecticide treated nets (ITNs and indoor residual spraying (IRS are effective vector control tools that protect against malaria. There is conflicting evidence regarding whether using ITNs and IRS in combination provides additional benefit over using either of these methods alone. This study investigated factors that may modify the effect of the combined use of IRS and ITNs compared to using ITNs alone on malaria infection prevalence.Secondary analysis was carried out on data from a cluster randomised trial in north-west Tanzania. 50 clusters received ITNs from a universal coverage campaign; of these 25 were randomly allocated to additionally receive two rounds of IRS in 2012. In cross-sectional household surveys children 0.5-14 years old were tested for Plasmodium falciparum infections (PfPR two, six and ten months after the first IRS round.IRS protected those sleeping under nets (OR = 0.38, 95%CI 0.26-0.57 and those who did not (OR = 0.43, 95%CI 0.29-0.63. The protective effect of IRS was not modified by community level ITN use (ITN use = 50%, OR = 0.46, 95%CI 0.28-0.74. The additional protection from IRS was similar in low (<10% PfPR, OR = 0.38, 95%CI 0.19-0.75 and high transmission areas (≥10% PfPR, OR = 0.34, 95%CI 0.18-0.67. ITN use was protective at the individual-level regardless of whether the village had been sprayed (OR = 0.83, 95%CI 0.70-0.98. Living in a sprayed village was protective regardless of whether the individual slept under an ITN last night (OR = 0.41, 95%CI 0.29-0.58.Implementing IRS in addition to ITNs was beneficial for individuals from villages with a wide range of transmission intensities and net utilisation levels. Net users received additional protection from IRS. ITNs were providing some individual protection, even in this area with high levels of pyrethroid insecticide resistance. These results demonstrate that there is a supplementary benefit of IRS even when ITNs are effective.ClinicalTrials.gov NCT01697852.

  4. Organochlorine compounds and the biogeochemical cycle of chlorine in soils: A review

    Science.gov (United States)

    Vodyanitskii, Yu. N.; Makarov, M. I.

    2017-09-01

    Chloride ions in soil may interact with soil organic matter and form organochlorine compounds in situ. The biotic chlorination of soil organic substances takes places under aerobic conditions with participation of H2O2 forming from peroxidases released by soil microorganisms (in particular, by microscopic fungi). The abiotic chlorination results also from the redox reactions with the participation of Fe3+/Fe2+ system, but it develops several times slower. Chlorination of soil organic substances is favored by Cl- coming to soil both from natural (salinized soil-forming rocks and groundwater, sea salt) and anthropogenic sources of chlorides, i.e., spills of saline water at oil production, road deicing chemicals, mineral fertilizers, etc. The study of the biogeochemical chlorine cycle should take into account the presence of organochlorine compounds in soils, in addition to transformation and migration of chloride ions.

  5. Organochlorine compounds in soils and sediments of the mountain Andean Lakes

    International Nuclear Information System (INIS)

    Borghini, Francesca; Grimalt, Joan O.; Sanchez-Hernandez, Juan C.; Barra, Ricardo; Garcia, Carlos J. Torres; Focardi, Silvano

    2005-01-01

    Semi-volatile organochlorine compounds (OC) were analyzed in remote Andean soils and lake sediments. The sampling sites covered a wide latitudinal gradient from 18 deg. S to 46 deg. S along Chile and an altitudinal gradient (10-4500 m). The concentrations were in the order of background levels, involving absence of major pollution sources in the high mountain areas. Significant correlations were found between log-transformed concentrations of hexachlorobenzene, α- and γ-hexachlorocyclohexane in soils and total organic content (TOC). In addition, TOC-normalized concentrations of the most volatile OC showed a significant linear dependence with air temperature. This good agreement points to temperature as a significant factor for the retention of long range transported OC in remote ecosystems such as the Andean mountains, although other variables should not be totally excluded. The highest concentrations of OCs were achieved in the sites located at highest altitude and lowest temperature of the dataset. - Distribution of persistent organochlorine compounds in the Andean Mountain lakes is influenced by temperature

  6. 14C-Profenofos Residues in Milk and Milk Products

    International Nuclear Information System (INIS)

    Fakhr, I.M.I.; Afifi, L.M.; Fouzy, A.S.M.; Hegazi, B.

    1999-01-01

    Treatment of lactating goats with only one dose of 14 C-ethoxy profenofos (17.9 mg/Kg) in gelatin capsules and then feeding normally, resulted in the presence of 0.5% of the radioactive insecticide residues in the milk collected through the fourteen successive days. The highest activity level was depicted at the first day and almost disappeared after two weeks. After processing, the analysis of milk products revealed difference in radioactive residue level according to the nature of the product and increased in the order: whey< skim < yoghurt < pasteurized milk < cheese< cream. TLC analysis of milk and milk products revealed the absence of the parent compound and the presence of 4 major metabolites, which were identified by co-chromatography with authentic compounds

  7. The development of insecticide-treated durable wall lining for malaria control: insights from rural and urban populations in Angola and Nigeria

    Directory of Open Access Journals (Sweden)

    Messenger Louisa A

    2012-09-01

    Full Text Available Abstract Background Durable lining (DL is a deltamethrin-impregnated polyethylene material, which is designed to cover domestic walls that would normally be sprayed with residual insecticide. The operational success of DL as a long-lasting insecticidal substrate will be dependent on a high level of user acceptability as households must maintain correctly installed linings on their walls for several years. Preliminary trials were undertaken to identify a material to develop into a marketable wall lining and to assess its level of acceptability among rural and urban populations. Methods In Angola (n=60, prototype DL and insecticide-treated plastic sheeting (ITPS were installed on urban house walls and ceilings, respectively, and acceptability was compared to indoor residual spraying (IRS (n=20 using a knowledge, attitude and practice (KAP questionnaire. In Nigeria (n=178, three materials (prototype DL, ITPS and insecticide-treated wall netting were distributed among rural and urban households. User opinions were gathered from focus group discussions, in-depth interviews and KAP questionnaires. Results In Angola, after two weeks, the majority of participants (98% expressed satisfaction with the products and identified the killing of insects as the materials’ principal benefits (73%. After one year, despite a loss of almost 50% of households to refugee repatriation, all 32 remaining households still asserted that they had liked the DL/ITPS in their homes and given the choice of intervention preferred DL/ITPS to IRS (94% or insecticide-treated nets (78%. In Nigeria, a dichotomy between rural and urban respondents emerged. Rural participants favoured wall adornments and accepted wall linings because of their perceived decorative value and entomological efficacy. By contrast, urban households preferred minimal wall decoration and rejected the materials based upon objections to their aesthetics and installation feasibility. Conclusions The high level

  8. The development of insecticide-treated durable wall lining for malaria control: insights from rural and urban populations in Angola and Nigeria

    Science.gov (United States)

    2012-01-01

    Background Durable lining (DL) is a deltamethrin-impregnated polyethylene material, which is designed to cover domestic walls that would normally be sprayed with residual insecticide. The operational success of DL as a long-lasting insecticidal substrate will be dependent on a high level of user acceptability as households must maintain correctly installed linings on their walls for several years. Preliminary trials were undertaken to identify a material to develop into a marketable wall lining and to assess its level of acceptability among rural and urban populations. Methods In Angola (n=60), prototype DL and insecticide-treated plastic sheeting (ITPS) were installed on urban house walls and ceilings, respectively, and acceptability was compared to indoor residual spraying (IRS) (n=20) using a knowledge, attitude and practice (KAP) questionnaire. In Nigeria (n=178), three materials (prototype DL, ITPS and insecticide-treated wall netting) were distributed among rural and urban households. User opinions were gathered from focus group discussions, in-depth interviews and KAP questionnaires. Results In Angola, after two weeks, the majority of participants (98%) expressed satisfaction with the products and identified the killing of insects as the materials’ principal benefits (73%). After one year, despite a loss of almost 50% of households to refugee repatriation, all 32 remaining households still asserted that they had liked the DL/ITPS in their homes and given the choice of intervention preferred DL/ITPS to IRS (94%) or insecticide-treated nets (78%). In Nigeria, a dichotomy between rural and urban respondents emerged. Rural participants favoured wall adornments and accepted wall linings because of their perceived decorative value and entomological efficacy. By contrast, urban households preferred minimal wall decoration and rejected the materials based upon objections to their aesthetics and installation feasibility. Conclusions The high level of acceptability

  9. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  10. Insecticide Resistance in Eggs and First Instars of the Bed Bug, Cimex lectularius (Hemiptera: Cimicidae

    Directory of Open Access Journals (Sweden)

    Brittany E. Campbell

    2015-01-01

    Full Text Available Two strains of the common bed bug, Cimex lectularius L., eggs and first instars collected from pyrethroid-resistant adults were evaluated for insecticide resistance and compared to a susceptible strain. Dose-response bioassays were conducted using two insecticide formulations (Temprid: imidacloprid/β-cyfluthrin, and Transport: acetamiprid/ bifenthrin. The lethal concentration (LC50 for the two resistant egg strains exposed to imidacloprid/β-cyfluthrin ranged from 3 to 5-fold higher than susceptible strain eggs. Resistant strain eggs dipped into formulations of acetamiprid/bifenthrin had LC50 values which were significantly greater (39 to 1,080-fold than susceptible strain eggs. Similar to eggs, resistant strain first instars exposed to residual applications of imidacloprid/β-cyfluthrin had LC50 values ranging from 121 to 493-fold greater than susceptible strain first instars. When resistant strain first instars were treated with acetamiprid/bifenthrin, they had LC50 values that were 99 to >1,900-fold greater than susceptible strain first instars. To determine differences between egg and first instar resistance, stage resistance ratios (SRR were compared between the two stages. There was little difference between the egg and first instar stages, indicated by small SRR values ranging from 1.1 to 10.0. This study suggests that insecticide resistance is expressed early during bed bug development.

  11. N6-(2-Hydroxyethyl)-Adenosine Exhibits Insecticidal Activity against Plutella xylostella via Adenosine Receptors.

    Science.gov (United States)

    Fang, Ming; Chai, Yiqiu; Chen, Guanjv; Wang, Huidong; Huang, Bo

    The diamondback moth, Plutella xylostella, is one of the most important pests of cruciferous crops. We have earlier shown that N6-(2-hydroxyethyl)-adenosine (HEA) exhibits insecticidal activity against P. xylostella. In the present study we investigated the possible mechanism of insecticidal action of HEA on P. xylostella. HEA is a derivative of adenosine, therefore, we speculated whether it acts via P. xylostella adenosine receptor (PxAdoR). We used RNAi approach to silence PxAdoR gene and used antagonist of denosine receptor (AdoR) to study the insecticidal effect of HEA. We cloned the whole sequence of PxAdoR gene. A BLAST search using NCBI protein database showed a 61% identity with the Drosophila adenosine receptor (DmAdoR) and a 32-35% identity with human AdoR. Though the amino acids sequence of PxAdoR was different compared to other adenosine receptors, most of the amino acids that are known to be important for adenosine receptor ligand binding and signaling were present. However, only 30% binding sites key residues was similar between PxAdoR and A1R. HEA, at a dose of 1 mg/mL, was found to be lethal to the second-instar larvae of P. xylostella, and a significant reduction of mortality and growth inhibition ratio were obtained when HEA was administered to the larvae along with PxAdoR-dsRNA or antagonist of AdoR (SCH58261) for 36, 48, or 60 h. Especially at 48 h, the rate of growth inhibition of the PxAdoR knockdown group was 3.5-fold less than that of the HEA group, and the corrected mortality of SCH58261 group was reduced almost 2-fold compared with the HEA group. Our findings show that HEA may exert its insecticidal activity against P. xylostella larvae via acting on PxAdoR.

  12. Geochemical distribution of trace metals and organochlorine contaminants of a lake ontario shoreline marsh

    Energy Technology Data Exchange (ETDEWEB)

    Glooschenko, W A; Capocianco, J; Coburn, J; Glooschenko, V

    1981-02-01

    Rattray Marsh, an 8 ha marsh on the Lake Ontario shoreline at Mississauga, Ontario, is an important local habitat for waterfowl and shorebirds during spring and fall migration. A study was conducted to determine the distribution of nutrients (carbon, nitrogen, and phosphorus) and potential trace metal and organochlorine pollutants in the marsh as evidenced by the sedimentary concentrations of these compounds. Generally, copper, zinc, lead, and mercury were higher in concentration in local soils than in Lake Ontario sediments. Metals and organic carbon levels did not correlate, and the metals appeared to be associated with silts and clays. Organochlorine contaminants include p,p1-DDE, p,p1-DDD, p,p1-DDT, alpha-chlordane, PCB, mirex, and HCB.

  13. Socio-economic inequity in demand for insecticide-treated nets, in-door residual house spraying, larviciding and fogging in Sudan

    Directory of Open Access Journals (Sweden)

    Mustafa Sara

    2005-12-01

    Full Text Available Abstract Background In order to optimally prioritize and use public and private budgets for equitable malaria vector control, there is a need to determine the level and determinants of consumer demand for different vector control tools. Objectives To determine the demand from people of different socio-economic groups for indoor residual house-spraying (IRHS, insecticide-treated nets (ITNs, larviciding with chemicals (LWC, and space spraying/fogging (SS and the disease control implications of the result. Methods Ratings and levels of willingness-to-pay (WTP for the vector control tools were determined using a random cross-sectional sample of 720 householdes drawn from two states. WTP was elicited using the bidding game. An asset-based socio-economic status (SES index was used to explore whether WTP was related to SES of the respondents. Results IRHS received the highest proportion of highest preferred rating (41.0% followed by ITNs (23.1%. However, ITNs had the highest mean WTP followed by IRHS, while LWC had the least. The regression analysis showed that SES was positively and statistically significantly related to WTP across the four vector control tools and that the respondents' rating of IRHS and ITNs significantly explained their levels of WTP for the two tools. Conclusion People were willing to pay for all the vector-control tools, but the demand for the vector control tools was related to the SES of the respondents. Hence, it is vital that there are public policies and financing mechanisms to ensure equitable provision and utilisation of vector control tools, as well as protecting the poor from cost-sharing arrangements.

  14. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  15. High entomological inoculation rate of malaria vectors in area of high coverage of interventions in southwest Ethiopia: Implication for residual malaria transmission

    Directory of Open Access Journals (Sweden)

    Misrak Abraham

    2017-05-01

    Finally, there was an indoor residual malaria transmission in a village of high coverage of bed nets and where the principal malaria vector is susceptibility to propoxur and bendiocarb; insecticides currently in use for indoor residual spraying. The continuing indoor transmission of malaria in such village implies the need for new tools to supplement the existing interventions and to reduce indoor malaria transmission.

  16. Detection of pesticides residues in water samples from organic and conventional paddy fields of Ledang, Johor, Malaysia

    Science.gov (United States)

    Abdullah, Md Pauzi; Othman, Mohamed Rozali; Ishak, Anizan; Nabhan, Khitam Jaber

    2016-11-01

    Pesticides have been used extensively by the farmers in Malaysia during the last few decades. Sixteen water samples, collected from paddy fields both organic and conventional, from Ledang, Johor, were analyzed to determine the occurrence and distribution of organochlorine (OCPs) and organophosphorus (OPPs) pesticide residues. GC-ECD instrument was used to identify and determine the concentrations of these pesticide residues. Pesticide residues were detected in conventional fields in the range about 0.036-0.508 µg/L higher than detected in organic fields about 0.015-0.428 µg/L. However the level of concentration of pesticide residues in water sample from both paddy fields are in the exceed limit for human consumption, according to European Economic Commission (EEC) (Directive 98/83/EC) at 0.1 µg/L for any pesticide or 0.5 µg/L for total pesticides. The results that the organic plot is still contaminated with pesticides although pesticides were not use at all in plot possibly from historical used as well as from airborne contamination.

  17. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  18. 78 FR 56185 - Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or on Various...

    Science.gov (United States)

    2013-09-12

    ... 40 CFR part 180 for residues of the insecticide diflubenzuron, N-[[(4- chlorophenyl)amino]-carbonyl... acid, and cis-and trans-3-chloroallylalcohol, in or on the commodity. The proposed tolerances are to... in grapes. Adequate enforcement methodology, using capillary gas chromatography with mass selective...

  19. Comparison of ingestion and topical application of insecticides against the common bed bug, Cimex lectularius (Hemiptera: Cimicidae)

    Science.gov (United States)

    Sierras, Angela; Schal, Coby

    2016-01-01

    Background The global prevalence of Cimex lectularius infestations has challenged current intervention efforts, as pyrethroid resistance has become ubiquitous, availability of labeled insecticides for bed bugs is limited, and non-chemical treatment options, such as heat, are often unaffordable. We evaluated representative insecticides toward the goal of developing a novel, ingestible liquid bait for hematophagous arthropods. Results LC50 values were estimated for adult males and first instar nymphs of an insecticide-susceptible strain for abamectin, clothianidin, fipronil and indoxacarb, after ingestion from an in vitro feeder. LD50 values were calculated based on the ingested blood volume. Ingested abamectin, clothianidin and fipronil caused rapid mortality in both life stages. Fipronil was ∼43-fold more effective by ingestion than by topical application. Indoxacarb and its bioactive metabolite decarbomethoxyllated JW062 (DCJW) were ineffective at causing bed bug mortality even at concentrations as high as 1000 ng mL−1 blood. Conclusions Fipronil, clothianidin and abamectin have potential for being incorporated into a liquid bait for bed bug control; indoxacarb and DCJW were not effective. Bed bugs are a good candidate for an ingestible liquid bait because systemic formulations generally require less active ingredient than residual sprays, they remain contained and more effectively target hematophagous arthropods. PMID:27766740

  20. Prenatal exposure to persistent organochlorine pollutants and female reproductive function in young adulthood

    DEFF Research Database (Denmark)

    Kristensen, Susanne Lund; Ramlau-Hansen, Cecilia Høst; Ernst, Erik

    2016-01-01

    . OBJECTIVES: To investigate effects on female reproduction following intrauterine exposure to selected biopersistent organochlorines. METHODS: We used data from a Danish pregnancy cohort with follow-up on 436 eligible daughters at approximately 20years of age. Information on age of menarche (n=335), menstrual...... cycle length (n=230) and serum concentrations of reproductive hormones (n=243) was obtained. Number of antral follicles was counted by vaginal ultrasound (n=147). Of 244 daughters who attended clinical examination, 170 used hormonal contraceptives and 74 were non-users. Concentrations of p,p'-DDE, HCB...... and six PCB congeners were analysed in maternal serum samples obtained in pregnancy week 30. RESULTS: Age of menarche and menstrual cycle length were found not to be statistically significant associated with prenatal organochlorine exposure. Among non-users of hormonal contraceptives with information...

  1. Effect of commercial processing procedures on 14C-LINDANE residues in corn oil

    International Nuclear Information System (INIS)

    Soliman, S.M.

    2006-01-01

    At blooming, maize plants were sprayed twice, 23 days apart, at a dose of 22 mg equivalent to 5 μCi/ plant. At post harvest, maize seeds had a radioactivity corresponding to 0.36% of the applied dose. The insecticide residues in crude oil, cake and methanolic extract were amounted to 8 % and 60 % 5 % , respectively, of original residues inside the seeds.The 14 C-activity in the crude oil could be reduced by commercial processes locally used for refining. The refined oil had a residue level of about 0.7 ppm mainly in the form of unchanged lindane in addition to a number of chloro phenols as main metabolites. Refining of corn oil fortified with 14 C-lindane led to a high reduction of 14 C-lindane (88%). The refined oil contained a residue consisting lindane and its chloro phenols

  2. Organochlorine pesticides in the atmosphere of Guangzhou and Hong Kong: Regional sources and long-range atmospheric transport

    Science.gov (United States)

    Li, Jun; Zhang, Gan; Guo, Lingli; Xu, Weihai; Li, Xiangdong; Lee, Celine S. L.; Ding, Aijun; Wang, Tao

    Organochlorine pesticides (OCPs) were measured in the atmosphere over the period of December 2003-December 2004 at four sampling sites in Guangzhou and Hong Kong. Gas phase and particle phase concentrations of 8 OCP species, including trans-chlordane ( t-CHL), cis-chlordane ( c-CHL), p, p'-DDT, p, p'-DDE, o, p'-DDT, α-endosulfan, α- and γ-hexachlorocyclohexane (HCH), were studied. OCPs were found predominantly in the gas phase in all seasons. t-CHL, c-CHL, o, p'-DDT, p, p'-DDT and α-endosulfan had significantly ( pGuangzhou could be attributed to the present usage of lindane and dicofol in the Pearl River Delta (PRD) region. The very high concentrations of p, p'-DDT and α-endosulfan were observed at all sampling sites. The results of 7 days air back trajectory analysis indicated that the unusual high p, p'-DDT levels in summer in both cities could be related to the seasonal usage of DDT containing antifouling paints for fishing ships in the upwind seaports of the region. The high concentrations of α-endosulfan in winter in the study area suggested an atmospheric transport by the winter monsoon from the East China, where endosulfan is being used as insecticide in cotton fields. The consistency of the seasonal variation of concentrations and isomeric ratios of DDTs and α-endosulfan with the alternation of winter monsoon and summer monsoon suggested that the Asian monsoon plays an important role in the long-range atmospheric transport of OCPs.

  3. High organochlorine accumulation in blubber of Guiana dolphin, Sotalia guianensis, from Brazilian coast and its use to establish geographical differences among populations

    International Nuclear Information System (INIS)

    Lailson-Brito, J.; Dorneles, P.R.; Azevedo-Silva, C.E.; Azevedo, A.F.; Vidal, L.G.; Zanelatto, R.C.; Lozinski, C.P.C.; Azeredo, A.; Fragoso, A.B.L.

    2010-01-01

    Blubber samples from 33 Guiana dolphins (Sotalia guianensis) from three estuaries (Guanabara, Sepetiba/Ilha Grande and Paranagua Bays) of Southern and Southeastern Brazil were analyzed for organochlorine compounds (DDTs, PCBs and HCB). The sampled individuals were incidentally captured in gillnet fishery between 1995 and 2005. The concentrations (in ng/g lipids) varied from 652 to 23 555 for ΣDDT; from 765 to 99 175 for ΣPCB; and from <4.4 to 156 for HCB. The results have shown that cetaceans from Brazil present organochlorine concentrations that are comparable to those reported for highly industrialized regions of Northern Hemisphere. Using discriminant analysis it was possible to verify that the dolphin populations from the three bays present different organochlorine accumulation patterns. This feature allows the use of this set of pollutants as an auxiliary tool for identification of different populations of the species off Brazilian Coast. - The site fidelity of Guiana dolphins inhabiting polluted environments allows population differentiation through discriminant analysis using organochlorine profiles.

  4. High organochlorine accumulation in blubber of Guiana dolphin, Sotalia guianensis, from Brazilian coast and its use to establish geographical differences among populations

    Energy Technology Data Exchange (ETDEWEB)

    Lailson-Brito, J., E-mail: lailson@biof.ufrj.b [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil); Instituto de Biofisica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro (UFRJ) (Brazil); Dorneles, P.R., E-mail: dorneles.paulo@uerj.b [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil); Instituto de Biofisica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro (UFRJ) (Brazil); Azevedo-Silva, C.E., E-mail: ceass@biof.ufrj.b [Instituto de Biofisica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro (UFRJ) (Brazil); Azevedo, A.F., E-mail: azevedo.alex@uerj.b [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil); Vidal, L.G. [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil); Zanelatto, R.C. [Pro- Reitoria de Administracao, Universidade Federal do Parana, Curitiba (Brazil); Lozinski, C.P.C. [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil); Azeredo, A., E-mail: aazeredo@uefs.b [Instituto de Biofisica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro (UFRJ) (Brazil); Colegiado de Ciencias Farmaceuticas, Departamento de Saude, Universidade Estadual de Feira de Santana (UEFS) (Brazil); Fragoso, A.B.L. [Laboratorio de Mamiferos Aquaticos e Bioindicadores ' Prof. Izabel Gurgel' (MAQUA), Faculdade de Oceanografia, Universidade do Estado do Rio de Janeiro (UERJ) (Brazil)

    2010-05-15

    Blubber samples from 33 Guiana dolphins (Sotalia guianensis) from three estuaries (Guanabara, Sepetiba/Ilha Grande and Paranagua Bays) of Southern and Southeastern Brazil were analyzed for organochlorine compounds (DDTs, PCBs and HCB). The sampled individuals were incidentally captured in gillnet fishery between 1995 and 2005. The concentrations (in ng/g lipids) varied from 652 to 23 555 for SIGMADDT; from 765 to 99 175 for SIGMAPCB; and from <4.4 to 156 for HCB. The results have shown that cetaceans from Brazil present organochlorine concentrations that are comparable to those reported for highly industrialized regions of Northern Hemisphere. Using discriminant analysis it was possible to verify that the dolphin populations from the three bays present different organochlorine accumulation patterns. This feature allows the use of this set of pollutants as an auxiliary tool for identification of different populations of the species off Brazilian Coast. - The site fidelity of Guiana dolphins inhabiting polluted environments allows population differentiation through discriminant analysis using organochlorine profiles.

  5. Sentinel California sea lions provide insight into legacy organochlorine exposure trends and their association with cancer and infectious disease

    Directory of Open Access Journals (Sweden)

    Nistara Randhawa

    2015-12-01

    Conclusion: Organochlorine contamination has significant associations with health outcomes in California sea lions, raising concerns for humans and other animals eating tainted seafood. While environmental exposure to these organochlorines appears to be decreasing over time based on levels in sea lion tissues, their persistence in the environment and food web for all predators, including humans, and the associated serious health risks, warrant monitoring, possibly through sentinel species like marine mammals.

  6. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  7. Evidence for Dual Binding Sites for 1,1,1-Trichloro-2,2-bis(p-chlorophenyl)ethane (DDT) in Insect Sodium Channels.

    Science.gov (United States)

    Du, Yuzhe; Nomura, Yoshiko; Zhorov, Boris S; Dong, Ke

    2016-02-26

    1,1,1-Trichloro-2,2-bis(p-chlorophenyl)ethane (DDT), the first organochlorine insecticide, and pyrethroid insecticides are sodium channel agonists. Although the use of DDT is banned in most of the world due to its detrimental impact on the ecosystem, indoor residual spraying of DDT is still recommended for malaria control in Africa. Development of resistance to DDT and pyrethroids is a serious global obstacle for managing disease vectors. Mapping DDT binding sites is necessary for understanding mechanisms of resistance and modulation of sodium channels by structurally different ligands. The pioneering model of the housefly sodium channel visualized the first receptor for pyrethroids, PyR1, in the II/III domain interface and suggested that DDT binds within PyR1. Previously, we proposed the second pyrethroid receptor, PyR2, at the I/II domain interface. However, whether DDT binds to both pyrethroid receptor sites remains unknown. Here, using computational docking of DDT into the Kv1.2-based mosquito sodium channel model, we predict that two DDT molecules can bind simultaneously within PyR1 and PyR2. The bulky trichloromethyl group of each DDT molecule fits snugly between four helices in the bent domain interface, whereas two p-chlorophenyl rings extend into two wings of the interface. Model-driven mutagenesis and electrophysiological analysis confirmed these propositions and revealed 10 previously unknown DDT-sensing residues within PyR1 and PyR2. Our study proposes a dual DDT-receptor model and provides a structural background for rational development of new insecticides. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  8. Pesticides residue levels in selected fruits from some Ghanaian markets

    International Nuclear Information System (INIS)

    Bempah, K.C.

    2009-02-01

    The amount of some pesticide residues in fruits was monitored at five (5) Accra Metropolis markets. Locally produced fruits (pawpaw and tomato) and imported apples were purchased from two supermarkets and three urban markets in Accra metropolis and analyzed by gas chromatography equipped with electron capture detector for pesticide residues. A total of 220 samples of fruits were extracted and analyzed for pesticide residues, mainly organochlorines (γ-HCH, δ-HCH, aldrin, heptachlor, γ-chlordane, heptachlor epoxide, α-endosulfan, p,p'-DDE, endrin, β-endosulfan, o,p'-DDT, endrin aldehyde, p,p'- DDT, endrin ketone and methoxychlor). The data showed that most of the fruit samples analyzed contain residues of the monitored pesticides above the accepted maximum residue limit (MRL) as adopted by the FAO/WHO Codex Alimentarius Commission (CAC). The results obtained showed that 38.6 % fruit samples showed results above the MRL, 48.7 % were below the MRL and 12.7 % contained no detectable level of the monitored pesticides. Data analysis of health risk estimates indicated that, particularly γ-HCH, δ-HCH, o,p'-DDT, p,p'-DDE or p,p'-DDT do not pose a direct hazard to human health, although present in the three fruits (pawpaw, tomato and apple). However, heptachlor, heptachlor epoxide, endrin aldehyde, and endrin ketone levels exceeded the reference dose, indicating a great potential for systemic toxicity, especially in children who are considered to be the most vulnerable population subgroup. Lastly, the public is aware of pesticide residues in fruits and advocates for the curtailing of pesticide use on horticulture produce or strong educational programmes for farmers on control and safer use of pesticides. (au)

  9. Accumulation of current-use and organochlorine pesticides in crab embryos from northern California, USA.

    Science.gov (United States)

    Smalling, Kelly L; Morgan, Steven; Kuivila, Kathryn K

    2010-11-01

    Invertebrates have long been used as resident sentinels for assessing ecosystem health and productivity. The shore crabs, Hemigrapsus oregonensis and Pachygrapsus crassipes, are abundant in estuaries and beaches throughout northern California, USA and have been used as indicators of habitat conditions in several salt marshes. The overall objectives of the present study were to conduct a lab-based study to test the accumulation of current-use pesticides, validate the analytical method and to analyze field-collected crabs for a suite of 74 current-use and legacy pesticides. A simple laboratory uptake study was designed to determine if embryos could bioconcentrate the herbicide molinate over a 7-d period. At the end of the experiment, embryos were removed from the crabs and analyzed by gas chromatography/mass spectrometry. Although relatively hydrophilic (log K(OW) of 2.9), molinate did accumulate with an estimated bioconcentration factor (log BCF) of approximately 2.5. Following method validation, embryos were collected from two different Northern California salt marshes and analyzed. In field-collected embryos 18 current-use and eight organochlorine pesticides were detected including synthetic pyrethroids and organophosphate insecticides, as well as DDT and its degradates. Lipid-normalized concentrations of the pesticides detected in the field-collected crab embryos ranged from 0.1 to 4 ppm. Pesticide concentrations and profiles in crab embryos were site specific and could be correlated to differences in land-use practices. These preliminary results indicate that embryos are an effective sink for organic contaminants in the environment and have the potential to be good indicators of ecosystem health, especially when contaminant body burden analyses are paired with reproductive impairment assays. © 2010 SETAC.

  10. The residual efficacy of a cypermethrin pour-on formulation applied on goats on the mortality and blood intake of Triatoma infestans

    Directory of Open Access Journals (Sweden)

    Ivana Amelotti

    2012-12-01

    Full Text Available Triatoma infestans is the main vector of Trypanosoma cruzi, the aetiological agent of Chagas disease in the Gran Chaco region of South America. As a frequent blood meal source for triatomine bugs, domestic goats play a key role in the eco-epidemiology of Chagas disease. The aim of this study was to evaluate the mortality and blood intake of T. infestans fed on goats that had been treated with different doses of pour-on insecticide. Third-instar nymphs were fed on goats that had been treated with 0 cc, 5 cc, 10 cc or 15 cc of a pour-on formulation of cypermethrin. The exposure of T. infestans to animals treated at different post-application intervals revealed a residual activity of the insecticide. The mortality rate in the treated groups was higher than in the control groups until 30 days post-insecticide application (p = 0.03, except in the group treated with 5 cc, in which no mortality was detected after seven days of insecticide application. Rainfall affected the triatomicide effect, reducing the time of residual activity. The cypermethrin pour-on treatment decreased the blood intake of T. infestans. Thirty days after the cypermethrin application, nymph mortality was 16% (± 13 with both doses (10 cc and 15 cc. The 15 cc dose did not result in higher insect mortality or increased persistence compared to the 10 cc dose.

  11. Current trends of some organochlorinated pesticides in Yamuna River sediments around Delhi

    Digital Repository Service at National Institute of Oceanography (India)

    Sethi, P.K.; Bhattacharyya, A.K.; Sarkar, A.

    selected for the purpose of study. Among the organochlorine pesticides detected, t-DDT was the most predominant in the sediments of Yamuna River. The concentration of t-DDT was in the range of 63.0-236.0 ng/g during the pre-monsoon and decreased...

  12. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  13. Sensitivity of Bemisia Tabaci (Hemiptera: Aleyrodidae) to Several New Insecticides in China: Effects of Insecticide Type and Whitefly Species, Strain, and Stage

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040

  14. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  15. Protective effect and economic impact of insecticide application methods on barley

    Directory of Open Access Journals (Sweden)

    Alfred Stoetzer

    2014-03-01

    Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.

  16. DETERMINATION OF ORGANOCHLORINE PESTICIDES IN DRINKING WATERS SAMPLED FROM CLUJ AND HUNEDOARA COUNTIES

    Directory of Open Access Journals (Sweden)

    MARIA-ELISABETA LOVÁSZ

    2011-03-01

    Full Text Available Determination of organochlorine pesticides in drinking waterssampled from Cluj and Hunedoara counties. Pesticides are found scattered indifferent environmental factors (water, air, soil wherefrom they are drawn off byvegetal and animal organisms. Water pollution by pesticides results from the plantprotection products industry and also from massive application of these resourcesin agriculture and other branches of economy. Pesticides can reach surface wateralong with dripping waters and by infiltration may reach the groundwater layers,organochlorine pesticides are most often found in the water sources (dieldrin,endrin, DDT, aldrin, lindane, heptachlor, etc. due to their increased persistence inthe external environment. This study followed up the determination oforganochlorine pesticides in 14 drinking water samples collected from the outputof water treatment plants in Cluj and Hunedoara counties that process surfacewater and deep-water sources. For identification of organochlorine pesticides, thegas chromatographic method after liquid-liquid extraction was used, by a gascromatograph Shimadzu GC 2010 with detector ECD (Electron CaptureDetection. There were not detected higher values than the method detection limit(0.01 μg/l in the drinking water samples collected and analyzed for both totalorganochlorine pesticides and components, which were well below the maximumconcentration admitted by Law 452/2002 regarding drinking water quality. Resultsare correlated with the sanitary protection areas for water sources and with the useof agricultural lands in the area. The solution to reduce risk of pesticides use isecological agriculture , which gains increasingly more ground in Romania too.

  17. Organochlorine pesticide, polychlorinated biphenyl, trace element and metal residues in bird eggs from Salton Sea, California, 2004

    Science.gov (United States)

    Henny, Charles J.; Anderson, T.W.; Crayon, J.J.

    2008-01-01

    The Salton Sea is a highly eutrophic, hypersaline terminal lake that receives inflows primarily from agricultural drainages in the Imperial and Coachella valleys. Impending reductions in water inflow at Salton Sea may concentrate existing contaminants which have been a concern for many years, and result in higher exposure to birds. Thus, waterbird eggs were collected and analyzed in 2004 and compared with residue concentrations from earlier years; these data provide a base for future comparisons. Eggs from four waterbird species (black-crowned night-heron [Nycticorax nycticorax], great egret [Ardea alba], black-necked stilt [Himantopus mexicanus], and American avocet [Recurvirostra Americana]) were collected. Eggs were analyzed for organochlorine pesticides, polychlorinated biphenyls (PCBs), metals, and trace elements, with current results compared to those reported for eggs collected from the same species and others during 1985a??1993. The two contaminants of primary concern were p,pa??-DDE (DDE) and selenium. DDE concentrations in night-heron and great egret eggs collected from the northwest corner of Salton Sea (Whitewater River delta) decreased 91 and 95%, respectively, by 2004, with a concomitant increase in eggshell thickness for both species. Decreases in bird egg DDE levels paralleled those in tissues of tilapia (Oreochromis mossambicus ?? O. urolepis), an important prey species for herons and egrets. Despite most nests of night-herons and great egrets failing in 2004 due to predation, predicted reproductive effects based on DDE concentrations in eggs were low or negligible for these species. The 2004 DDE findings were in dramatic contrast to those in the past decade, and included an 81% decrease in black-necked stilt eggs, although concentrations were lower historically than those reported in night-herons and egrets. Selenium concentrations in black-necked stilt eggs from the southeast corner of Salton Sea (Davis Road) were similar in 1993 and 2004, with 4

  18. Alternative treatments for indoor residual spraying for malaria control in a village with pyrethroid- and DDT-resistant vectors in The Gambia

    NARCIS (Netherlands)

    Tangena, J.A.A.; Adiamoh, M.; Alessandro, D' U.; Jarju, L.; Jawara, M.; Jeffries, D.; Malik, N.; Nwakanma, D.; Kaur, H.; Takken, W.; Lindsay, S.W.; Pinder, M.

    2013-01-01

    Background: Malaria vector control is threatened by resistance to pyrethroids, the only class of insecticides used for treating bed nets. The second major vector control method is indoor residual spraying with pyrethroids or the organochloride DDT. However, resistance to pyrethroids frequently

  19. Organochlorine Pesticides (OCs) and Polychlorinated Biphenyls (PCBs) in Tilapia zillii from Lake El-Manzala, Egypt

    International Nuclear Information System (INIS)

    El-Greisy, Zeinab Abdalbagi; Abdallah, A. Mohamed Ali

    2005-01-01

    A fresh water fish species, (Tilapia zillii) from Lake El-Manzala was analyzed for concentrations of several Organochlorine pesticides (OCs) and Polychlorine piphenyl's (PCBs) in liver, gonads, mesenteric fat, flesh and the digestive tract in mature fish during the breeding season. Polychlorinated piphenyls (PCBs) and Organochloripe pesticides (OCs) were calculated in (ng/g) dry weight (dw) in homogenized samples. The obtained results revealed differences in lipid content between these different organs. The females showed higher lipid content than males. There was significant positive correlation the lipid content and organochlorines and polychlorinated biphenyls (PCBs). The results come concomitant with the lipophilicity of studied compounds. However, the recoded concentration of these studied pollutants still does not exceed international hazardous levels. (author)

  20. Organochlorine compounds and ultrasound measurements of fetal growth in the INMA cohort (Spain)

    NARCIS (Netherlands)

    M.-J. Lopez-Espinosa (Maria-Jose); M. Murcia (Mario); A. Iñiguez (Andrés); E. Vizcaino (Esther); O. Costa (Olga); A. Fernández-Somoano (Ana); M. Basterrechea (Mikel); A. Lertxundi (Aitana); M. Guxens Junyent (Mònica); M. Gascon (Mireia); F. Goñi-Irigoyen (Fernando); J.O. Grimalt (Joan O.); A. Tardón (Adonina); F. Ballester (Ferran)

    2016-01-01

    textabstractBackground: Several studies have reported decreases in birth size associated with exposure to organochlorine compounds (OCs), but uncertainties remain regarding the critical windows of prenatal exposure and the effects on fetal body segments. Objective: We examined the relationship

  1. Organochlorines in the Vaccares Lagoon trophic web (Biosphere Reserve of Camargue, France)

    Energy Technology Data Exchange (ETDEWEB)

    Roche, H., E-mail: helene.roche@u-psud.f [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France); Vollaire, Y.; Persic, A.; Buet, A. [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France); Oliveira-Ribeiro, C. [Departamento de Biologia Celular, Universidade Federal do Parana, Caixa Postal 19031, CEP: 81.531-990, Curitiba, PR (Brazil); Coulet, E. [Nature Reserve of Camargue, La Capeliere, F13200 Arles (France); Banas, D.; Ramade, F. [Ecologie, Systematique et Evolution, UMR8079 CNRS, Universite Paris-Sud, AgroParisTech, F91405 Orsay Cedex (France)

    2009-08-15

    During a decade (1996-2006), ecotoxicological studies were carried out in biota of the Vaccares Lagoon (Biosphere Reserve in Rhone Delta, France). A multicontamination was shown at all levels of the trophic web due to a direct bioconcentration of chemical from the medium combined with a food transfer. Here, the pollutants investigated were organochlorines, among which many compounds banned or in the course of prohibition (or restriction) (PCB, lindane, pp'-DDE, dieldrin, aldrin, heptachlor, endosulfan...) and some substances likely still used in the Rhone River basin (diuron, fipronil). The results confirmed the ubiquity of contamination. It proves to be chronic, variable and tends to regress; however contamination levels depend on the trophic compartment. A biomagnification process was showed. A comparison of investigation methods used in other Mediterranean wetlands provides basis of discussion, and demonstrates the urgent need of modelling to assess the ecotoxicological risk in order to improve the management of such protected areas. - The Vaccares Lagoon trophic web biomagnifies organochlorine pollutants.

  2. [Influence of organochlorine pesticides in wastewater on the soil along the channel].

    Science.gov (United States)

    Xu, Liang; Zhang, Cai-Xiang; Liu, Min; Liao, Xiao-Ping; Yao, Lin-Lin; Li, Jia-Le; Xiang, Qing-Qing

    2013-08-01

    Nine profile soil samples and two sewage water samples were collected from Xiaodian sewage irrigation area in Taiyuan city, concentrations of organochlorine pesticides (OCPs) were determined by the gas chromatography coupled with electron capture detector (GC-ECD) to analyze the influence of the leakage of sewage water. The result shows that OCPs in sewage water were mainly composed of HCHs. Concentrations of DDTs and other organochlorine pesticides were very low or out of the detection limit. Concentrations of sigmaOCPs and HCHs in eight profiles near irrigation channels to some extend decreased with the increasing of the linear distance off the channel, which shows influences of the leakage of sewage water on the soil nearby. Concentrations of HCHs clearly decreased with the increasing of soil depth in most profile soils. For the horizontal direction, concentrations of HCHs also decreased with the increasing of the linear distance off the channel. The correlation between HCHs and TOC was positive, but no correlation between pH and HCHs was found.

  3. Organohalogen exposure in a Eurasian owl (Bubo bubo) population from Southeastern Spain: Temporal-spatial trends and risk assessment

    NARCIS (Netherlands)

    Gomez-Ramirez, P.; Martinez-Lopez, E.; Garcia-Fernandez, A.; Zweers, A.J.; Brink, van den N.W.

    2012-01-01

    Polybrominated diphenyl ethers (PBDEs), polychlorinated biphenyls (PCBs) and organochlorine insecticides (OCs) were analysed in 58 Eurasian Eagle owl (Bubo bubo) unhatched eggs collected between 2004 and 2009 in Southeastern Spain. Levels of p,p'-DDE were found to be higher than in eggs laid by

  4. Pirimiphos-methyl residues in stored wheat and barley, bread, burghul and parboiled wheat

    International Nuclear Information System (INIS)

    Hadjidemetriou, D.G.

    1990-01-01

    Residues of 14 C-pirimiphos-methyl in stored grain declined to 88% in wheat and 82% in barley after 12 months. Corresponding percentages with the unlabelled insecticide were 78% and 59% since only the parent chemical was determined. Surface residues, removed by washing the grain with water, decreased from 3.3 to 0.2 mg/kg for wheat and from 2.0 to 0.2 mg/kg for barley. Bound residues increased gradually with time and reached a maximum of 2.2% for wheat and 3.0% for barley in 12 months. Pirimiphos-methyl residues in flour increased from 1.1 at 0 time to 2.2 mg/kg after one year. The mean values of residues contained in the unwashed wheat grain were 81% for bran and 19% for flour. The loss in milling during preparation of wholemeal flour from prewashed grain was 7% for wheat and 6% for barley. Processed products from wheat showed residue losses ranging from 24 to 45%. (author). 16 refs, 2 figs, 2 tabs

  5. [Situation analysis and standard formulation of pesticide residues in traditional Chinese medicines].

    Science.gov (United States)

    Yang, Wan-Zhen; Kang, Chuan-Zhi; Ji, Rui-Feng; Zhou, L I; Wang, Sheng; Li, Zhen-Hao; Ma, Zhong-Hua; Guo, Lan-Ping

    2017-06-01

    Chinese Pharmacopoeia provides nine pesticide Maximum Residual Limits(MRLs) of traditional Chinese medicines(TCMs), The number of pesticides used in production are far more than those listed in pharmacopoeia. The lack of the standards make it's hard to reflect the real situation of pesticide residues in TCMs correctly. The paper is aimed to analyze the data of pesticide residues in TCMs from 7 089 items in 140 reports, and judging the exceedance rate of pesticides in TCMs using the MRLs of European pharmacopoeia,which is widely accepted in many countries. The results show that:①Pesticide residues in 18 kinds of TCMs are higher than MRLs,while in 137 kinds are below MRLs, such as Atractylodis Macrocephalae Rhizoma, Menthae Haplocalycis Herba and Fritillariae Thunbergii Bulbus. The average exceedance rate of all TCMs is 1.72%. The average exceedance rates of organochlorine, organophosphorus and pyrethroid are 2.26%, 1.51%, 0.37%,respectively. ②The average exceedance rate of pesticides is 2.00%, and the exceedance rate is more than 5%, accounting for 8.33%, the exceedance rate is between 1%-5%, accounting for 18.75%. the exceedance rate is between 0%-1%, accounting for 18.75%. The remaining 29 kinds of pesticides were not exceeded, accounting for 60.42%.Some reports like Greenpeace's organization exaggerated the pesticide residues in TCMs.But the pesticide residue question is still worthy of attention, so we proposed to amend the Chinese Pharmacopoeia pesticide residues standards, to increase the pesticide species of traditional Chinese medicine in production on the basis of retaining the existing types of pesticide residues, to strengthen the system research of pesticide residues in TCMs, providing a basis for making standard and promoting import and export trade in TCMs. Copyright© by the Chinese Pharmaceutical Association.

  6. THE SIDE-EFFECT OF ORGANIC INSECTICIDE SPINOSAD ON BIOCHEMICAL AND MICROBIOLOGICAL PROPERTIES OF CLAY SOIL

    Directory of Open Access Journals (Sweden)

    Arkadiusz Telesiński

    2015-09-01

    Full Text Available The aim of the study was to determine the effect of spinosad on soil biochemical and microbiological properties. The experiment was carried out on sandy loam with Corg content 10.91 g·kg-l. Spinosad, as Spintor 240 SC was added into soil in dosages: a recommended field dosage, and fivefold, tenfold, and twenty-fivefold higher dosages. The amount of spinosad introduced into soil was between 12.55 and 313.75 g·kg-l. Moreover, soil samples without spinosad supplement were prepared as a reference. Respective Spintor 240 SC doses were converted into 1 kg soil, taking into account 10 cm depth. After application of insecticide water emulsions, soil moisture was brought to 60% maximum holding water capacity. The soil was thoroughly mixed and stored in tightly-closed polyethylene bags at 20 °C for a period 4 weeks. During the experiment dissipation of spinosad, soil enzymes (dehydrogenase, alkaline phosphatase, acid phosphatase, urease and number of bacteria, fungi, actinomycetes were assayed. Obtained results showed, that dissipation of spinosad in soil was relatively fast – the DT50 of this insecticide was ranged between 1.11 and 2.21 days. Spinosad residues had different effects on soil microbiological and biochemical properties. However, over time the impact of this insecticide definitely decreased. This indicated that the use of spinosad in organic farming, particularly in the field dosage, does not pose a long-term threat to the soil environment.

  7. Sensitivity of Bemisia tabaci (Hemiptera: Aleyrodidae) to several new insecticides in China: effects of insecticide type and whitefly species, strain, and stage.

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC50 values were higher for Lab-Q than for Lab-B; avermectin LC50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  8. Evaluation of pesticide residue dynamics in Chinese cabbage, head cabbage and cauliflower.

    Science.gov (United States)

    Kocourek, František; Stará, Jitka; Holý, Kamil; Horská, Tereza; Kocourek, Vladimír; Kováčová, Jana; Kohoutková, Jana; Suchanová, Marie; Hajšlová, Jana

    2017-06-01

    Pesticide residues from the time of application until harvest were analysed for 20, 17 and 18 active insecticidal and fungicidal substances in Chinese cabbage, head cabbage and cauliflower, respectively. In total, 40 mathematical models of residue degradation were developed using a first-order kinetic equation, and from these models it was possible to forecast the action pre-harvest interval for a given action threshold for low-residue production in Brassica vegetables as a percentage of the maximum residue level. Additionally, it was possible to establish an action pre-harvest interval based on an action threshold of 0.01 mg kg ‒1 for the production of Brassica vegetables for baby food. Among the evaluated commodities, the speed of residue degradation was highest in head cabbage, medium in Chinese cabbage and lowest in cauliflower. The half-lives of pesticide in various vegetables were also determined: they ranged from 1.55 to 5.25 days in Chinese cabbage, from 0.47 to 6.54 days in head cabbage and from 1.88 to 7.22 days in cauliflower.

  9. RESEARCH OF HEAVY METALS, ORGANOCHLORINE AND ORGANOPHOSPHORUS PESTICIDES IN POWDERED INFANT FORMULA

    Directory of Open Access Journals (Sweden)

    M.C. Abete

    2009-02-01

    Full Text Available During the period between october 2007 and november 2008 were collected 60 samples of powdered infant formula. The analysis for the detection of heavy metals, organochlorine and organophosphorus pesticides show that the environmental situation is under control and powdered infant formula satisfies this health requisite.

  10. Pesticide residues in nut-planted soils of China and their relationship between nut/soil.

    Science.gov (United States)

    Han, Yongxiang; Mo, Runhong; Yuan, Xinyue; Zhong, Donglian; Tang, Fubin; Ye, Caifen; Liu, Yihua

    2017-08-01

    Twenty-nine pesticide residues in nut-planted soils from China were investigated. One organophosphate (chlorpyrifos) was detected in 5.3% soils, and the residue levels of 7.2 μg/kg to 77.2 μg/kg. The concentrations of six organochlorines (DDT, HCH, endosulfan, quintozene, aldrin and dieldrin) detected in 78.9% soils were 0.6 μg/kg to 90.1 μg/kg. The residue levels of six pyrethroids (bifenthrin, fenpropathrin, cyhalothrin, cypermethrin, fenvalerate and deltamethrin) detected in 65.8% soils were 1.5 μg/kg to 884.3 μg/kg. Triadimefon and buprofezin were found in 71.1% and 52.6% samples, respectively, with the corresponding concentrations of 9.8 μg/kg to 193.7 μg/kg and 87.9 μg/kg to 807.4 μg/kg. The multiple residues were found in 76.3% soils. A significant correlation between pesticide residues in nuts and soils was observed, with the correlation coefficient (r) 0.83 (P < 0.001). In addition, the bioconcentration factor (BCF) values for the explanation of pesticides from soils into nuts were ranged from 0.8 to 16.5. The results showed that some pesticides could accumulate in nut by the uptake effect from soil. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  12. Risk assessment of various insecticides used for management of Asian citrus psyllid, Diaphorina citri in Florida citrus, against honey bee, Apis mellifera.

    Science.gov (United States)

    Chen, Xue Dong; Gill, Torrence A; Pelz-Stelinski, Kirsten S; Stelinski, Lukasz L

    2017-04-01

    The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), is a major pest of citrus trees worldwide. A wide variety of insecticides are used to manage D. citri populations within citrus groves in Florida. However, in areas shared by citrus growers and beekeepers the use of insecticides may increase the risks of Apis mellifera  L. (Hymenoptera: Apidae) loss and contaminated honey. The objective of this research was to determine the environmental toxicity of insecticides, spanning five different modes of action used to control D. citri, to A. mellifera. The insecticides investigated were imidacloprid, fenpropathrin, dimethoate, spinetoram and diflubenzuron. In laboratory experiments, LD 50 values were determined and ranged from 0.10 to 0.53 ng/μl for imidacloprid, fenpropathrin, dimethoate and spinetoram. LD 50 values for diflubenzuron were >1000 ng/μl. Also, a hazard quotient was determined and ranged from 1130.43 to 10893.27 for imidacloprid, fenpropathrin, dimethoate, and spinetoram. This quotient was mellifera 3 and 7 days after application. Spinetoram and imidacloprid were moderately toxic to A. mellifera at the recommended rates for D. citri. Diflubenzuron was not toxic to A. mellifera in the field as compared with untreated control plots. Phenoloxidase (PO) activity of A. mellifera was higher than in untreated controls when A. mellifera were exposed to 14 days old residues. The results indicate that diflubenzuron may be safe to apply in citrus when A. mellifera are foraging, while most insecticides used for management of D. citri in citrus are likely hazardous under various exposure scenarios.

  13. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  14. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  15. Plasma organochlorine concentrations and bone ultrasound measurements: a cross-sectional study in peri-and postmenopausal Inuit women from Greenland

    Directory of Open Access Journals (Sweden)

    Mulvad Gert

    2006-12-01

    Full Text Available Abstract Background Inuit women are highly exposed through their traditional seafood based diet to organochlorine compounds, some of them displaying endocrine disrupting properties. We hypothesized that this exposure might be related to bone characteristics that are altered in osteoporosis, because hormone deficiency is a known risk factor for the disease. Methods We measured quantitative ultrasound parameters (QUS at the right calcaneum of 153 peri- and postmenopausal Inuit women (49–64 year old from Nuuk, Greenland, and investigated the relation between these parameters and plasma organochlorine concentrations. We used high-resolution gas chromatography with electron capture detection to analyze plasma samples for 14 polychlorinated biphenyls (PCB congeners and 11 chlorinated pesticides and metabolites. We analysed morning urine samples for cadmium, a potential confounder, by atomic absorption spectrometry. We used a validated questionnaire to document dietary and lifestyle habits as well as reproductive and medical histories. Results Concentrations of PCB 153, a surrogate of exposure to most organochlorines present in plasma samples, were inversely correlated to QUS parameters in univariate analyses (p 2 = 0.39; p Conclusion Overall we found little evidence that organochlorines exposure is related to osteoporosis in Greenlandic Inuit women, but the hypothesis that exposure to dioxin-like compounds might be linked to decreased bone quality and osteoporosis deserves further attention.

  16. Degradation of Organophosphorus and Pyrethroid Insecticides in Beverages: Implications for Risk Assessment

    Directory of Open Access Journals (Sweden)

    Samantha A. Radford

    2018-02-01

    Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.

  17. Contamination of organochlorine pesticides in the soils of the Campania Plain, Italy

    Science.gov (United States)

    Qu, Chengkai; Albanese, Stefano; Doherty, Angela; Chen, Wei; Lima, Annamaria; Piccolo, Alessandro; Arienzo, Michele; Qi, Shihua; De Vivo, Benedetto

    2016-04-01

    For the last several decades, organochlorine pesticides (OCPs) have been introduced into the environment through anthropogenic activity. Due to their volatility and persistence, OCPs may undergo long-range atmospheric transport and, as a result, can be redistributed globally. Exposure to OCPs can pose serious health risks, including certain cancers, birth defects, respiratory illness, dysfunctional reproductive and immune systems, greater susceptibility to disease and damages to the central and peripheral nervous systems. To date, only a handful of studies, have reported the OCPs contamination level in water, sediment and organisms in the Campania Region, however a regional study of the soil contamination is still lacking. In our study, the distribution, inventory and potential risk of OCPs, including Hexachlorocyclohexanes (HCHs) and Dichlorodiphenyltrichloroethanes (DDTs), and their correlation with environmental and anthropological factors were investigated in soils of the Campania Plain. The specific objectives of this study were to (I) investigate the residual levels, distribution and possible sources of legacy OCPs, and further estimate their mass inventories in soils of the Campania Plain, (II) analyze the impact of soil properties on contaminant distribution, and (III) evaluate the potential ecological and health risks of OCPs. The total concentrations of HCHs and DDTs has a geometric mean (GM) of 0.05 ng/g, and 14.4 ng/g, respectively. The significant difference in spatial variations of OCPs (Kruskal-Wallis test, P<0.05) was observed in the Campania Plain. Two specific areas exhibited higher concentrations of OCP residues: one situated in the Acerra-Marigliano conurbation with elevated HCHs and DDTs; and the other in the Sarno River basin which contains elevated levels of DDTs. The recent application of technical HCHs and DDTs in large quantities appears unlikely in light of the ratio of α-HCH/β-HCH and p,p'-DDT/p,p'-DDE, and the prohibition of the use

  18. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

  19. Radiotracer studies of pesticide residues in edible oil seeds and related products

    International Nuclear Information System (INIS)

    1979-01-01

    Ten papers were presented in which chemical pollution due to insecticides was examined in edible oil seeds and their products. They include hexachlorocyclohexane residues in groundnut; carbaryl in groundnut; maize and cotton seed products, and in lactating goats; propoxur in cocoa beans; and leptophos residues in cotton seed and its products and in lactating goats. Eight of these papers constitute separate INIS entries. Egypt, Ghana, India, Korea, Lebanon, Pakistan, the Philippines, Poland, and the Sudan participated under the coordinated research programme. The progress of the programme is reviewed, and problems and priorities for future development of the programme are identified. A number of recommendations are addressed to the Joint FAO/IAEA Secretariat

  20. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.