Areva 2005 annual report; Areva rapport annuel 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This annual report contains information on AREVA's objectives, prospects and strategies, particularly in Chapters 4 and 7, as well as contains information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the annual report and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction; 3 - General information on the company and share capital: Information on AREVA, Information on share capital and voting rights, Investment certificate trading, Dividends, Organizational chart of the AREVA group, Equity interests, Shareholders' agreements; 4 - Information on company operations, 5 - New developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, AREVA group energy businesses, Front End Division, Reactors and Services Division, Back End Division, Transmission and Distribution Division, Major Contracts, The Group's principal sites, AREVA's customers and suppliers, Human resources, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development, intellectual property and brand name programs, Risk and insurance; 6 - Assets - Financial position - financial performance: Analysis of and comments on the Group's financial position and performance, Human Resources report 2005, Environmental report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA Financial statements 2005, Notes to the corporate financial statements; 7 - Corporate governance: Composition and functioning of administrative bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual General Meeting of Shareholders of May 2, 2006; 8 - Recent developments and outlook: Events subsequent to year-end closing for 2005, Outlook.

Areva, reference document 2006; Areva, document de reference 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains information on the markets, market shares and competitive position of the AREVA group. Content: - 1 Person responsible for the reference document and persons responsible for auditing the financial statements; - 2 Information pertaining to the transaction (Not applicable); - 3 General information on the company and its share capital: Information on AREVA, on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; - 4 Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts, The principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development programs, intellectual property and trademarks, Risk and insurance; - 5 Assets - Financial position - Financial performance: Analysis of and comments on the group's financial position and performance, 2006 Human Resources Report, Environmental Report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA financial statements, Notes to the corporate financial statements; 6 - Corporate Governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Combined General Meeting of Shareholders of May 3, 2007; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2006, Outlook; 8 - Glossary; 9 - Table of concordance.

AREVA Technical Days (ATD) session 4: operations of the front-end division of the nuclear fuel cycle

International Nuclear Information System (INIS)

2004-01-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This fourth session deals with the strategic and financial significance of the Areva mining operations, the Areva chemistry business, the Areva enrichment business and the Areva fuel business. (A.L.B.)

Areva, reference document 2006; Areva, document de reference 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains information on the markets, market shares and competitive position of the AREVA group. Content: - 1 Person responsible for the reference document and persons responsible for auditing the financial statements; - 2 Information pertaining to the transaction (Not applicable); - 3 General information on the company and its share capital: Information on AREVA, on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; - 4 Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts, The principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development programs, intellectual property and trademarks, Risk and insurance; - 5 Assets - Financial position - Financial performance: Analysis of and comments on the group's financial position and performance, 2006 Human Resources Report, Environmental Report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA financial statements, Notes to the corporate financial statements; 6 - Corporate Governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Combined General Meeting of Shareholders of May 3, 2007; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2006, Outlook; 8 - Glossary; 9 - Table of concordance.

Areva reference document 2007; Areva document de reference 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains also information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the reference document and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction (not applicable); 3 - General information on the company and its share capital: Information on Areva, Information on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; 4 - Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts 140 Principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and Development programs, Intellectual Property and Trademarks, Risk and insurance; 5 - Assets financial position financial performance: Analysis of and comments on the group's financial position and performance, Human Resources report, Environmental report, Consolidated financial statements 2007, Notes to the consolidated financial statements, Annual financial statements 2007, Notes to the corporate financial statements; 6 - Corporate governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Ordinary General Meeting of Shareholders of April 17, 2008; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2007, Outlook; Glossary; table of concordance.

Areva - 2011 Annual results

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du

2012-01-01

Areva's backlog established at 45.6 billion euros at the end of 2011, significantly increasing at the end of a year marked by the Fukushima accident, confirms the commercial dynamism of the group alongside its customers and reinforces the visibility on its future business level. In a difficult context, the slight decline in revenue in 2011 demonstrates the robustness of Areva's integrated model, resting mainly on recurring business generated in relation to Areva's customers' nuclear installed base, and benefiting from the development of Areva's renewable energies operations. Free operating cash flow before tax, although down over the whole year in 2011, improved in the second half, showing the first effects of Areva's stronger focus on cash generation and debt management. After the success of Areva's bond issue in September 2011, the Group's liquidity remains high at the end of 2011. The Areva teams are now dedicating all of their efforts to the deployment of the 'Action 2016' strategic action plan, which had already yielded its first positive results at the end of 2011, with an improvement in the cost structure of Areva's operations, an increase in order intake, and the launch of several disposals of minority interests. Summary of the 2011 financial results: - Backlog: euro 45.6 bn, +3.1% vs. 2010, i.e +6.7% over 3 months; - Revenue: euro 8.872 bn, i.e -2.6% vs. 2010; - Operating income: - euro 1.923 bn; - Net income attributable to equity owners of the parent: - euro 2.424 bn; - EBITDA: euro 1.068 bn ( euro 420 m excluding Siemens impact); - Free operating cash flow before tax: - euro 2.397 bn (- euro 1.366 bn excluding Siemens impacts), improvement over the second half; - Decrease in net debt of euro 124 m for the year; - Significant drop in general and administrative expenses, with a noticeable reduction between the first and the second half; - Launch of several disposals of minority interests

Areva: 2014 annual results

International Nuclear Information System (INIS)

Repaire, Philippine du

2015-01-01

The scale of the net loss for 2014 illustrates the twofold challenge confronting AREVA: continuing stagnation of the nuclear operations, lack of competitiveness and difficulties in managing the risks inherent in large projects. The group understands how serious this situation is. A comprehensive strategic review of operations was undertaken beginning in November 2014 and is being carried out without compromise. As a result, AREVA is now able to announce a solid transformation plan that sets a challenging but economically realistic course for its teams. First, AREVA will refocus on its core business: mastery of key nuclear processes essential to operators around the globe. This strategic redeployment will lead to the revision of certain goals, whether in the management of new reactor projects or in renewable energies. AREVA's objective is to achieve excellence as a high value-added supplier of products and services. Secondly, AREVA, whose resources had been marshaled to support a spurt of growth in nuclear power, must now adapt to new market realities and become competitive once again. The group's most urgent task is recovery and securing its future by immediately launching a far-reaching competitiveness plan founded on organizational simplification, quality of operations, and a completely revamped approach to managing risk in large projects. Last but not least, AREVA must ensure sustainable financing for its activities. A financing plan will be clarified before publication of the half-year financial statements. This document presents the key financial data of the group, its strategic road-map and its operating and financing plans

Areva reference document 2007; Areva document de reference 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains also information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the reference document and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction (not applicable); 3 - General information on the company and its share capital: Information on Areva, Information on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; 4 - Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts 140 Principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and Development programs, Intellectual Property and Trademarks, Risk and insurance; 5 - Assets financial position financial performance: Analysis of and comments on the group's financial position and performance, Human Resources report, Environmental report, Consolidated financial statements 2007, Notes to the consolidated financial statements, Annual financial statements 2007, Notes to the corporate financial statements; 6 - Corporate governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Ordinary General Meeting of Shareholders of April 17, 2008; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2007, Outlook; Glossary; table of

Areva: experiences in outage services

International Nuclear Information System (INIS)

Wiemeier, R.; Mueller, N.; Blanco, I. J.

2010-01-01

As the world leader in the nuclear industry, Areva is firmly committed to the safe and reliable operation of the Spanish nuclear power plants. Following this commitment, Areva has established the subsidiary Areva NP Services Spain as a local platform to provide nuclear services for the Spanish nuclear power plants. being integrated and supported by the global Areva Group, Areva NP Services Spain is able to offer services solutions to all customers demands while maintaining close and sustainable relationships with them. This integration also allows the Spanish personnel of Areva to employ their skills by working in multinational teams in international projects. This article will present the capacities, and the most important recent national and international project performed by Areva NP Services Spain in the field of outage services. (Author)

Areva - 2008 results: yet another year of growth for AREVA; Areva - Resultats 2008: une nouvelle annee de croissance pour AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-02-15

This paper summarizes the 2008 financial results of the Areva group: Backlog: 48.2 billion euros, up 21.1%; Revenue: 13.2 billion euros, up 10.4%; Operating income: - Operating income excluding provision on OL3 contract in Finland: 1,166 million euros, i.e. operating margin of 8.9%; - Additional provision on OL3 contract of 749 million euros; - Operating income: 417 million euros, i.e. operating margin of 3.2%. Net income attributable to equity holders of the parent: 589 million euros, i.e. euros 16.62 per share; Net debt of 3.45 billion euros before recognition of the SIEMENS put; Dividend of euros 7.05 to be proposed during the Annual General Meeting of Shareholders of April 30, 2009. After publication of these figures Siemens announced its decision to withdraw from AREVA NP.

Areva's water chemistry guidebook with chemistry guidelines for next generation plants (AREVA EPRTM reactors)

International Nuclear Information System (INIS)

Ryckelynck, N.; Chahma, F.; Caris, N.; Guillermier, P.; Brun, C.; Caron-Charles, M.; Lamanna, L.; Fandrich, J.; Jaeggy, M.; Stellwag, B.

2012-09-01

Over the years, AREVA globally has maintained a strong expertise in LWR water chemistry and has been focused on minimizing short-term and long-term detrimental effects of chemistry for startup, operation and shutdown chemistry for all key plant components (material integrity and reliability, promote optimal thermal performances, etc.) and fuel. Also AREVA is focused on minimizing contamination and equipment/plant dose rates. Current Industry Guidelines (EPRI, VGB, etc.) provide utilities with selected chemistry guidance for the current operating fleet. With the next generation of PWR plants (e.g. AREVA's EPR TM reactor), materials of construction and design have been optimized based on industry lessons learned over the last 50+ years. To support the next generation design, AREVA water chemistry experts, have subsequently developed a Chemistry Guidebook with chemistry guidelines based on an analysis of the current international practices, plant operating experience, R and D data and calculation codes now available and/or developed by AREVA. The AREVA LWR chemistry Guidebook can be used to help resolve utility and safety authority questions and addresses regulation requirement questions/issues for next generation plants. The Chemistry Guidebook provides water chemistry guidelines for primary coolant, secondary side circuit and auxiliary systems during startup, normal operation and shutdown conditions. It also includes conditioning and impurity limits, along with monitoring locations and frequency requirements. The Chemistry Guidebook Guidelines will be used as a design reference for AREVA's next generation plants (e.g. EPR TM reactor). (authors)

Annual report 2001. A (AREVA) for..; Rapport annuel 2001. A (AREVA) comme..

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

This annual report 2001, on the group Areva, provides data and information on the Areva emerges, overview of operations, sustainable development policy, research and development programs, nuclear power activities (front-end, reactors and services back-end divisions), components (connectors division and STMicroelectronics, human resources, share data and the financial report. (A.L.B.)

AREVA 2009 reference document; AREVA document de reference 2009

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-07-01

This Reference Document contains information on the AREVA group's objectives, prospects and development strategies. It contains information on the markets, market shares and competitive position of the AREVA group. This information provides an adequate picture of the size of these markets and of the AREVA group's competitive position. Content: 1 - Person responsible for the Reference Document and Attestation by the person responsible for the Reference Document; 2 - Statutory and Deputy Auditors; 3 - Selected financial information; 4 - Risks: Risk management and coverage, Legal risk, Industrial and environmental risk, Operating risk, Risk related to major projects, Liquidity and market risk, Other risk; 5 - Information about the issuer: History and development, Investments; 6 - Business overview: Markets for nuclear power and renewable energies, AREVA customers and suppliers, Overview and strategy of the group, Business divisions, Discontinued operations: AREVA Transmission and Distribution; 7 - Organizational structure; 8 - Property, plant and equipment: Principal sites of the AREVA group, Environmental issues that may affect the issuer's; 9 - Analysis of and comments on the group's financial position and performance: Overview, Financial position, Cash flow, Statement of financial position, Events subsequent to year-end closing for 2009; 10 - Capital Resources; 11 - Research and development programs, patents and licenses; 12 -trend information: Current situation, Financial objectives; 13 - Profit forecasts or estimates; 14 - Administrative, management and supervisory bodies and senior management; 15 - Compensation and benefits; 16 - Functioning of corporate bodies; 17 - Employees; 18 - Principal shareholders; 19 - Transactions with related parties: French state, CEA, EDF group; 20 - Financial information concerning assets, financial positions and financial performance; 21 - Additional information: Share capital, Certificate of incorporation and

Areva, reference document 2006

International Nuclear Information System (INIS)

2006-01-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains information on the markets, market shares and competitive position of the AREVA group. Content: - 1 Person responsible for the reference document and persons responsible for auditing the financial statements; - 2 Information pertaining to the transaction (Not applicable); - 3 General information on the company and its share capital: Information on AREVA, on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; - 4 Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts, The principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development programs, intellectual property and trademarks, Risk and insurance; - 5 Assets - Financial position - Financial performance: Analysis of and comments on the group's financial position and performance, 2006 Human Resources Report, Environmental Report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA financial statements, Notes to the corporate financial statements; 6 - Corporate Governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Combined General Meeting of Shareholders of May 3, 2007; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2006, Outlook; 8 - Glossary; 9 - Table of concordance

Areva 2005 annual report

International Nuclear Information System (INIS)

2005-01-01

This annual report contains information on AREVA's objectives, prospects and strategies, particularly in Chapters 4 and 7, as well as contains information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the annual report and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction; 3 - General information on the company and share capital: Information on AREVA, Information on share capital and voting rights, Investment certificate trading, Dividends, Organizational chart of the AREVA group, Equity interests, Shareholders' agreements; 4 - Information on company operations, 5 - New developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, AREVA group energy businesses, Front End Division, Reactors and Services Division, Back End Division, Transmission and Distribution Division, Major Contracts, The Group's principal sites, AREVA's customers and suppliers, Human resources, Sustainable Development and Continuous Improvement, Capital spending programs, Research and development, intellectual property and brand name programs, Risk and insurance; 6 - Assets - Financial position - financial performance: Analysis of and comments on the Group's financial position and performance, Human Resources report 2005, Environmental report, Consolidated financial statements, Notes to the consolidated financial statements, AREVA SA Financial statements 2005, Notes to the corporate financial statements; 7 - Corporate governance: Composition and functioning of administrative bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual General Meeting of Shareholders of May 2, 2006; 8 - Recent developments and outlook: Events subsequent to year-end closing for 2005, Outlook

Areva reference document 2007

International Nuclear Information System (INIS)

2008-01-01

This reference document contains information on the AREVA group's objectives, prospects and development strategies, particularly in Chapters 4 and 7. It contains also information on the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the reference document and persons responsible for auditing the financial statements; 2 - Information pertaining to the transaction (not applicable); 3 - General information on the company and its share capital: Information on Areva, Information on share capital and voting rights, Investment certificate trading, Dividends, Organization chart of AREVA group companies, Equity interests, Shareholders' agreements; 4 - Information on company operations, new developments and future prospects: Overview and strategy of the AREVA group, The Nuclear Power and Transmission and Distribution markets, The energy businesses of the AREVA group, Front End division, Reactors and Services division, Back End division, Transmission and Distribution division, Major contracts 140 Principal sites of the AREVA group, AREVA's customers and suppliers, Sustainable Development and Continuous Improvement, Capital spending programs, Research and Development programs, Intellectual Property and Trademarks, Risk and insurance; 5 - Assets financial position financial performance: Analysis of and comments on the group's financial position and performance, Human Resources report, Environmental report, Consolidated financial statements 2007, Notes to the consolidated financial statements, Annual financial statements 2007, Notes to the corporate financial statements; 6 - Corporate governance: Composition and functioning of corporate bodies, Executive compensation, Profit-sharing plans, AREVA Values Charter, Annual Ordinary General Meeting of Shareholders of April 17, 2008; 7 - Recent developments and future prospects: Events subsequent to year-end closing for 2007, Outlook; Glossary; table of concordance

Areva - 2008 results: yet another year of growth for AREVA

International Nuclear Information System (INIS)

2009-02-01

This paper summarizes the 2008 financial results of the Areva group: Backlog: 48.2 billion euros, up 21.1%; Revenue: 13.2 billion euros, up 10.4%; Operating income: - Operating income excluding provision on OL3 contract in Finland: 1,166 million euros, i.e. operating margin of 8.9%; - Additional provision on OL3 contract of 749 million euros; - Operating income: 417 million euros, i.e. operating margin of 3.2%. Net income attributable to equity holders of the parent: 589 million euros, i.e. euros 16.62 per share; Net debt of 3.45 billion euros before recognition of the SIEMENS put; Dividend of euros 7.05 to be proposed during the Annual General Meeting of Shareholders of April 30, 2009. After publication of these figures Siemens announced its decision to withdraw from AREVA NP

Areva, annual report 2004

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

This annual report contains information on AREVA objectives, prospects and strategies, particularly in chapters 4 and 7. This information is a not meant as a presentation of past performance data and should not be interpreted as a guarantee that events or data set forth herein are assured or that objectives will be met. Forward looking statements made in this document also address known and unknown risks, uncertainties and other factors that could, were they to translate into fact, cause AREVA future financial performance, operating performance and production to differ significantly from the objectives presented or suggested herein. Those factors include, in particular, changes in international, economic or market conditions, as well as risk factors presented in Section 4.14.3. Neither AREVA nor the AREVA group is committing to updating forward looking statements or information contained in the annual report. This annual report contains information on the markets, market shares and competitive position of the AREVA group. Unless otherwise indicated, all historical data and forward looking information are based on Group estimates (source: AREVA) and are provided as examples only. To AREVA knowledge, no report is available on the AREVA group markets that is sufficiently complete or objective to serve as a sole reference source. The AREVA group developed estimates based on several sources, including in-house studies and reports, statistics provided by international organizations and professional associations, data published by competitors and information collected by AREVA subsidiaries. The main sources, studies and reports used include (i) the International Atomic Energy Agency (IAEA), the International Energy Agency (IEA), the World Nuclear Association (WNA), the Nuclear Energy Institute (NEA), Nuclear Assurance Corporation (NAC), the European Atomic Energy Community (Euratom) and the Commissariat a l'Energie Atomique (CEA) for the nuclear business; and (ii) the

Areva, annual report 2004

International Nuclear Information System (INIS)

2004-01-01

This annual report contains information on AREVA objectives, prospects and strategies, particularly in chapters 4 and 7. This information is a not meant as a presentation of past performance data and should not be interpreted as a guarantee that events or data set forth herein are assured or that objectives will be met. Forward looking statements made in this document also address known and unknown risks, uncertainties and other factors that could, were they to translate into fact, cause AREVA future financial performance, operating performance and production to differ significantly from the objectives presented or suggested herein. Those factors include, in particular, changes in international, economic or market conditions, as well as risk factors presented in Section 4.14.3. Neither AREVA nor the AREVA group is committing to updating forward looking statements or information contained in the annual report. This annual report contains information on the markets, market shares and competitive position of the AREVA group. Unless otherwise indicated, all historical data and forward looking information are based on Group estimates (source: AREVA) and are provided as examples only. To AREVA knowledge, no report is available on the AREVA group markets that is sufficiently complete or objective to serve as a sole reference source. The AREVA group developed estimates based on several sources, including in-house studies and reports, statistics provided by international organizations and professional associations, data published by competitors and information collected by AREVA subsidiaries. The main sources, studies and reports used include (i) the International Atomic Energy Agency (IAEA), the International Energy Agency (IEA), the World Nuclear Association (WNA), the Nuclear Energy Institute (NEA), Nuclear Assurance Corporation (NAC), the European Atomic Energy Community (Euratom) and the Commissariat a l'Energie Atomique (CEA) for the nuclear business; and (ii) the

Areva, annual report 2004

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

This annual report contains information on AREVA objectives, prospects and strategies, particularly in chapters 4 and 7. This information is a not meant as a presentation of past performance data and should not be interpreted as a guarantee that events or data set forth herein are assured or that objectives will be met. Forward looking statements made in this document also address known and unknown risks, uncertainties and other factors that could, were they to translate into fact, cause AREVA future financial performance, operating performance and production to differ significantly from the objectives presented or suggested herein. Those factors include, in particular, changes in international, economic or market conditions, as well as risk factors presented in Section 4.14.3. Neither AREVA nor the AREVA group is committing to updating forward looking statements or information contained in the annual report. This annual report contains information on the markets, market shares and competitive position of the AREVA group. Unless otherwise indicated, all historical data and forward looking information are based on Group estimates (source: AREVA) and are provided as examples only. To AREVA knowledge, no report is available on the AREVA group markets that is sufficiently complete or objective to serve as a sole reference source. The AREVA group developed estimates based on several sources, including in-house studies and reports, statistics provided by international organizations and professional associations, data published by competitors and information collected by AREVA subsidiaries. The main sources, studies and reports used include (i) the International Atomic Energy Agency (IAEA), the International Energy Agency (IEA), the World Nuclear Association (WNA), the Nuclear Energy Institute (NEA), Nuclear Assurance Corporation (NAC), the European Atomic Energy Community (Euratom) and the Commissariat a l'Energie Atomique (CEA) for the nuclear business; and (ii

Reference document 2001. A (AREVA) for..; Document de reference 2001. A (AREVA) comme..

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

This reference document 2001, on the group Areva, provides data and information on the Areva emerges, overview of operations, sustainable development policy, research and development programs, nuclear power activities (front-end, reactors and services back-end divisions), components (connectors division and STMicroelectronics, human resources, share data and financial information (financial report 2001, financial report first-half 2002). (A.L.B.)

AREVA group overview; Presentation du groupe AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-02-08

This document presents the Group Areva, a world nuclear industry leader, from a financial holding company to an industrial group, operating in two businesses: the nuclear energy and the components. The structure and the market of the group are discussed, as the financial assets. (A.L.B.)

AREVA 2010 annual results; AREVA resultats annuels 2010

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-07-01

Areva's 44-billion euro backlog at the end of 2010 gives the group excellent visibility, enabling it to confirm its outlook for 2012: 12 billion euros in revenue, double-digit operating margin and significantly positive free operating cash flow. Revenue rose by 575 million euros in 2010, or 6.7%, in comparison to 2009 and operating income excluding particular items improved by 201 million euros, nearly 2 points of revenue. In the past two years, Areva has raised 7.1 billion euros and secured its liquidity to ensure its development. In 2011, Areva is going to simplify the group's capital structure by listing ordinary shares of AREVA. At that time, the group may launch the employee share-holding plan, something it has ardently sought for several years as a way for its employees to share in AREVA's growth. The consolidated backlog stood at 44.204 billion euros at December 31, 2010, up 2.0% compared with that at December 31, 2009. The group's consolidated revenue came to 9.104 billion euros in 2010, up 6.7% on a reported basis and 5.1% like-for-like compared with 2009. Excluding particular items, operating income rose by 1.9 point, going from 3.9% in 2009 to 5.8% in 2010, giving operating income of 532 million euros (331 million euros in 2009). Net income attributable to equity owners of the parent came to 883 million euros in 2010, an increase of 331 million euros compared with 2009. Operating cash flow before capex was 923 million euros, an increase of 548 million euros compared with 2009, when it was 375 million euros, due to the visible improvement in EBITDA and working capital requirement. The change in gross capex (excluding acquisitions) from 1.780 billion euros in 2009 to 1.966 billion euros in 2010 is due to the ramp-up of construction programs, particularly in Enrichment. In 2010, almost 60% of the group's capital spending was on sites in France. The acquisitions made in Renewable Energies in 2010 in the amount of 210 million euros

Areva solutions for management of defective fuel

International Nuclear Information System (INIS)

Morlaes, I.; Vo Van, V.

2014-01-01

Defective fuel management is a major challenge for nuclear operators when all fuel must be long-term managed. This paper describes AREVA solutions for managing defective fuel. Transport AREVA performs shipments of defective fuel in Europe and proposes casks that are licensed for that purpose in Europe and in the USA. The paper presents the transport experience and the new European licensing approach of defective fuel transport. Dry Interim Storage AREVA is implementing the defective fuel storage in the USA, compliant with the Safety Authority's requirements. In Europe, AREVA is developing a new, more long-term oriented storage solution for defective fuel, the best available technology regarding safety requirements. The paper describes these storage solutions. Treatment Various types of defective fuel coming from around the world have been treated in the AREVA La Hague plant. Specific treatment procedures were developed when needed. The paper presents operational elements related to this experience. (authors)

Areva and sustainable development 2003 summary report; Areva et le developpement durable abrege 2003

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

This document is a summary of the 2003 report on the sustainable development of the world nuclear industry leader, Areva. The 2002 report helped establish the status of Areva entities sustainable development performance and identity areas for improvement. The 2003 report presents the continuous improvement process, including accomplishments and projects initiated as well as difficulties encountered and ground yet to be covered. Two new tools support this process. The Areva Way self assessment model allows each unit to assess its own performance against the sustainable development commitments and the Areva values charter lays down ethical principles of action and rules of conduct. Over the coming months, the Group will devote considerable effort to extending the sustainable development initiative to the activities resulting from the acquisition of Alstom Transmission and Distribution operations in early 2004. (A.L.B.)

Areva in 2002

International Nuclear Information System (INIS)

Anon.

2003-01-01

In 2002 the consolidated turnover of Areva reached 8265 million euros, it means a decrease by 7,2% in comparison with 2001. This decrease is due to the sharp drop of the turnover of the connector sector (-20,7%) while the nuclear sector was stable. The bad figure of connectors engineering is linked to a new collapse of the telecommunication market. In 2002 the operational result of Areva reached 180 million euros, that is to say an increase by 48%, which is a consequence of progress made in the nuclear sector. (A.C.)

The new AREVA

International Nuclear Information System (INIS)

Le Ngoc, B.

2017-01-01

The French state is the main shareholder of AREVA with a 86% share. The restructuring of AREVA has entered its final phase and the future organisation is now set. The new AREVA (called 'NEW AREVA' temporarily) will focus on fuel cycle activities only while designing reactor activities including fuel fabrication (formerly called 'AREVA NP') and associated services will be taken over by EDF (Electricite de France). The AREVA SA holding will gather the activities linked to the EPR contract of Olkiluoto-3 in Finland and those that are planned to be sold. The European Commission has given its agreement for this new reorganisation around 3 entities. The French state has decided to make 2 capital increases: one of 2 billions euros for AREVA SA and another of 2.5 billions euros for NEW AREVA. AREVA is an industrial group whose main industrial platforms are located in France: Tricastin, La Hague, MELOX. 2 Japanese companies (MHI and JNFL) and Chinese authorities have indicated that they are interested to acquire shares of NEW AREVA. (A.C.)

AREVA 2009 reference document

International Nuclear Information System (INIS)

2009-01-01

This Reference Document contains information on the AREVA group's objectives, prospects and development strategies. It contains information on the markets, market shares and competitive position of the AREVA group. This information provides an adequate picture of the size of these markets and of the AREVA group's competitive position. Content: 1 - Person responsible for the Reference Document and Attestation by the person responsible for the Reference Document; 2 - Statutory and Deputy Auditors; 3 - Selected financial information; 4 - Risks: Risk management and coverage, Legal risk, Industrial and environmental risk, Operating risk, Risk related to major projects, Liquidity and market risk, Other risk; 5 - Information about the issuer: History and development, Investments; 6 - Business overview: Markets for nuclear power and renewable energies, AREVA customers and suppliers, Overview and strategy of the group, Business divisions, Discontinued operations: AREVA Transmission and Distribution; 7 - Organizational structure; 8 - Property, plant and equipment: Principal sites of the AREVA group, Environmental issues that may affect the issuer's; 9 - Analysis of and comments on the group's financial position and performance: Overview, Financial position, Cash flow, Statement of financial position, Events subsequent to year-end closing for 2009; 10 - Capital Resources; 11 - Research and development programs, patents and licenses; 12 -trend information: Current situation, Financial objectives; 13 - Profit forecasts or estimates; 14 - Administrative, management and supervisory bodies and senior management; 15 - Compensation and benefits; 16 - Functioning of corporate bodies; 17 - Employees; 18 - Principal shareholders; 19 - Transactions with related parties: French state, CEA, EDF group; 20 - Financial information concerning assets, financial positions and financial performance; 21 - Additional information: Share capital, Certificate of incorporation and by-laws; 22 - Major

Annual report 2001. A (AREVA) for.

International Nuclear Information System (INIS)

2002-01-01

This annual report 2001, on the group Areva, provides data and information on the Areva emerges, overview of operations, sustainable development policy, research and development programs, nuclear power activities (front-end, reactors and services back-end divisions), components (connectors division and STMicroelectronics, human resources, share data and the financial report. (A.L.B.)

AREVA annual results 2009

International Nuclear Information System (INIS)

2009-01-01

AREVA expanded its backlog and increased its revenues compared with 2008, on strong installed base business and dynamic major projects, fostering growth in operating income of 240 million euros. As announced previously, Areva is implementing a financing plan suited to its objectives of profitable growth. The plan was implemented successfully in 2009, including the conclusion of an agreement, under very satisfactory terms, to sell its Transmission and Distribution business for 4 billion euros, asset sales for more than 1.5 billion euros, and successful bond issues of 3 billion euros. The plan will continue in 2010 with a capital increase, the completion of asset disposals and cost reduction and continued operational performance improvement programs. Areva bolstered its Renewable Energies business segment by supplementing its offshore wind power and biomass businesses with the acquisition of Ausra, a California-based leader in concentrated solar power technology. Despite the sale of T and D, Areva is maintaining its financial performance outlook for 2012: 12% average annual revenue growth to 12 billion euros in 2012, double digit operating margin and substantially positive free operating cash flow. Annual results 2009: - For the group as a whole, including Transmission and Distribution: Backlog: euros 49.4 bn (+2.5%), Revenues: euros 14 bn (+6.4%), Operating income: euros 501 m (+20.1%); - Nuclear and Renewable Energies perimeter: Backlog: euros 43.3 bn (+1.8%), Strong revenue growth: +5.4% to euros 8.5 bn, Operating income before provision for the Finnish project in the first half of 2009: euros 647 m, Operating income: euros 97 m, for a euros 240 m increase from 2008; - Net income attributable to equity holders of the parent: euros 552 m, i.e. euros 15.59 per share; - Net debt: euros 6,193 m; - Pro-forma net debt, including net cash to be received from the sale of T and D in 2010: euros 3,022 m; - Dividend of euros 7.06 per share to be proposed during the Annual

Areva - 2014 Reference document

International Nuclear Information System (INIS)

2015-01-01

Areva supplies high added-value products and services to support the operation of the global nuclear fleet. The company is present throughout the entire nuclear cycle, from uranium mining to used fuel recycling, including nuclear reactor design and operating services. Areva is recognized by utilities around the world for its expertise, its skills in cutting-edge technologies and its dedication to the highest level of safety. Areva's 44,000 employees are helping build tomorrow's energy model: supplying ever safer, cleaner and more economical energy to the greatest number of people. This Reference Document contains information on Areva's objectives, prospects and development strategies. It contains estimates of the markets, market shares and competitive position of Areva. Contents: 1 - Person responsible; 2 - Statutory auditors; 3 - Selected financial information; 4 - Risk factors; 5 - Information about the issuer; 6 - Business overview; 7 - Organizational structure; 8 - Property, plant and equipment; 9 - Analysis of and comments on the group's financial position and performance; 10 - Capital resources; 11 - Research and development programs, patents and licenses; 12 - Trend information; 13 - Profit forecasts; 14 - Administrative, management and supervisory bodies and senior management; 15 - Compensation and benefits; 16 - Functioning of administrative, management and supervisory bodies and senior management; 17 - Employees; 18 - Principal shareholders; 19 - Transactions with related parties; 20 - Financial information concerning assets, financial positions and financial performance; 21 - Additional information; 22 - Major contracts; 23 - Third party information, statements by experts and declarations of interest; 24 - Documents on display; 25 - information on holdings; appendix: Report of the Chairman of the Board of Directors on governance, internal control procedures and risk management, Statutory Auditors' report, Corporate social

Areva - 2013 annual results: breakeven free operating cash flow objective reached despite a difficult environment

International Nuclear Information System (INIS)

Duperray, Julien; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2014-01-01

The Areva group reached a major milestone in 2013 in turning performance around by meeting a key objective of its Action 2016 plan: the return to breakeven of free operating cash flow. For the first time since 2005, cash generated by the Group's operations allowed it to fully fund strategic capital expenditures essential to the group's profitable growth. To achieve this result, Areva built on robust growth in nuclear operations, on contributions from its cost reduction plan and on strict management of capital spending. However, two projects launched in the previous decade (OL3 and a power plant modernization) and the Renewable Energies business impacted negatively the group's 2013 net income. On the Renewable Energies market, in a situation marked by a reduction of capital spending by customers, AREVA anticipated the consolidation required in the sector by implementing industrial partnerships such as the joint venture project with Gamesa, which aims to create a European champion in offshore wind. Similar initiatives were undertaken in solar energy and energy storage. The Group continues to implement the Action 2016 plan to pursue its recovery. While the economic environment remains uncertain and projects launched in the previous decade remain a burden, the Group forecasts further performance improvement and significant growth in cash flow generation by the end of the plan

Reference document 2001. A (AREVA) for.

International Nuclear Information System (INIS)

2002-01-01

This reference document 2001, on the group Areva, provides data and information on the Areva emerges, overview of operations, sustainable development policy, research and development programs, nuclear power activities (front-end, reactors and services back-end divisions), components (connectors division and STMicroelectronics, human resources, share data and financial information (financial report 2001, financial report first-half 2002). (A.L.B.)

Areva as of December 31, 2011; Areva au 31 decembre 2011

Energy Technology Data Exchange (ETDEWEB)

Marie, Patricia; Briand, Pauline; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du

2012-01-26

In 2011, AREVA's consolidated revenue came to 8.872 billion euros, down slightly (-2.6%) compared with 2010 (-1.2% like for like). The decrease in revenue in nuclear operations was partially offset by significant growth in the renewable energies business. Foreign exchange and changes in the scope of consolidation had respectively a negative impact of 113 million euros and 16 million euros over the period. Revenue totaled 2.922 billion euros in the fourth quarter of 2011, stable compared with the fourth quarter of 2010 (-0.5% on a reported basis and -0.5% like for like). Foreign exchange had a negligible impact during the period. Led by nuclear operations, the group's backlog was 45.6 billion euros at December 31, 2011, up 3.1% year on year and 6.7% in relation to September 30, 2011. Order cancellations since Fukushima were limited to 464 million euros as of December 31, 2011. In accordance with the requirements of IFRS 8, AREVA's business segment information is presented for each operating Business Group (BG), which is the level of information examined by the group's governance bodies. Subsequent to the establishment of a subsidiary combining all of the group's mining operations, data for the Mining Business Group are now reported separately from those of the Front End Business Group. Data used for comparisons with 2010 were restated to reflect this new organization. The business segment information therefore corresponds to AREVA's five operating Business Groups: Mining, Front End, Reactors and Services, Back End and Renewable Energies

Crisis exercises at AREVA

International Nuclear Information System (INIS)

Chanson, D.

2016-01-01

AREVA being an operator of nuclear facilities has to organize crisis exercises regularly. About 100 crisis exercises are performed each year in AREVA installations. These exercises allow the training of the staff, the assessing of material and humane means and the checking of the quality of the interfaces between all the participants (other AREVA teams or Nuclear Safety Authority or...). The management of nuclear crisis is based on anticipation and relies on 3 pillars: a referential gathering all the useful documents (emergency plans, procedures,...), the training and practice of AREVA staff in specific domains to cope with emergency situations, and various crisis exercises to keep fit all the teams. The basis emergency exercise lasts 2 hours and is organized into modules. First module: detecting abnormal conditions, alerting, rescuing and limiting the consequences; second module: launching the emergency plan; third module: understanding the situation and limiting the consequences; fourth module: communicating with other actors that intervene in a nuclear crisis (nuclear safety authority, state or local officials, the media...); and fifth module: anticipating the end of the emergency phase to prepare post-accidental management. (A.C.)

AREVA's toolbox for long-term best performance and reliable operation of nuclear steam generators

International Nuclear Information System (INIS)

Drexler, Andreas; Weiss, Steffen; Caris, Neil; Stiepani, Christoph

2015-01-01

Long-term integrity and high performance of major plant systems and components are of uppermost importance for the successful operation of any power plant. AREVA's experience gathered with water-steam cycle chemistry treatments in more than 40 years yields the conclusion: Accumulation of corrosion products in SGs may result in local overheating and enrichment of impurities up to critical levels. This can lead to several degradation phenomena of the structural materials of the SGs. Therefore, minimization of corrosion product generation and prevention of deposit accumulation is required. The objective of AREVA's asset management program is to support operators by minimizing corrosion damage and performance losses of water-steam cycle systems and components and thereby to maximize the availability and economic performance of the plant. Such asset management program is in principle a closed cycle process. It is based on control, corrective and preventive measures. The objective of control measure is deriving a widespread assessment of the corrosion status of the steam-water cycle which yields to weak points and identifying the best suited corrective and/or preventive measures. In the subsequent steps appropriate measures which improve the current status or counteract on identified issues are identified and applied. Corrective measures, likes mechanical and/or chemical cleaning are targeting the minimization of negative influence on plant performance caused by corrosion in the steam-water cycle. Complementary to corrective measures are preventive ones, like optimization of pH strategy and AREVA's FFA technology could by applied. They are focusing on the origin of corrosion product generation. AREVA is offering a toolbox for long-term best performance and reliable operation of NPPs. (author)

Report on responsible growth. AREVA in 2008; Rapport de croissance responsable. AREVA en 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-07-01

All over the world, AREVA supplies its customers with solutions for carbon-free power generation and electricity transmission and distribution. With its knowledge and expertise in these fields, the group has a leading role to play in meeting the world's energy needs. Ranked first in the global nuclear power industry, AREVA's unique integrated offering covers every stage of the fuel cycle, reactor design and construction, and related services. In addition, the group is expanding its operations in renewable energies. AREVA is also a world leader in electricity transmission and distribution and offers its customers a complete range of solutions for greater grid stability and energy efficiency. Sustainable development is a core component of the group's industrial strategy. Its 75,000 employees work every day to make AREVA a responsible industrial player that is helping to supply ever cleaner, safer and more economical energy to the greatest number of people. Sustainable development is a keystone of AREVA's industrial strategy for achieving growth that is profitable, socially responsible and respectful of the environment. To translate this choice into reality, AREVA integrates sustainable development into its management practices via a continuous improvement initiative revolving around ten commitments: customer satisfaction, financial performance, governance, community involvement, environmental protection, innovation, continuous improvement, commitment to employees, risk management and prevention, dialogue and consensus building. This document is Areva's 2008 report on responsible growth. After the Messages from the Chairman of the Supervisory Board and from the Chief Executive Officer, the report presents the Key data and Highlights of the period, the Corporate governance, the Organization of the group, the Share information and shareholder relations, the uranium reserves, the growing energy demand and the World's population demographic

AREVA. Operating and financial results for the first half of 2011; AREVA. Resultats du 1er semestre 2011

Energy Technology Data Exchange (ETDEWEB)

Marie, Patricia; Briand, Pauline; Floquet-Daubigeon, Fleur; Michaut, Maxime; De Scorbiac, Marie

2011-07-27

The first half of 2011 was marked by the accident at the Fukushima power plant following the unprecedented natural disasters that struck Japan. AREVA drew the first consequences from these events as early as June 2011 and recorded provisions and impairment in its half-year financial statements, related in particular to the expected short-term level of activity of some facilities. Close to 200 million euros in orders were canceled out of a total in backlog of more than 43 billion euros, which was down by a little more than 1 billion euros compared with the end of 2010. The longer term consequences of these events for AREVA are being assessed. They could concern all operations in the nuclear cycle and will be included in the strategic plan to be prepared by the end of the second half of the year. The fundamentals underpinning the development of the nuclear market are unchanged: strong growth in demand for electricity in the coming decades, diminished fossil resources, the search by many countries for energy independence, and the growing need to address climate issues. Through its efficient integrated business model, AREVA is present in every segment of the nuclear chain and is positioned in high-tech renewable energies with an offering that is perfectly suited to the requirements of the world's power companies. Decisions by governments on energy policy and by the safety authorities in different countries will influence market developments and the schedule for executing certain projects. Germany announced its decision to withdraw permanently from nuclear power and Switzerland intends to do the same, while Italy has opted not to restart its program. And yet the majority of countries have confirmed their decision to pursue nuclear power programs, present and future. In the first half, the group continued to draw down debt, achieving a net debt level of less than 3 billion euros at the end of June, thanks in particular to the conclusion of the proceedings with

Areva - Environmental Policy 2014-2016

International Nuclear Information System (INIS)

2014-01-01

Areva supplies advanced technology solutions for power generation with less carbon. Its expertise and unwavering insistence on safety, security, transparency and ethics are setting the standard, and its responsible development is anchored in a process of continuous improvement. Ranked first in the global nuclear power industry, Areva's unique integrated offering to utilities covers every stage of the fuel cycle, nuclear reactor design and construction, and operating services. The group is also expanding in renewable energies - wind, bio-energy, solar, energy storage - to become a European leader in this sector. With these two major offers, Areva's 46,000 employees are helping to supply ever safer, cleaner and more economical energy to the greatest number of people. The 6 commitments of Areva's environmental policy are: 1. Maintain and develop a shared culture for the prevention of environmental risks; 2. Improve the design of our installations taking into account their entire life cycle; 3. Strengthen the prevention and control of accidental technological risks; 4. Prevent risks linked to ageing of installations and accidental spillage; 5. Strengthen the prevention and control of chronic health risks; 6. Manage the environmental footprint of our activities to prevent damages to biodiversity. A graphics summarises Areva's 2016 environmental footprint objectives

Areva at September 30, 2015:

International Nuclear Information System (INIS)

Lachaux, Manuel; Jugean, Anne-Sophie

2015-01-01

After the phase of strategic choices and definition of competitiveness objectives, AREVA entered the phase of operational execution of its transformation plan. Despite a still depressed market environment, the Group is beginning to measure the first results of its efforts to restore its financial situation. Thanks to the actions undertaken, the cash consumption pace was sharply slowed down compared to what had been anticipated. In summary: Rise in revenue to euro 2.947 bn: +10.3% vs. September 2014 (+8.7% like for like); - Backlog of euro 31.595 bn; - Discontinued operations, including AREVA NP: - Revenue of euro 2.732 bn: -7.5% vs. September 2014, - Backlog of euro 12.872 bn. Progress on the transformation plan in the third quarter: - Social dialogue: signature of the group agreement on the employment plan and submittal of documents describing the group's reorganization plans to employee representation bodies as part of a job-saving plan; - Continued deployment of actions for operational performance; - Strategic partnership with EDF: finalization of due diligence for the sale of AREVA NP; - Decisions on capital increase taken before the end of 2015

Areva - Occupational Health and Safety. Policy 2014-2016

International Nuclear Information System (INIS)

2014-09-01

Areva is a world leader in nuclear power. The group's offer to utilities covers every stage of the nuclear fuel cycle, reactor design and construction, and operating services. Its expertise and uncompromising dedication to safety make it a leading industry player. Areva also invests in renewable energies to develop, via partnerships, high technology solutions. Through the complementary nature of nuclear and renewables, Areva's 45,000 employees contribute to building tomorrow's energy model: supplying the greatest number of people with energy that is safer and with less CO 2 . Areva promotes the highest standards for Nuclear and Occupational Safety toward its customers and aims at being exemplary in this field everywhere in the world. The first pillar of the 'Action 2016' strategic action plan states that Nuclear and Occupational Safety are Areva's absolute priorities

AREVA group overview

International Nuclear Information System (INIS)

2002-01-01

This document presents the Group Areva, a world nuclear industry leader, from a financial holding company to an industrial group, operating in two businesses: the nuclear energy and the components. The structure and the market of the group are discussed, as the financial assets. (A.L.B.)

Areva and sustainable development 2003 summary report

International Nuclear Information System (INIS)

2004-01-01

This document is a summary of the 2003 report on the sustainable development of the world nuclear industry leader, Areva. The 2002 report helped establish the status of Areva entities sustainable development performance and identity areas for improvement. The 2003 report presents the continuous improvement process, including accomplishments and projects initiated as well as difficulties encountered and ground yet to be covered. Two new tools support this process. The Areva Way self assessment model allows each unit to assess its own performance against the sustainable development commitments and the Areva values charter lays down ethical principles of action and rules of conduct. Over the coming months, the Group will devote considerable effort to extending the sustainable development initiative to the activities resulting from the acquisition of Alstom Transmission and Distribution operations in early 2004. (A.L.B.)

Global expertise of the ten-year environmental situation of AREVA N.C.1. part: storage of Bellezane and environmental impact at the level of the Ritord catchment basin

International Nuclear Information System (INIS)

2007-01-01

The first step of the expertise of the ten-year environmental assessment of Areva Nc was focused on the storage of mine residues of Bellezane and on the environmental impact of mine exploitation at the level of the Ritord watershed, these two aspects being appeared as a priority as regard to the different concerns and topical. The I.R.S.N. analysis consisted in checking that the impacts associated to the presence of residues are correctly controlled. The specificity of the storage system face to the water control rest on the capacity of water collect that have circulated at the residues contact and on their treatment before release. Concerning the exposure by emission in atmosphere, the characteristics of the roofing, particularly its thickness, allow to reduce significantly the residues contribution to the ambient gamma radiation and radon emission. The measured dose rate appear linked to the radiological content of deads themselves and rocks constituting the surrounding landscape. (N.C.)

Sustainable development of Areva Mongol and Cogegobi. Report 2014

International Nuclear Information System (INIS)

2015-10-01

This document is Areva Mongol's stakeholder report for 2014. Areva started its exploration operations in Mongolia in 1997 via its subsidiary COGEGOBI and long before the so-called 'mining boom'. Throughout the last decade, Areva made significant investments to bring its geological exploration works to success, which led to the successive discoveries of the Dulaan Uul and Zuuvch Ovoo deposits. These breakthroughs, by almost doubling the account of Mongolia's official uranium resources, have now positioned the country as a possible future major uranium producer. 2014 has been a year of hard work and great achievements for the company. Areva successfully completed the technical and economic feasibility studies of both deposits. The company restored its relationships with local authorities, herders and local citizens, to a point where it now reach some level of mutual understanding. Since the very beginning of its presence in Mongolia, Areva has brought support to local institutions and citizens. The livestock health project that Areva Mongol is funding, has a double objective to clarify the causes of livestock diseases observed in Ulaanbadrakh sum which cause doubts among the local community, as well as to bring direct support to herders in Areva's project area. Areva is waiting the approval of the Feasibility Study of Dulaan Uul and Zuuvch Ovoo uranium deposits mining by the Professional Council of the Mineral Resources Authority and the granting of mining licenses on these areas to Areva Mines LLC. The objective will be to launch the operations of Areva Mines LLC, the joint-venture with the Mongolian state owned partner Mon-Atom. This will be a first step towards Mongolia becoming a uranium exporter being involved itself in the uranium mining for the first time in its history. Content: Areva's approach to responsibility (The uranium market in the world, Areva a world player in Uranium, Responsible Mining Player, actions for

AREVA 2010 annual results

International Nuclear Information System (INIS)

2010-01-01

Areva's 44-billion euro backlog at the end of 2010 gives the group excellent visibility, enabling it to confirm its outlook for 2012: 12 billion euros in revenue, double-digit operating margin and significantly positive free operating cash flow. Revenue rose by 575 million euros in 2010, or 6.7%, in comparison to 2009 and operating income excluding particular items improved by 201 million euros, nearly 2 points of revenue. In the past two years, Areva has raised 7.1 billion euros and secured its liquidity to ensure its development. In 2011, Areva is going to simplify the group's capital structure by listing ordinary shares of AREVA. At that time, the group may launch the employee share-holding plan, something it has ardently sought for several years as a way for its employees to share in AREVA's growth. The consolidated backlog stood at 44.204 billion euros at December 31, 2010, up 2.0% compared with that at December 31, 2009. The group's consolidated revenue came to 9.104 billion euros in 2010, up 6.7% on a reported basis and 5.1% like-for-like compared with 2009. Excluding particular items, operating income rose by 1.9 point, going from 3.9% in 2009 to 5.8% in 2010, giving operating income of 532 million euros (331 million euros in 2009). Net income attributable to equity owners of the parent came to 883 million euros in 2010, an increase of 331 million euros compared with 2009. Operating cash flow before capex was 923 million euros, an increase of 548 million euros compared with 2009, when it was 375 million euros, due to the visible improvement in EBITDA and working capital requirement. The change in gross capex (excluding acquisitions) from 1.780 billion euros in 2009 to 1.966 billion euros in 2010 is due to the ramp-up of construction programs, particularly in Enrichment. In 2010, almost 60% of the group's capital spending was on sites in France. The acquisitions made in Renewable Energies in 2010 in the amount of 210 million euros (100% of Ausra and the

AREVA in China

International Nuclear Information System (INIS)

2007-01-01

China has a great need for secure, safe, and economic energy supplies that combat the greenhouse effect and global warming. Since January 2002, China, the most heavily populated country with more than 1.3 billion inhabitants in a territory of 9.5 million km 2 (17 times larger than France), has a nuclear capacity of 9 GWe with 11 nuclear plants on line. Forecasts of electricity consumption report a need for 900 to 1,000 GWe per year through 2020, and at this time the country's objective is to increase nuclear generated electricity from 1% to 4% of its total output. This means a need for additional 30 GWe, which is the equivalent of twenty 1,500 MWe reactors. In addition to nuclear power, China is pushing renewable energy. With the passage of the 2005 Renewable Energy Law, China's government imposed a national renewable energy requirement that is expected to boost the use of renewable energy capacity from 10 to 12 percent by 2020, up from 3% in 2003. This law requires power operators to buy electricity from alternative energy providers and gives economic incentives to these providers. Consequently, China is expanding its interests in renewable energy sources including wind and bio-energies, among others. It is in this context that AREVA, a world expert in energy, creates and offers solutions to generate, transmit, and distribute electricity for China. Based on its long experience and global presence, AREVA has become the worldwide leader for nuclear energy in the areas of construction, equipment, and services for nuclear power plants, and for the whole nuclear fuel cycle. AREVA is also a world leader in electrical power-grid equipment and systems. This document presents: China's need for energy; the Sources of China's energy mix; the challenges of China's nuclear program; AREVA's action in supporting China's ambitious nuclear program; the strong opportunities in renewable energy; and the high potential market for AREVA's T and D Division

Information report of AREVA Tricastin site - 2015 Edition. This report is written in compliance with article L. 125-15 of the French environment code

International Nuclear Information System (INIS)

2016-01-01

Published in compliance with the French code of the environment, this report presents, first, the AREVA Tricastin site with its facilities (AREVA NC, EURODIF Production, SET, SOCATRI and AREVA NP Pierrelatte) and activities in the domain of uranium conversion and enrichment. Then, it takes stock of the dispositions implemented for the limitation and prevention of risks and summarizes the events declared in 2015. Next, it presents the management of the site effluents and wastes and the environmental monitoring. Finally, the actions of public information are presented. The recommendations of the Health and safety Committee are included in appendix

AREVA Germany. International competence in nuclear technology

International Nuclear Information System (INIS)

Graeber, Ulrich

2011-01-01

AREVA NP was created in 2001 by the merger of the French nuclear technology specialist Framatome with the nuclear sector of Siemens. The company is headquartered in Paris and has regional subsidiaries in Germany and the United States. The joint venture's strength lies in its all-round competence in nuclear power plants, from reactor development to power plant services and modernization of operating plants, design and production of fuel assemblies and turn-key construction of nuclear power reactors. Major core competences are located in Germany including the test facilities which are unique in the entire group as well as electrical engineering and instrumentation and control systems. AREVA NP is part of the globally acting AREVA group which pursues a unique integrated business model. The concept covers the entire nuclear fuel cycle from uranium mining to reprocessing used fuel assemblies. At present, AREVA has 48,000 employees worldwide, of which 5,700 are Germany-based. (orig.)

AREVA. Operating and financial results for the first half of 2011

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Floquet-Daubigeon, Fleur; Michaut, Maxime; De Scorbiac, Marie

2011-01-01

The first half of 2011 was marked by the accident at the Fukushima power plant following the unprecedented natural disasters that struck Japan. AREVA drew the first consequences from these events as early as June 2011 and recorded provisions and impairment in its half-year financial statements, related in particular to the expected short-term level of activity of some facilities. Close to 200 million euros in orders were canceled out of a total in backlog of more than 43 billion euros, which was down by a little more than 1 billion euros compared with the end of 2010. The longer term consequences of these events for AREVA are being assessed. They could concern all operations in the nuclear cycle and will be included in the strategic plan to be prepared by the end of the second half of the year. The fundamentals underpinning the development of the nuclear market are unchanged: strong growth in demand for electricity in the coming decades, diminished fossil resources, the search by many countries for energy independence, and the growing need to address climate issues. Through its efficient integrated business model, AREVA is present in every segment of the nuclear chain and is positioned in high-tech renewable energies with an offering that is perfectly suited to the requirements of the world's power companies. Decisions by governments on energy policy and by the safety authorities in different countries will influence market developments and the schedule for executing certain projects. Germany announced its decision to withdraw permanently from nuclear power and Switzerland intends to do the same, while Italy has opted not to restart its program. And yet the majority of countries have confirmed their decision to pursue nuclear power programs, present and future. In the first half, the group continued to draw down debt, achieving a net debt level of less than 3 billion euros at the end of June, thanks in particular to the conclusion of the proceedings with Siemens

Press kit. Areva in China

International Nuclear Information System (INIS)

2004-10-01

The results achieved in the nuclear energy field illustrate the exemplary nature of the cooperation between France and China. Over 20 years, China has developed the nuclear technology for generating electricity, using the expertise and knowledge of the AREVA Group. AREVA has been present in China since 1986 and now employs 3,500 staff there. The group supplied the nuclear islands for 4 reactors at Daya Bay and Ling Ao as well as technology and equipment for 4 more reactors at the Qinshan II and Tianwan plants. AREVA has developed an ambitious program for transferring technology to the Chinese industry and developing local skills. The group's objective is to remain China's partner of choice in terms of its nuclear program. During an official visit to France in June 2004, China's Vice Premier Zeng Peiyan said he was in favor of 'overall and long-lasting cooperation between China and France in the field of nuclear energy'. AREVA took the opportunity to sign two letters of intent for cooperation over technology from its next generation of nuclear reactors. Electricity consumption forecasts report a need for 900 GW through 2020 and the country's objective is to increase nuclear-generated electricity from 1% to 4% of its total output (36 GW: the equivalent of around twenty 1,500 MWe reactors). An official decision to build 4 new reactors was announced in July 2004 and a further decision concerning another 4 reactors is expected in the near future. Various construction sites are being considered, mainly along the country's eastern coast. An official decision to build four duplicate reactors was announced n July 2004. In addition to these four duplicate reactors to be built on existing sites, China has decided to build four 3. generation reactors at Yangjiang and Sanmen. An international call for tender was launched on September 28, 2004. AREVA will reply to the tender by offering its EPR model. AREVA also aims to expand its Chinese operations into exploring and extracting

Areva: a future to be prepared; Areva: un avenir a preparer

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

The Areva group was created on September 3, 2001 from the fusion of the activities of CEA-Industrie, Framatome and Cogema. It is today one of the first world actor of the nuclear sector, of the sector of new technologies and of the sector of connectors engineering. This paper recalls the factors that led to a reorganization of the French nuclear sector and to the creation of the Areva group. It briefly summarizes the forthcoming missions of Areva. (J.S.)

Areva - Results for the first half of 2009

International Nuclear Information System (INIS)

2009-01-01

Areva Group's results for the first half of 2009 can be summarized as follows: - Backlog of 48,876 million euro: +28% compared to June 30, 2008; - Sales revenue of 6,522 million euro: + 6% compared to the first half of 2008; - Operating income before additional provision for the Finnish OL3 project: 566 million euro, representing an operating margin of 8.7%; - Operating income: 16 million euro; - Net income attributable to equity holders of the parent: 161 million euro, or 4.55 euro per share; - Net debt of 6,414 million euro; - AREVA capital increase and opening of capital to strategic and industrial partners and launch of an open call for bids for the T and D activity; - Granting of a long-term Standard and Poor's 'A' rating and confirmation of the short-term 'A1' rating - stable outlook. Based on the consolidation scope as at June 30, 2009, AREVA anticipates for the financial year 2009: - strong growth in the backlog; - strong growth in sales revenue; - operating income close to that of the financial year 2008. The document includes the transparencies of the presentation of the first half 2009 results

Report on responsible growth. AREVA in 2008

International Nuclear Information System (INIS)

2009-01-01

All over the world, AREVA supplies its customers with solutions for carbon-free power generation and electricity transmission and distribution. With its knowledge and expertise in these fields, the group has a leading role to play in meeting the world's energy needs. Ranked first in the global nuclear power industry, AREVA's unique integrated offering covers every stage of the fuel cycle, reactor design and construction, and related services. In addition, the group is expanding its operations in renewable energies. AREVA is also a world leader in electricity transmission and distribution and offers its customers a complete range of solutions for greater grid stability and energy efficiency. Sustainable development is a core component of the group's industrial strategy. Its 75,000 employees work every day to make AREVA a responsible industrial player that is helping to supply ever cleaner, safer and more economical energy to the greatest number of people. Sustainable development is a keystone of AREVA's industrial strategy for achieving growth that is profitable, socially responsible and respectful of the environment. To translate this choice into reality, AREVA integrates sustainable development into its management practices via a continuous improvement initiative revolving around ten commitments: customer satisfaction, financial performance, governance, community involvement, environmental protection, innovation, continuous improvement, commitment to employees, risk management and prevention, dialogue and consensus building. This document is Areva's 2008 report on responsible growth. After the Messages from the Chairman of the Supervisory Board and from the Chief Executive Officer, the report presents the Key data and Highlights of the period, the Corporate governance, the Organization of the group, the Share information and shareholder relations, the uranium reserves, the growing energy demand and the World's population demographic growth, Areva's actions to

Proceedings of the Areva Technical Days. Session 5

International Nuclear Information System (INIS)

2004-01-01

This document presents the proceedings of the Areva technical days, presented during the session 5 the 9 and 10 december 2004, at Istanbul. It deals with the operations of the transmission and distribution division. With manufacturing facilities in over 40 countries and a sales network in over 100, Areva offers customers technological solutions for nuclear power generation and electricity transmission and distribution (the Group also provides interconnect systems to the telecommunications, computer and automotive markets). It provides five topics: a general presentation of Areva, the strategic stakes for transmission and distribution by world-zone, economic and strategic stakes of business unit products, business unit systems and business unit automation. (A.L.B.)

Proceedings of the Areva Technical Days. Session 5

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

This document presents the proceedings of the Areva technical days, presented during the session 5 the 9 and 10 december 2004, at Istanbul. It deals with the operations of the transmission and distribution division. With manufacturing facilities in over 40 countries and a sales network in over 100, Areva offers customers technological solutions for nuclear power generation and electricity transmission and distribution (the Group also provides interconnect systems to the telecommunications, computer and automotive markets). It provides five topics: a general presentation of Areva, the strategic stakes for transmission and distribution by world-zone, economic and strategic stakes of business unit products, business unit systems and business unit automation. (A.L.B.)

EPZ and AREVA. A longstanding partnership for the safe and reliable operation of the Dutch Borssele nuclear power plant

International Nuclear Information System (INIS)

Broy, Yvonne; Linger, Monique

2014-01-01

After 40 years of service, it belongs to the safest 25 % of all light-water reactors in the western hemisphere thanks to continuous modernisation. In doing so, Borssele is setting standards for maintenance and upgrades. In view of the continuation of operation until 2034, further comprehensive modernisation projects are planned. The plant operator, the Dutch N.V. Elektriciteitsproduktiemaatschappij (EPZ), decided to tackle this challenge with the support of its long-standing partner AREVA. Another milestone is coming up soon: The safety I and C shall gradually be changed to digital technology in the next years. Apart from close cooperation in plant technology, EPZ and AREVA also cooperate in fuel supply, as well as in the area of service and maintenance work.

Nuclear renaissance in the reactor training of Areva

International Nuclear Information System (INIS)

De Braquilanges, Bertrand; Napior, Amy; Schoenfelder, Christian

2010-01-01

Because of the perspectives of new builds, a significant increase in the number of design, construction and management personnel working in AREVA, their clients and sub-contractors has been estimated for the next future. In order to cope with the challenge to integrate newly hired people quickly and effectively into the AREVA workforce, a project - 'Training Task Force (TTF)' - was launched in 2008. The objective was to develop introductory and advanced courses and related tools harmonized between AREVA Training Centers in France, Germany and USA. First, a Global Plants Introductory Session (GPIS) was developed for newly hired employees. GPIS is a two weeks training course introducing in a modular way AREVA and specifically the activities and the reactors technical basics. As an example, design and operation of a nuclear power plant is illustrated on EPRTM. Since January 2009, these GPIS are held regularly in France, Germany and the US with a mixing of employees from these 3 regions. Next, advanced courses for more experienced employees were developed: - Advanced EPR TM , giving a detailed presentation of the EPR TM reactor design; - Codes and Standards; - Technical Nuclear Safety. Finally, feasibility studies on a Training Material Management (TMM) system, able to manage the training documentation, and on a worldwide training administration tool, were performed. The TTF project was completed mid of 2009; it transferred their recurrent activities to a new AREVA training department. This unit now consists of the French, German and US Reactors Training Centers. In particular, all courses developed by the TTF are now implemented worldwide with an opening to external trainees. The current worldwide course catalogue includes training courses for operation and maintenance personnel as well as for managers, engineers and non technical personnel of nuclear operators, suppliers, safety authorities and expert organizations. Training delivery is supported effectively by tools

Areva as of December 31, 2011

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du

2012-01-01

In 2011, AREVA's consolidated revenue came to 8.872 billion euros, down slightly (-2.6%) compared with 2010 (-1.2% like for like). The decrease in revenue in nuclear operations was partially offset by significant growth in the renewable energies business. Foreign exchange and changes in the scope of consolidation had respectively a negative impact of 113 million euros and 16 million euros over the period. Revenue totaled 2.922 billion euros in the fourth quarter of 2011, stable compared with the fourth quarter of 2010 (-0.5% on a reported basis and -0.5% like for like). Foreign exchange had a negligible impact during the period. Led by nuclear operations, the group's backlog was 45.6 billion euros at December 31, 2011, up 3.1% year on year and 6.7% in relation to September 30, 2011. Order cancellations since Fukushima were limited to 464 million euros as of December 31, 2011. In accordance with the requirements of IFRS 8, AREVA's business segment information is presented for each operating Business Group (BG), which is the level of information examined by the group's governance bodies. Subsequent to the establishment of a subsidiary combining all of the group's mining operations, data for the Mining Business Group are now reported separately from those of the Front End Business Group. Data used for comparisons with 2010 were restated to reflect this new organization. The business segment information therefore corresponds to AREVA's five operating Business Groups: Mining, Front End, Reactors and Services, Back End and Renewable Energies

Rosatom, the Russian who wants to dethrone Areva

International Nuclear Information System (INIS)

Maincent, G.

2009-01-01

On March 3, 2009, Rosatom, the Russian atomic agency, signed an agreement with Siemens (Germany) for the creation of a common nuclear company. The objective is to become the World leader of the nuclear industry and to gain market shares on General Electric-Hitachi and Toshiba-Westinghouse. This is the spectacular consequence of the Siemens/Areva split from Areva NP, the reactor division of the Areva group. Rosatom gathers 89 civil nuclear companies inside the Atomenergoprom entity and is going to benefit from Siemens' know-how in the domains of instrumentation and control systems and reactors operation. Thanks to this alliance, the volume of Atomenergoprom's activities should grow up rapidly in particular in central and eastern Europe and more particularly in emerging countries. (J.S.)

Areva in Niger

International Nuclear Information System (INIS)

2005-02-01

Niger is the second poorest country in the world but it has natural resources underground in the form of uranium ores deposits. This uranium is currently mined by two companies incorporated under Nigerian law: Somair and Cominak, operated by the principal shareholder Areva (through its subsidiary Cogema). After a presentation of Somair and Cominak key figures, this document details the working conditions and radiological protection, the environmentally friendly operations, the production traceability, the local economic development, the strengthening of the health care system and the development of the infrastructure. (A.L.B.)

Areva 2007 results: accelerated growth and significantly improved profitability; Areva resultats 2007: acceleration de la croissance et hausse significative de la profitabilite

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-02-15

The AREVA group recorded accelerated growth and increased profitability in 2007, meeting both of its objectives for the year. The group made strategic inroads in fast growing markets. AREVA's integrated model met with record success in China, where GGNPC acquired two EPR nuclear islands in a combined order including both the reactors and the fuel, and the creation of a joint venture in engineering. Its T and D division was awarded the largest contract of its history in Qatar, making it the leader in a region where T and D was not even present a few years ago. For more than three years, AREVA has built up its capacity to meet surging demand in the nuclear power and T and D markets through an active policy of research and development and by capitalizing on the diversity and strength of its partnerships. Areva hired 8,600 people in 2006 and 11,500 people in 2007; this represents an investment in recruitment, training and integration of approximately euro 200 million per year. For 2008, the group foresees a further increase in its backlog, sales revenue and operating income. The Areva Group financial statements for 2007 are summarized below: - Backlog: euro 39.8 billion, up 55%; - Sales revenue: euro 11.9 billion, up 9.8% (up 10.4% like-for-like); - Operating income: euro 751 million, i.e. 6.3% operating margin, up 2.6 points compared with 2006; - Net income attributable to equity holders of the parent: euro 743 million (euro 20.95 per share), up from euro 649 million in 2006 (euro 18.31 per share); - Net debt: euro 1.954 billion, linked to the acquisition of UraMin; - Dividend: euro 6.77, to be proposed to the Annual General Meeting of Shareholders convening on April 17, 2008.

Status of safety at Areva group facilities. 2007 annual report; Areva, etat de surete des installations nucleaires. Rapport annuel 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This report describes the status of nuclear safety and radiation protection in the facilities of the AREVA group and gives information on radiation protection in the service operations, as observed through the inspection programs and analyses carried out by the General Inspectorate in 2007. Having been submitted to the group's Supervisory Board, this report is sent to the bodies representing the personnel. Content: 1 - A look back at 2007 by the AREVA General Inspector: Visible progress in 2007, Implementation of the Nuclear Safety Charter, Notable events; 2 - Status of nuclear safety and radiation protection in the nuclear facilities and service operations: Personnel radiation protection, Event tracking, Service operations, Criticality control, Radioactive waste and effluent management; 3 - Performance improvement actions; 4 - Description of the General Inspectorate; 5 - Glossary.

Areva 2007 results: accelerated growth and significantly improved profitability

International Nuclear Information System (INIS)

2008-02-01

The AREVA group recorded accelerated growth and increased profitability in 2007, meeting both of its objectives for the year. The group made strategic inroads in fast growing markets. AREVA's integrated model met with record success in China, where GGNPC acquired two EPR nuclear islands in a combined order including both the reactors and the fuel, and the creation of a joint venture in engineering. Its T and D division was awarded the largest contract of its history in Qatar, making it the leader in a region where T and D was not even present a few years ago. For more than three years, AREVA has built up its capacity to meet surging demand in the nuclear power and T and D markets through an active policy of research and development and by capitalizing on the diversity and strength of its partnerships. Areva hired 8,600 people in 2006 and 11,500 people in 2007; this represents an investment in recruitment, training and integration of approximately euro 200 million per year. For 2008, the group foresees a further increase in its backlog, sales revenue and operating income. The Areva Group financial statements for 2007 are summarized below: - Backlog: euro 39.8 billion, up 55%; - Sales revenue: euro 11.9 billion, up 9.8% (up 10.4% like-for-like); - Operating income: euro 751 million, i.e. 6.3% operating margin, up 2.6 points compared with 2006; - Net income attributable to equity holders of the parent: euro 743 million (euro 20.95 per share), up from euro 649 million in 2006 (euro 18.31 per share); - Net debt: euro 1.954 billion, linked to the acquisition of UraMin; - Dividend: euro 6.77, to be proposed to the Annual General Meeting of Shareholders convening on April 17, 2008

Nuclear renaissance in the reactor training of Areva

Energy Technology Data Exchange (ETDEWEB)

De Braquilanges, Bertrand [Reactor Training Center/France Manager, La Tour Areva - 1, place Jean Millier - 92084 Paris - La Defense (France); Napior, Amy [Reactor Training Center/USA Manager, 1300 Old Graves Mill Road - Lynchburg VA, 2450 (United States); Schoenfelder, Christian [Reactor Training Center/Germany Manager, Kaiserleistrasse 29 - 63067 Offenbach (Germany)

2010-07-01

Because of the perspectives of new builds, a significant increase in the number of design, construction and management personnel working in AREVA, their clients and sub-contractors has been estimated for the next future. In order to cope with the challenge to integrate newly hired people quickly and effectively into the AREVA workforce, a project - 'Training Task Force (TTF)' - was launched in 2008. The objective was to develop introductory and advanced courses and related tools harmonized between AREVA Training Centers in France, Germany and USA. First, a Global Plants Introductory Session (GPIS) was developed for newly hired employees. GPIS is a two weeks training course introducing in a modular way AREVA and specifically the activities and the reactors technical basics. As an example, design and operation of a nuclear power plant is illustrated on EPRTM. Since January 2009, these GPIS are held regularly in France, Germany and the US with a mixing of employees from these 3 regions. Next, advanced courses for more experienced employees were developed: - Advanced EPR{sup TM}, giving a detailed presentation of the EPR{sup TM} reactor design; - Codes and Standards; - Technical Nuclear Safety. Finally, feasibility studies on a Training Material Management (TMM) system, able to manage the training documentation, and on a worldwide training administration tool, were performed. The TTF project was completed mid of 2009; it transferred their recurrent activities to a new AREVA training department. This unit now consists of the French, German and US Reactors Training Centers. In particular, all courses developed by the TTF are now implemented worldwide with an opening to external trainees. The current worldwide course catalogue includes training courses for operation and maintenance personnel as well as for managers, engineers and non technical personnel of nuclear operators, suppliers, safety authorities and expert organizations. Training delivery is supported

AREVA in India

International Nuclear Information System (INIS)

2008-01-01

India is the sixth largest energy consumer in the world and its demand is rising rapidly. To support its economic growth, estimated to be 8% on average over the last three years and to ensure access to electricity for all, the country foresees massive investments in its power sector over the next five years. India is therefore an essential market for the AREVA Group, where its Transmission and Distribution division plays a leading role on the strategic grid modernization market. This document presents: 1 - the economic situation in India: Key figures, Growth, India's growing need for electricity, India's energy sources and policy: current mix, driving role of the State, the financial reorganization of the SEBs, the 'Mega-Power' projects, the electricity act, the rural electrification program, the Investments. 2 - Civil nuclear energy: a strong potential for development; 3 - India's transmission and distribution network: the power challenge of the transmission network, the efficiency challenge of the distribution network. 4 - AREVA T and D in India: AREVA T and D profile, Areva's presence in India, market share, T and D customers and flagship projects

1. half results 2003 - AREVA group; Resultats du 1. semestre 2003 - groupe AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-10-01

This financial presentation of the Areva group, the world nuclear industry leader, results for the first half 2003 highlights the good level of activity, the negotiations with URENCO in final stages concerning the enrichment, the revision of estimates and negotiations underway concerning the dismantling and the operating income positive in Q2 2003 concerning the connectors division. (A.L.B.)

Areva in 2006

International Nuclear Information System (INIS)

2007-01-01

This document is the 2006 activity report of the Areva group and presents the 2006 highlights of the nuclear division (front end of the nuclear cycle, pressurized water reactors, treatment and recycling of used nuclear fuel) and of the Transmission and Distribution division. Content: Message from the Chairman of the Supervisory Board; Message from the Chief Executive Officer; the World in 2006; Areva 2006 highlights; business review; key data; Areva around the World; policy of continuous innovation; five years of sustainable development; governance; Continuous improvement; Financial performance; Innovation; Customer satisfaction; Commitment to employees; Environmental protection; Risk management and prevention; Dialogue and consensus building; Community involvement; corporate governance; organization of the group; Share information and shareholder relations; glossary; learn more

AREVA - 2012 annual results: significant turnaround in performance one year after launching the Action 2016 plan

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Kempkes, Vincent; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2013-01-01

One year after launching Areva's Action 2016 strategic plan, the first results are in. AREVA is ahead of schedule in executing its recovery plan. While pursuing its efforts in the management of a few difficult projects (such as OL3), Areva group was able to return to a virtuous performance cycle rooted in strong growth in nuclear order intake and good progress on its cost reduction program. Commercially, despite the difficult economic environment, AREVA was able to capitalize on its leadership in the installed base and on its long-term partnerships with strategic customers, beginning with EDF, with which AREVA renewed a confident and constructive working relationship. Areva has secured 80% of its objective of one billion euros of savings by the end of 2015 to improve its competitiveness. The group also continued efforts to optimize working capital requirement and control the capital expenditure trajectory. Together, these results enabled AREVA to exceed the objectives set for 2012 for two key indicators of its strategic plan: EBITDA and free operating cash flow. Nearly 60% of the 2.1 billion euros devoted to capital expenditures for future growth in 2012 were funded by operations, a quasi-doubled share compared to 2011. Areva's floor target for asset disposals was achieved one year ahead of schedule, also helping the Group to control its net debt, which remained below 4 billion euros. In 2013, Areva is continuing to implement the Action 2016 plan to keep its turnaround on track. In summary: - Backlog renewed over the year 2012 to euro 45.4 bn thanks to the increase in nuclear order intake; - Sales revenue growth: euro 9.342 bn (+5.3% vs. 2011), led by nuclear and renewables operations; - Very sharp upturn in EBITDA: euro 1.007 bn (+euro 586 m vs. 2011) - Very net improvement in free operating cash flow: -euro 854 m (+euro 512 m vs. 2011); - Back to positive reported operating income: euro 118 m (+euro 1.984 bn vs. 2011); - 2012-2013 floor target for asset disposals

AREVA: Operating performance shows distinct improvement; Results heavily impacted by the cost of remedial measures

International Nuclear Information System (INIS)

2016-01-01

The 2015 results illustrate the progress AREVA made in 2015 and open up favorable prospects for 2016 and the following years in view of its fundamentals. The group's competitiveness plan had a very positive impact on its costs and cash, despite the heavy net loss situation which continues and in a market environment that remained difficult in 2015. Half of this loss of 2 billion Euro is due to additional provisions for OL3 and half to provisions for restructuring and impairment related to market conditions. Concerning the group's liquidity, 2016 is funded and the capital increase which will be launched in the coming months will enable AREVA to gradually regain the group's positive profile. A new phase awaits the Group in 2016 with clarity and confidence in the implementation of the restructuring announced in 2015 and in particular the autonomy of AREVA NP and the creation of New AREVA

Areva: questions about a champion

International Nuclear Information System (INIS)

Bottois, P.

2009-01-01

Siemens announced in January 26, 2009 its decision to leave Areva NP, i.e. the Areva/Siemens common daughter company for reactors. This news re-launches the questions about the long-term financing strategy of the Areva group, of its capitalistic partnerships and of its position in the world nuclear market. Siemens on its side wishes to preserve its position in this market and a possible cooperation with the Russian AtomEnergoProm is under discussion. Areva, the world leader of nuclear industry, integrates a mining activity as well and is the world number 3 of uranium exploitation (15% of the world offer). It wishes to double its production by 2012 thanks to big investments in Niger, Namibia and Canada. Areva is developing its enrichment capacities as well thanks to the future Georges-Besse II ultracentrifugation facility which is under construction at Tricastin (Drome, France) and which should be put into service in 2009. And finally, a second EPR (European pressurized reactor), the new generation of Areva reactors, is to be built at Penly (Haute Normandie, France) between 2012 and 2017 and will generate 1400 employments in the region. (J.S.)

Areva - Updated Reference Document 2015 Including the 2016 half-year financial report

International Nuclear Information System (INIS)

2016-01-01

Areva supplies high added-value products and services to support the operation of the global nuclear fleet. The company is present throughout the entire nuclear cycle, from uranium mining to used fuel recycling, including nuclear reactor design and operating services. Areva is recognized by utilities around the world for its expertise, its skills in cutting-edge technologies and its dedication to the highest level of safety. Areva's 40,000 employees are helping build tomorrow's energy model: supplying ever safer, cleaner and more economical energy to the greatest number of people. This Reference Document contains information on Areva's objectives, prospects and development strategies. It contains estimates of the markets, market shares and competitive position of Areva. Contents: 1 - Persons responsible; 2 - Information on operations and recent events (Overview of the Group's operations, Simplified organization chart of the Group, Implementation of the Group's strategic roadmap and Restructuring Plan, Deployment of the performance plan, Other significant transactions since the filing of the Reference Document, Review of third quarter 2016 operations, Press releases); 3 - Financial information (2016 Half-year financial report, Statutory auditors' report on the half-year financial information for the period January 1 to June 30, 2016, Unaudited consolidated pro-forma financial information, Statutory auditors' report on the pro-forma financial information); 4 - Risk factors (Risks related to the Restructuring Plan, Legal risks, Industrial and environmental risks, Operational risks, Liquidity and market risks); 5 - Cash and capital resources (Financial outlook, 12-month liquidity); 6 - Governance; 7 - Workforce - jobs (Voluntary departure plan and change in the Group's workforce, Signature of a memorandum of understanding ensuring the stability of labor agreements, Reorganization and refinancing of the Group); 8 - Share

AREVA and sustainable development. 2002 report; AREVA et le developpement durable. Rapport 2002

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-07-01

The performance indicators in this report reflect the major sustainable development impacts and challenges that Areva is facing as a group due to the very nature of its operations. They chose the calendar year as reporting period, from January 1 to December 31. This report covers all of the group operations in France and abroad. This report presents an overview of the major financial, social and environmental challenges facing the group. This report is a companion document to the annual activity report. (A.L.B.)

EPR by Areva. The path of greatest certainty

International Nuclear Information System (INIS)

2008-01-01

AREVA's Evolutionary Power Reactor (EPR) is the first Generation III+ reactor design currently being built to answer the world's growing demand for clean and reliable electricity generation. Already under construction in Finland, France and China, the EPR is also being considered by America, United Kingdom, South Africa and other countries for the development of their nuclear fleet. The EPR is now clearly destined to become the mainstay of standardized, efficient reactor fleets around the globe. AREVA's EPR incorporates unbeatable know-how provided by an uninterrupted track record of reactor building activities and backed by decades of feedback experience from operating PWRs, including the most recent. The EPR is a Franco-German initiative which benefited from the stringent scrutiny of safety authorities from both countries, at each stage of the project. The EPR has already secured construction licenses from two of the world's most demanding safety authorities in France and Finland and is currently in line for a design certification and a combined construction and operating license (COL) in the USA. It is also taking part in the licensing process recently launched in the United Kingdom. Europe's leading utilities have granted the EPR their approval under the 'European Utilities Requirements' and have further expressed individual interest in the design and performance of the EPR for their businesses. AREVA is the only Gen III+ reactor constructor in the world with ongoing building experience. To date, AREVA is the only vendor who has the necessary field experience that future customers can benefit: - Detailed design completed; - Experience feedback from 87 PWR; - 3 projects going on; - Continuous PWR experience in design and construction. Close to 100% of the EPR primary circuit heavy components are sourced directly from AREVA's integrated plants. Engineering, manufacturing, services and fuel cycle management are totally integrated and mastered by AREVA. From its

4. European forum of radiation protection sciences. Proceedings

International Nuclear Information System (INIS)

2010-09-01

This 4. European forum of radiation protection sciences was the occasion for nuclear professionals to share their experience and to present the tools and techniques implemented in dismantling operations in the respect of radiation protection rules. This document brings together the abstracts and the available presentations given at this forum: 1 - Dismantling organisation and management - regulations: dismantling environment (A. Gay, Areva NC); Dismantling at the CEA (Ph. Guiberteau, DEN-Saclay); Optimisation of future dismantlement at the design and operation stage of facilities (P. Poncet, Areva); Action of the labour Ministry for workers radiation protection (T. Lahaye, DGT); 2 - Dismantling experience feedbacks 1: Radiation protection and dismantlement at Marcoule (J. Chardin, Areva NC); INB 106 dismantling (N. Pauwels, UDIL); Dismantling wastes management and valorisation of ALS and Saturne accelerators at Saclay (C. Salmon, CEA-Saclay); Chooz power plant deconstruction (L. Bardou, EDF); 3-4 - Dismantling projects: Phenix power plant dismantling (C. Beretti, CEA-Marcoule); Radiological characterization impact on the DGB project (H.C. Turbatte, F. Lemperiere, DGB Eurodif); Contribution of scientific calculations to reactor dismantling studies (A. Van Lauwe, CEA-Saclay); Acceptance committee of radiological cleansing companies (S. Faure, DPSN); Externalizing of the radiation protection skilled person (J.P. Piferrer, ATSR); International network of radiation protection professionals (G. Abela, EDF); 5 - Dismantling experience feedback 2: gloveboxes dismounting at La Hague plant (R. Choquet, P. Mougnard, Areva NC); Nuclear submarines dismantling in Russia (C. Deregel, Topp-Decide); Radioactive waste management of CERN accelerators (Y. Algoet, CERN); Nuclear facilities decommissioning (M. Berton, CEA, B. Marc, DRIM Sogeris); Asbestos removal in radiological environment (R. Blanc, Areva NC); 6-7-8 - Tools and methods: Aspilaser, decontamination by laser ablation (F

Ramp-up - Areva Resources Canada Inc. 2015 annual sustainability review

International Nuclear Information System (INIS)

2016-01-01

Areva Resources Canada Inc. is a subsidiary of the Areva group. 2015 was the first full year of production at McClean Lake operation after four years of care and maintenance without production. A record-breaking 11.3 million pounds of uranium concentrate was produced at the McClean Lake mill in 2015, well above targets and up from a past maximum output of 6.5 million pounds. Areva's share of 2015 production at the mill totaled 4.2 million pounds. The substantial rise in output at McClean Lake is a direct result of Areva's upgrade and expansion work at the mill and the higher grade ore coming from its partnership with the Cigar Lake mine. With the upgrade, McClean Lake family has grown to 330 permanent employees with many more hired to complete specific projects. With the joint venture partnerships in the McArthur River mine and Key Lake mill, Areva's share of uranium concentrate production reached 12.9 million pounds. Despite the many successes, the fires that burned through northern Saskatchewan early in the summer of 2015 threatened the local communities

Nuclear. Areva, a French fission

International Nuclear Information System (INIS)

Dupin, Ludovic

2015-01-01

This article comments the difficulties and problems faced by Areva for its activity of nuclear reactor construction, and which leaded to the transfer of this activity from Areva to EDF while Areva will keep its uranium providing and fuel enrichment activities. These difficulties and problems concern the Flamanville EPR (the construction is 5 years late, vessel defects have just been identified, cost overruns), the Finnish EPR (7 years late, a 5 billions cost overrun), the Jules Horowitz research reactor (5 years late, cost overrun), and strategic choices (notably with respect to the post-Fukushima context). The article also outlines that other activities (mining, enrichment, reactor maintenance) are still doing well, and then briefly discusses the future of Areva NP

Responsible Development of Areva's Mining Activities. Report 2012

International Nuclear Information System (INIS)

2013-09-01

This annual report, prepared by the Corporate Social Responsibility Department of Areva Mines, is the result of the mobilization of all our teams present at Areva's mining sites as well as those in Areva corporate support functions (compliance, sustainable development, etc). The data given cover the assets for which Areva acts as operator in uranium mining activities: exploration, project development, production and rehabilitation. The consolidated data target activities in France, Canada, Niger, Kazakhstan, Mongolia, Gabon and Namibia. Activities in the Central African Republic and those linked to La Mancha no longer fall within the scope of this report (sale of assets in 2012). By defining Areva's strategy and policies, this report aims to demonstrate Areva's performance in the key areas of mining activity responsibility: ethics and governance, social report, the environment, occupational health and safety, community involvement, commitments to stakeholders. This report is the third edition of this annual exercise. The results for Areva's main performance indicators are shown for the last three years (2010 to 2012). Some important information relates to the first half of 2013. Areva is a member of the International Council on Mining and Metals (ICMM). In this context, Areva's policies and commitments in terms of social responsibility are based on the ten sustainable development principles defined by the ICMM, as well as the associated 'position statement' documents. To this end, Areva's specialists are involved in the different working groups that bring together ICMM members to discuss the various sustainable development issues encountered in the extractive sector. Members of our top-level management form part of the Council of this organization. More generally, Areva has made a large number of commitments and works with professional organizations and international institutions. A file listing these various commitments is

The State regains control of Areva

International Nuclear Information System (INIS)

Dupin, Ludovic

2014-01-01

This article first gives an overview of problems faced by Areva during the past years: financial losses, new delay for the Finnish EPR and for the French one in Flamanville, delay for the construction of the Jules Horowitz reactor, bad investments, high expenses in offshore wind energy and solar energy. The second part comments the decision taken by the government for a closer relationship between Areva and EDF, the perspectives for Areva associated with the extension of French reactor lifetime, new orientation of activities and definition of a new strategy for Areva

Waste Estimates for a Future Recycling Plant in the US Based Upon AREVA Operating Experience - 13206

Energy Technology Data Exchange (ETDEWEB)

Foare, Genevieve; Meze, Florian [AREVA E and P, SGN - 1, rue des Herons, 78182 Montigny-le-Bretonneux (France); Bader, Sven; McGee, Don; Murray, Paul [AREVA Federal Services LLC, 7207 IBM Drive, Mail Code CLT- 1D, Charlotte NC 28262 (United States); Prud' homme, Pascal [AREVA NC SA - 1, place Jean Millier, 92084 Paris La Defense CEDEX (France)

2013-07-01

Estimates of process and secondary wastes produced by a recycling plant built in the U.S., which is composed of a used nuclear fuel (UNF) reprocessing facility and a mixed oxide (MOX) fuel fabrication facility, are performed as part of a U.S. Department of Energy (DOE) sponsored study [1]. In this study, a set of common inputs, assumptions, and constraints were identified to allow for comparison of these wastes between different industrial teams. AREVA produced a model of a reprocessing facility, an associated fuel fabrication facility, and waste treatment facilities to develop the results for this study. These facilities were divided into a number of discrete functional areas for which inlet and outlet flow streams were clearly identified to allow for an accurate determination of the radionuclide balance throughout the facility and the waste streams. AREVA relied primarily on its decades of experience and feedback from its La Hague (reprocessing) and MELOX (MOX fuel fabrication) commercial operating facilities in France to support this assessment. However, to perform these estimates for a U.S. facility with different regulatory requirements and to take advantage of some technological advancements, such as in the potential treatment of off-gases, some deviations from this experience were necessary. A summary of AREVA's approach and results for the recycling of 800 metric tonnes of initial heavy metal (MTIHM) of LWR UNF per year into MOX fuel under the assumptions and constraints identified for this DOE study are presented. (authors)

Energy. Saving 'Private' Areva

International Nuclear Information System (INIS)

Dupin, Ludovic

2015-01-01

While Areva keeps on loosing money (billions of euros for 2014), the saving of this company is at stake. Staff is already planned to be reduced in La Hague, and other staff reductions might occur after the failure of a previous strategic plan. Various activities could be sold (dismantling, mining). The article outlines the difficult relationships between Areva and EDF and the problems also faced by EDF. Some actors think that Areva should remain independent from EDF in order to be free to compete on international bidding. The rapprochement between these two companies is said to be necessary for the Ministry but seems very difficult to achieve

Export Control in the AREVA Group

International Nuclear Information System (INIS)

Zero, S.

2013-01-01

After the Second World War the nuclear technology was mostly considered inappropriate for the export. It remains strictly regulated today, but the development of the civil applications urged states to facilitate the peaceful uses while establishing a strict control in the domains of the internal security and the nuclear proliferation. AREVA decided to set up an Export Control program applied to all the products and in all the countries where the group operates. AREVA can export products or make transfer of technology considered as sensitive for the non-proliferation and the risks linked to the terrorism. This sensitiveness results from the nature of the products or from the country of destination and in certain cases both of them. AREVA has set up an Export Control program and an interactive e-learning training within the Group to make exports of sensitive products, raw materials and technologies more secure. The subject is rather complex, the regulations are constantly evolving, and becoming familiar with them is necessarily a gradual process, but it must be made in-depth, hence the idea of regular training sessions. The implementation of the Export Control in the AREVA Group declines in four fundamental stages: -) Policy and procedure; -) Appointment of Export Control Officers (ECO); -) Training; and -) Audit and Self Assessment. The training program is composed by the following elements: Ethics (Value Charter) of the Group, Non-proliferation, international regulations and more particularly those that are applicable in Europe (Germany and France) and in the United States. Particular attention is devoted to the Export Control practice in China, Japan and India. (A.C.)

EPR by Areva. The path of greatest certainty

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

AREVA's Evolutionary Power Reactor (EPR) is the first Generation III+ reactor design currently being built to answer the world's growing demand for clean and reliable electricity generation. Already under construction in Finland, France and China, the EPR is also being considered by America, United Kingdom, South Africa and other countries for the development of their nuclear fleet. The EPR is now clearly destined to become the mainstay of standardized, efficient reactor fleets around the globe. AREVA's EPR incorporates unbeatable know-how provided by an uninterrupted track record of reactor building activities and backed by decades of feedback experience from operating PWRs, including the most recent. The EPR is a Franco-German initiative which benefited from the stringent scrutiny of safety authorities from both countries, at each stage of the project. The EPR has already secured construction licenses from two of the world's most demanding safety authorities in France and Finland and is currently in line for a design certification and a combined construction and operating license (COL) in the USA. It is also taking part in the licensing process recently launched in the United Kingdom. Europe's leading utilities have granted the EPR their approval under the 'European Utilities Requirements' and have further expressed individual interest in the design and performance of the EPR for their businesses. AREVA is the only Gen III+ reactor constructor in the world with ongoing building experience. To date, AREVA is the only vendor who has the necessary field experience that future customers can benefit: - Detailed design completed; - Experience feedback from 87 PWR; - 3 projects going on; - Continuous PWR experience in design and construction. Close to 100% of the EPR primary circuit heavy components are sourced directly from AREVA's integrated plants. Engineering, manufacturing, services and fuel cycle management are totally

AREVA and sustainable development - 2003 report; Rapport developpement durable 2003 - AREVA

Energy Technology Data Exchange (ETDEWEB)

Lauvergeon, A

2003-07-01

The first report helped establish the status of Areva entities sustainable development performance and identify areas for improvement. This second report will report on the continuous improvement process, including accomplishments and projects initiated as well as difficulties encountered and ground yet to be covered. It includes, the Areva role in key sustainable development issues, the commitments and the governance, the risk management, the economic responsibility, the social responsibility and the environmental responsibility. (A.L.B.)

The Areva Group; Le groupe Areva

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-08-01

This document provides information on the Areva Group, a world nuclear industry leader, offering solutions for nuclear power generation, electricity transmission and distribution and interconnect systems to the telecommunications, computer and automotive markets. It presents successively the front end division including the group business lines involved in producing nuclear fuel for electric power generation (uranium mining, concentration, conversion and enrichment and nuclear fuel fabrication); the reactors and services division which designs and builds PWR, BWR and research reactors; the back end division which encompasses the management of the fuel that has been used in nuclear power plants; the transmission and distribution division which provides products, systems and services to the medium and high voltage energy markets; the connectors division which designs and manufactures electrical, electronic and optical connectors, flexible micro circuitry and interconnection systems. Areva is implemented in Europe, north and south america, africa and asia-pacific. (A.L.B.)

Energy. Areva, the mess

International Nuclear Information System (INIS)

Dupin, L.

2010-01-01

While outlining the different strengths (integrated business model, supplies, experience) and opportunities (Asian market development, nuclear security harmonization objective), this article comments the main weaknesses of Areva: the lack of evolution of its stake holding structure, the existence of a single model of nuclear plant which limits the accessible markets, and the cost and delay of the EPR development and construction in Finland. The author also mentions the various threats on Areva's activities and development: the development of non conventional gases in the United States which challenges the nuclear revival, and the political tensions in Niger which threaten a third of Areva's uranium supplies. A second part comments the development of the Chinese equivalents to the EPR

Responsible Development of Areva's Mining Activities - Report 2011

International Nuclear Information System (INIS)

2012-09-01

The results consolidated at Mining Business Group level and presented in this document mainly relate to the uranium production sites for which Areva is the majority operator. For each stage of the mining life cycle (exploration, project development, operation, closure, redevelopment) much of the data is also reported on a national and international reporting level, and is presented in this document when deemed necessary for the understanding of Areva's activities. This document reports the extra-financial performance of Areva's mining activities for the period from 1 January to 31 December 2011. The extra-financial performance of mining activities presented in this report is underpinned by the Areva group reporting process called STAR (for Sustainability Tools Advanced Reporting). It is supplemented by information collected from in-house experts or from other reporting documents deemed to be valid sources of reference for the subjects discussed. Content: 1 - Approach to responsibility (Being a Responsible Mining Stakeholder, The Fundamentals of Areva's Approach); 2 - Activities (Activities Experiencing Strong Growth, Uranium as a Core Business); 3 - Teams (A Proactive Employment Policy, Employee Health and Safety, Focus: 'I am committed to maintaining safety' campaign yields exemplary results in Namibia); 4 - Environmental policy (Management of Challenges, The Environment Throughout the Entire Mining Lifecycle, Focus: hybrid electricity generation system for prospecting camps in Australia); 5 - Social commitment (Transparency and Openness to Dialogue, Community Involvement, Focus: working group with communities of the province of Saskatchewan in Canada); 6 - Performance (The Main Sustainable Development Indicators, Scope of this Report); 7 - Appendices (Glossary, Communications associated with this report)

Status of safety at Areva group facilities. 2007 annual report

International Nuclear Information System (INIS)

2007-01-01

This report describes the status of nuclear safety and radiation protection in the facilities of the AREVA group and gives information on radiation protection in the service operations, as observed through the inspection programs and analyses carried out by the General Inspectorate in 2007. Having been submitted to the group's Supervisory Board, this report is sent to the bodies representing the personnel. Content: 1 - A look back at 2007 by the AREVA General Inspector: Visible progress in 2007, Implementation of the Nuclear Safety Charter, Notable events; 2 - Status of nuclear safety and radiation protection in the nuclear facilities and service operations: Personnel radiation protection, Event tracking, Service operations, Criticality control, Radioactive waste and effluent management; 3 - Performance improvement actions; 4 - Description of the General Inspectorate; 5 - Glossary

Operational HOF Practices in the AREVA Group to Face New Challenges

International Nuclear Information System (INIS)

Coye de Brunélis, T.; Bachellerie, E.; Sidaner, J.-F.

2016-01-01

Operating experience from TMI and and more general experience from three decades of nuclear facility operations, have shown the value of safety culture’s contribution to nuclear risk management. More than ever, this particular aspect of human and organizational factors (HOF) is central to the AREVA group’s concerns as it faces new challenges. The first generation of operators commissioned the facilities and optimized their operation. This first phase gave them a better understanding of operations and related limits, particularly through testing and start-up operations and the responses that were found for all of the technical issues that arose. All of these interactions offered opportunities to make the safety challenges of processes and facilities tangible and directly perceptible. The young operators of those bygone years are now the ones who are “in the know” in the organizations, the ones with unique technical know-how and a multi-layered perception of the risks involved. Those first generations of operators, with their unique operational knowledge, are gradually leaving the industrial world. Replacing those skills creates a new set of challenges. Concomitantly, the French nuclear safety authority benefited from these facility start-ups to increase its skills by sharing in the learning process concerning the facilities’ operational realities and in the construction of a safety configuration program, and by gaining a concrete perception of risk. This fostered the mutual trust that is vital and integral to facility safety.

Responsible Development of AREVA's Mining Activities - Report 2012

International Nuclear Information System (INIS)

2013-09-01

By defining AREVA's strategy and policies, this report aims to demonstrate the company's performance in the key areas of mining activity responsibility: ethics and governance, social report, the environment, occupational health and safety, community involvement, commitments to stakeholders. The data given cover the assets for which AREVA acts as operator in uranium mining activities: exploration, project development, production and rehabilitation. The consolidated data target activities in France, Canada, Niger, Kazakhstan, Mongolia, Gabon and Namibia. Activities in the Central African Republic and those linked to La Mancha no longer fall within the scope of this report (sale of assets in 2012). This report is the third edition of this annual exercise

Sharing Experiences within AREVA D and D Project Portfolio: Four Illustrations - 13049

International Nuclear Information System (INIS)

Chabeuf, Jean-Michel; Varet, Thierry; AREVA Site Value Development Business Unit, La Hague Site

2013-01-01

Over the past ten years, AREVA has performed D and D operations on a wide range of nuclear sites, such as Marcoule and La Hague recycling plants, to Cadarache MOX fuel fabrication plant or Veurey and Annecy metallic Uranium machining plants. Each site is different from the other but some lessons can be shared through this D and D portfolio. In that respect, knowledge management is one of AREVA D and D Technical Department main missions. Four illustrations demonstrate the interest of knowledge share. Waste management is one of the key activities in D and D; It requires a specific characterization methodology, adapted logistics, and optimized waste channels, all of which have been developed over the years by AREVA teams on the site of Marcoule while they are rather new to La Hague, whose main activity remains fuel reprocessing despite the launch of UP2 400 D and D program. The transfer of know how has thus been organized over the past two years. Plasma cutting has been used extensively in Marcoule for years, while prohibited on the site of La Hague following questions raised about the risks associated wit Ruthenium sublimation. La Hague Technical Department has thus developed an experimental protocol to quantify and contain the Ruthenium risk, the result of which will then be applied to Marcoule where the Ruthenium issue has appeared in recent operations. Commissioning and operating fission products evaporators is a rather standard activity on UP2 800 and UP3, while the associated experience has been decreasing in Marcoule following final shutdown in 1998. When the French atomic Energy commission decided to build and operate a new evaporator to concentrate rinsing effluents prior to vitrification in 2009, AREVA La Hague operators were mobilized to test and commission the new equipment, and train local operators. Concrete scabbling is the final stage prior to the free release of a nuclear facility. In the context of Veurey and Annecy final cleanup and declassification

Sharing Experiences within AREVA D and D Project Portfolio: Four Illustrations - 13049

Energy Technology Data Exchange (ETDEWEB)

Chabeuf, Jean-Michel; Varet, Thierry [AREVA Site Value Development Business Unit, La Hague Site (France); AREVA Site Value Development Business Unit, La Hague Site

2013-07-01

Over the past ten years, AREVA has performed D and D operations on a wide range of nuclear sites, such as Marcoule and La Hague recycling plants, to Cadarache MOX fuel fabrication plant or Veurey and Annecy metallic Uranium machining plants. Each site is different from the other but some lessons can be shared through this D and D portfolio. In that respect, knowledge management is one of AREVA D and D Technical Department main missions. Four illustrations demonstrate the interest of knowledge share. Waste management is one of the key activities in D and D; It requires a specific characterization methodology, adapted logistics, and optimized waste channels, all of which have been developed over the years by AREVA teams on the site of Marcoule while they are rather new to La Hague, whose main activity remains fuel reprocessing despite the launch of UP2 400 D and D program. The transfer of know how has thus been organized over the past two years. Plasma cutting has been used extensively in Marcoule for years, while prohibited on the site of La Hague following questions raised about the risks associated wit Ruthenium sublimation. La Hague Technical Department has thus developed an experimental protocol to quantify and contain the Ruthenium risk, the result of which will then be applied to Marcoule where the Ruthenium issue has appeared in recent operations. Commissioning and operating fission products evaporators is a rather standard activity on UP2 800 and UP3, while the associated experience has been decreasing in Marcoule following final shutdown in 1998. When the French atomic Energy commission decided to build and operate a new evaporator to concentrate rinsing effluents prior to vitrification in 2009, AREVA La Hague operators were mobilized to test and commission the new equipment, and train local operators. Concrete scabbling is the final stage prior to the free release of a nuclear facility. In the context of Veurey and Annecy final cleanup and declassification

The programs for lifetime extension by AREVA

International Nuclear Information System (INIS)

Knoche, P.

2014-01-01

In 2011 AREVA launched 2 worldwide programs to meet the demands of its customers: 'AREVA Safety Alliance' that proposes a set of measures for post-Fukushima safety upgrading and 'AREVA Forward Alliance' that is dedicated to lifetime extension projects. Concerning 'AREVA Safety Alliance' about 150 projects have been carried out for 53 customers in 19 countries, as for 'AREVA Forward Alliance' 60% of the lifetime extension projects in the US have been performed by AREVA. In the framework of lifetime extension projects, upgrading measures and services are proposed such as the installation of hydrogen recombiner units, of filtered ventilation systems for severe accidents, or the upgrading of the reactor control system through the implementation of the digital Teleperm XS technology, or recommendations about the methodology to follow for the repair or replacement of important components. The replacement of steam generators and of the pressurizer and with other upgrading works led to a gain of 18.5% on the output power of the Ringhals-4 unit. (A.C.)

Wind power: Areva acquires a 51% stake in Multibrid

International Nuclear Information System (INIS)

2007-01-01

AREVA announced the acquisition of a 51% stake in Multibrid, a designer and manufacturer of multi-megawatt off-shore wind turbines based in Germany. With this acquisition, AREVA has entered into a joint venture with Prokon Nord, a German off-shore wind turbine and biomass plant developer and current owner of Multibrid. This transaction values Multibrid at euro 150 million. AREVA plans to rapidly further develop Multibrid's activities by giving the company access to its industrial resources, financial base and international commercial network. In return, Multibrid will provide AREVA with its leading-edge technology which, developed for 5 MW turbines, can achieve a very high output while reducing operating costs thanks to a simplified maintenance system. With this stake in Multibrid, AREVA aims to increase its presence on the offshore wind market that meets land settlement requirements and that should grow significantly in the years to come (from 300 MW in Europe today to an expected 1400 MW by 2011). As an exclusive supplier of Prokon Nord, Multibrid will participate in projects such as Borkum West (30 MW), the first offshore project in Germany, Borkum West 2 (400 MW), and Cote d'Albatre (105 MW), the first offshore wind farm project in France. The stake in Multibrid strengthens AREVA's strategic positioning on the CO 2 -free energy market, thanks to complementary solutions ranging from nuclear technologies to renewables. A number of recent achievements illustrate this strategy: - bio-energy (crucial energy supply in numerous rural areas): delivery of turnkey biomass power plants; ongoing construction of 10 plants in India, Thailand and Brazil; future development plans in fast-growing regions, such as Latin America; - wind power: Multibrid adds to the Group's stake in REpower and to its partnership with Suzlon for which AREVA is the number one supplier of transmission and distribution solutions for wind power; - hydrogen and fuel cells: design and manufacture of

Areva. Group dynamics and activities. Competitive environment and strategic perspectives. Release - October 2016

International Nuclear Information System (INIS)

2016-10-01

After a synthesis which notably proposes a SWOT analysis of the Areva group, this report proposes a presentation of the Areva Group (general overview, mining, upstream and downstream poles, shareholder structure and stock market data, competitive environment). It gives an overview of the Areva group dynamics and of its activities through a presentation of an environment analysis (world electric power production, uranium production and consumption, operated nuclear plants in the world), a presentation of the group activity (turnover and order backlog, turnover per segment and per geographical area, operational and net income). It indicates important events and comments development axes: strategic orientations, new partnership with EDF, stronger presence in China, asset disposal, and organisation optimisation. Financial data are presented along with the main economic and financial indicators. Important statistical data are provided

AREVA's fuel assemblies addressing high performance requirements of the worldwide PWR fleet

International Nuclear Information System (INIS)

Anniel, Marc; Bordy, Michel-Aristide

2009-01-01

Taking advantage of its presence in the fuel activities since the start of commercial nuclear worldwide operation, AREVA is continuing to support the customers with the priority on reliability, to: >participate in plant operational performance for the in core fuel reliability, the Zero Tolerance for Failure ZTF as a continuous improvement target and the minimisation of manufacturing/quality troubles, >guarantee the supply chain a proven product stability and continuous availability, >support performance improvements with proven design and technology for fuel management updating and cycle cost optimization, >support licensing assessments for fuel assembly and reloads, data/methodologies/services, >meet regulatory challenges regarding new phenomena, addressing emergent performance issues and emerging industry challenges for changing operating regimes. This capacity is based on supplies by AREVA accumulating very large experience both in manufacturing and in plant operation, which is demonstrated by: >manufacturing location in 4 countries including 9 fuel factories in USA, Germany, Belgium and France. Up to now about 120,000 fuel assemblies and 8,000 RCCA have been released to PWR nuclear countries, from AREVA European factories, >irradiation performed or in progress in about half of PWR world wide nuclear plants. Our optimum performances cover rod burn ups of to 82GWD/tU and fuel assemblies successfully operated under various world wide fuel management types. AREVA's experience, which is the largest in the world, has the extensive support of the well known fuel components such as the M5'TM'cladding, the MONOBLOC'TM'guide tube, the HTP'TM' and HMP'TM' structure components and the comprehensive services brought in engineering, irradiation and post irradiation fields. All of AREVA's fuel knowledge is devoted to extend the definition of fuel reliability to cover the whole scope of fuel vendor support. Our Top Reliability and Quality provide customers with continuous

Areva - 2011 Reference document; Areva - Document de reference 2011

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-01

After having indicated the person responsible of this document and the legal account auditors, and provided some financial information, this document gives an overview of the different risk factors existing in the company: law risks, industrial and environmental risks, operational risks, risks related to large projects, market and liquidity risks. Then, after having recalled the history and evolution of the company and the evolution of its investments over the last five years, it proposes an overview of Areva's activities on the markets of nuclear energy and renewable energies, of its clients and suppliers, of its strategy, of the activities of its different departments. Other information are provided: company's flow chart, estate properties (plants, equipment), an analysis of its financial situation, its research and development policy, the present context, profit previsions or estimations, management organization and operation

Particular intervention plan of the Areva La Hague facility - 2012 edition

International Nuclear Information System (INIS)

2012-01-01

The Particular intervention plan (PPI in French) is an emergency plan which foresees the measures and means to be implemented to address the potential risks of the presence and operation of a nuclear facility. This plan is implemented and developed by the Prefect in case of nuclear accident (or incident leading to a potential accident), the impact of which extending beyond the facility perimeter. It represents a special section of the organisation plan for civil protection response (ORSEC plan). The PPI foresees the necessary measures and means for crisis management during the first hours following the accident and is triggered by the Department Prefect according to the information provided by the facility operator. Its aim is to protect the populations leaving within 10 km of the facility against a potential radiological hazard. The PPI describes: the facility, the intervention area, the protection measures for the population, the conditions of emergency plan triggering, the crisis organisation, the action forms of the different services, and the post-accident stage. This document is the public version of the Particular intervention plan of the Areva NC La Hague fuel reprocessing plant (located on the territories of Beaumont-Hague, Digulleville, Herqueville, Jobourg and Omonville-la-Petite towns, Manche, France) which comprises the totally decommissioned UP2 400 unit, and the UP2 800 production unit still in operation

1. half results 2003 - AREVA group

International Nuclear Information System (INIS)

2003-01-01

This financial presentation of the Areva group, the world nuclear industry leader, results for the first half 2003 highlights the good level of activity, the negotiations with URENCO in final stages concerning the enrichment, the revision of estimates and negotiations underway concerning the dismantling and the operating income positive in Q2 2003 concerning the connectors division. (A.L.B.)

AREVA in Mongolia - Press kit

International Nuclear Information System (INIS)

2013-01-01

Mongolia is going through a crucial period in its history and setting up a strategic policy for uranium. The choices that are being made will affect the country and its future. Mongolia, since the mid-2000's, has benefited from significant mining development that has nourished the strong growth of the country. The giant Oyu Tolgoi (gold and copper) and Tavan Tolgoi (coal) deposits are the symbols of this mining potential. Uranium in particular has a major strategic role. The exploration programmes have revealed the presence of exploitable resources. On 26 February 2013, the Professional Council of Mineral Resources with the Ministry of Mines officially classified the Zoovch Ovoo deposit's with more than 50 000 tons of uranium. Following classification of the deposit of Dulaan Uul in 2011, the Zoovch Ovoo classification makes Mongolia officially one of the top 10 countries with the largest uranium resources. Mongolia has set about making the uranium industry a centrepiece of its strategy and its policy of independence. This new approach is founded in the Nuclear Energy Act adopted in the summer of 2009. The Mongolian State wants to create a uranium industry that makes Mongolia a nuclear fuel supplier for the Asian market. The choice of partners with whom the country associates to mine the uranium deposits is therefore important. Agreements have notably entered into with France, through AREVA which is a public company, as well as with Russia, China, Japan and India. AREVA has been present in Mongolia since 1997. AREVA is today represented in Mongolia by AREVA Mongol, its 100% subsidiary. AREVA Mongol carries out its exploration activities through Cogegobi and will manage its mining licences through AREVA Mines LLC. AREVA holds several exploration licences in Mongolia covering over 9,000 km 2 in the provinces of Dornogobi and Sukbaatar, where COGEGOBI is conducting its drilling programmes. This first phase has led to the first project-development steps

AREVA 2010 Reference document

International Nuclear Information System (INIS)

2010-01-01

After a presentation of the person responsible for this document, and of statutory auditors, this report proposes some selected financial information. Then, it addresses, presents and comments the different risk factors: risk management and coverage, legal risk, industrial and environmental risk, operational risk, risks related to major projects, liquidity and market risk, and other risk. Then, after a presentation of the issuer, it proposes a business overview (markets for nuclear and renewable energies, AREVA customers and suppliers, strategy, activities), a presentation of the organizational structure, a presentation of AREVA properties, plants and equipment (sites, environmental issues), an analysis and comment of the group's financial position and performance, a presentation of its capital resources, an overview of its research and development activities, programs, patents and licenses. It indicates profit forecast and estimates, presents the administrative, management and supervisory bodies, and compensation and benefits amounts, reports of the functioning of corporate bodies. It describes the human resource company policy, indicates the main shareholders and transactions with related parties. It proposes financial information concerning assets, financial positions and financial performance. This document contains its French and its English versions

AREVA's nuclear reactors portfolio

International Nuclear Information System (INIS)

Marincic, A.

2009-01-01

A reasonable assumption for the estimated new build market for the next 25 years is over 340 GWe net. The number of prospect countries is growing almost each day. To address this new build market, AREVA is developing a comprehensive portfolio of reactors intended to meet a wide range of power requirements and of technology choices. The EPR reactor is the flagship of the fleet. Intended for large power requirements, the four first EPRs are being built in Finland, France and China. Other countries and customers are in view, citing just two examples: the Usa where the U.S. EPR has been selected as the technology of choice by several U.S utilities; and the United Kingdom where the Generic Design Acceptance process of the EPR design submitted by AREVA and EDF is well under way, and where there is a strong will to have a plant on line in 2017. For medium power ranges, the AREVA portfolio includes a boiling water reactor and a pressurized water reactor which both offer all of the advantages of an advanced plant design, with excellent safety performance and competitive power generation cost: -) KERENA (1250+ MWe), developed in collaboration with several European utilities, and in particular with Eon; -) ATMEA 1 (1100+ MWe), a 3-loop evolutionary PWR which is being developed by AREVA and Mitsubishi. AREVA is also preparing the future and is deeply involved into Gen IV concepts. It has developed the ANTARES modular HTR reactor (pre-conceptual design completed) and is building upon its vast Sodium Fast Reactor experience to take part into the development of the next prototype. (author)

T and D on sale, Areva on punishment; T and D a la vente, Areva a la peine

Energy Technology Data Exchange (ETDEWEB)

Maincent, G

2009-05-15

Areva group, the world leader of the nuclear industry, is looking for 5 billion euros to finance its investments. However, the French government which owns 90% of the group, mainly through the CEA, is not willing to supply this financial help. Therefore, about 40% of Areva group's turnover could change hands soon. In fact, the French government has asked Areva to consider the selling of its daughter company T and D (Transmission and Distribution) which is one of the major poles of the group's activity. Thanks to T and D, Areva can propose a complete range of products, services and systems from the low- to the extra-high voltage, and can be present on other energy markets, from the conventional to the renewable power generation. Already weakened by the departure of Siemens, Areva, without T and D would lose its full power in front of competitors like GE-Hitachi, Toshiba-Westinghouse or Rosatom-Siemens. (J.S.)

Areva - 2012 Annual Report. Forward looking energy

International Nuclear Information System (INIS)

2013-05-01

After an interview of the Chief Executive Officer, a presentation of the company's governance and organization, and a brief overview of its strategy (with its five pillars: safety and security, operation and customers, economic competitiveness, technology and innovation, people), this report indicates and presents the various projects across the world. It outlines the main activities and objectives: preservation of nuclear and occupational safety, service to customer over the long term, fuel supply security, expertise, sustainability of nuclear power, contribution to the energy mix of tomorrow. It outlines the belief of Areva in the future of nuclear and renewable energies (brief presentations of activities and examples in different countries and in different domains), describes how Areva offers comprehensive solutions for power generation with less carbon, and indicates the distribution of revenues by business group and by geographic area. It comments a year of mining operations, the activities concerning the front end of the fuel cycle, those related to reactors and nuclear services, to recycling (fuel recycling, site dismantling and reuse, material storage and disposal), to the booming business of renewable energies, to engineering services. The report proposes some key figures concerning greenhouse gas emissions, environmental footprint, occupational safety, and radiation protection within the group. It outlines the importance of innovation in terms of investment, personnel and patents. It comments the activities related to nuclear safety and to the control of the environment. It outlines the human resource policy, evokes the activity of the Areva foundation. A summarized presentation of financial statements is given

Areva Resources Namibia. Report to Stakeholders 2014

International Nuclear Information System (INIS)

2015-01-01

This document is Areva Namibia's stakeholder report for 2013-2014. The focus of this edition is on Areva Namibia's involvement in the community. The Trekkopje project went into a 'Care and Maintenance' phase from 1 July 2013. The mine is merely in a holding phase with every intention to start up as soon as the economic conditions become more favourable. Since then, the Care and Maintenance team has been protecting the assets and kept the mine's infrastructure in working condition so that it can be commissioned without delay. However, Areva is still present and actively engaged with its stakeholders at the local, regional and national level. Neighbouring communities are benefiting from social projects in Arandis, Swakopmund and the wider Erongo region. Areva is actively supporting economic development through the Erongo Development Foundation's SME micro-finance scheme and education projects. At the regional level, Areva's desalination plant has enabled NamWater to meet the water demand of Swakop Uranium's new Husab mine. Furthermore, water supply to the Roessing and Langer Heinrich mines could be sustained when pumping water from the Omaruru Delta (Omdel) aquifer at Henties Bay had to be reduced due to over-exploitation. Areva has recently started negotiations with the Government of the Republic of Namibia about the sale of the Erongo desalination plant. Areva is also involved in the mining industry as members of the Namibian Chamber of Mines and the Namibian Uranium Association (NUA). The NUA plays an important role in setting standards to ensure that local mining practices comply with global standards on sustainable development, environmental protection and radiological safety. One of Areva's major achievements in 2014 was the completion of the second phase of metallurgical test work with very promising results. The Care and Maintenance phase is the opportunity to thoroughly research the alkaline heap leach process and

Change-management. From commercial power operation to post power operation and decommissioning; Change-Management. Vom Leistungsbetrieb ueber den Nachbetrieb zum Rueckbau. T. 1. Stilllegung und Rueckbau von Reaktoren und Anlagen im Brennstoffkreislauf durch AREVA

Energy Technology Data Exchange (ETDEWEB)

Wasinger, Karl [AREVA GmbH, Offenbach am Main (Germany)

2015-02-15

Transition from power generation to decommissioning challenges utilities. Power generation is mainly characterized by a stable working environment and constant workload, decommissioning and dismantling, however, by transformation and change. Also, changing requirements for the workforce's skills challenge the organization and its senior management. Ensuring effective and efficient performance, while maintaining motivation of staff, requires adjustment of management processes as well as of operational organization and human resources management. AREVA has more than 20 years of experience in decommissioning of own nuclear fuel cycle plants in France, as well as of other large plants and power reactors in Germany, the United Kingdom and the US. Therefore, the group has developed and successfully implemented integrated change management processes. The implementation of well-established and proven methods, developed by the productive industry and adjusted to the nuclear regulatory requirements, significantly improves the performance and efficiency of means and methods in use. The AREVA Performance Improvement Process defines concrete approaches to identify and improve potential deficits of productivity in six main areas (decommissioning scenarios and stra-tegies, waste treatment and logistics, operations management, supply chain, regulatory monitoring and controls as well as dismantling operation). Nuclear plant and facility owners around the world benefit from AREVA experts well experienced in execution of large and complex decommissioning projects.

Figures and information on nuclear safety and radiation protection on the Tricastin AREVA site

International Nuclear Information System (INIS)

2010-01-01

This report presents and briefly comments figures concerning the environment (water consumption, greenhouse gas emissions, liquid releases in a canal, radioactive and hazardous industrial wastes), radiological impact and radiation protection (computed dose for a reference group, computed maximum dose for the reference group, radiological exposures of workers), nuclear safety (number of events, controls and audits), production (quantities of various materials) and transport (flows of radioactive products) for the whole Tricastin site for which only some general data are indicated, and more precisely the various installations and establishments it comprises: AREVA NC Pierrelatte, COMURHEX Pierrelatte, EURODIF Production, FBFC Pierrelatte, SET, SOCATRI

AREVA and sustainable development. 2002 report

International Nuclear Information System (INIS)

2003-01-01

The performance indicators in this report reflect the major sustainable development impacts and challenges that Areva is facing as a group due to the very nature of its operations. They chose the calendar year as reporting period, from January 1 to December 31. This report covers all of the group operations in France and abroad. This report presents an overview of the major financial, social and environmental challenges facing the group. This report is a companion document to the annual activity report. (A.L.B.)

Explicit flow equations and recursion operator of the ncKP hierarchy

International Nuclear Information System (INIS)

He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong

2011-01-01

The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)

Customer-operator partnership. A boiling water reactor developed jointly by AREVA NP and E.ON Kernkraft

International Nuclear Information System (INIS)

Pasler, Doris; Gauthier, Jean Claude; Diercks, Frank; Fuchs, Michael

2009-01-01

Many countries spread all over the world have publicly expressed their intention to pursue the construction of new nuclear power plants with improved safety, economy and more straight forwarded operation and maintenance. Reasons for the intention are: The world wide increasing demand for energy and hence the general necessity to build new power plants. The concerns for increased emissions of green house gases leading to a change in the climate have brought into question the primary reliance on plants utilizing fossil fuels. A new reactor type matching the previously stated issues is AREVA NP's further development of proven BWR design. Combining AREVA's and E.ON's expertise, a project was launched to customize the final basic design for this advanced nuclear power plant having a net power output of about 1,250 MW, a net efficiency of about 37% and a design service life of 60 years. Within this joint venture the overall plant design was simplified and additionally all active safety systems have passive safety related backup systems utilizing basic laws of physics, such as gravity, enabling them to function without electrical power supplies or activation by powered instrumentation and control systems. The development takes into account the technical and accumulated operating experience of the project partners. Based on the operating experience of the project partners a simplification of the overall system engineering was performed, flexible fuel cycle length (12 to 24 months) are possible as well as a reduction of process waste was achieved. These improvements regarding the operation and economics result on the one hand in lower investment cost and on the other hand in a high availability of the plant, hence in low maintenance costs. Generally, the electrical generation costs are accomplished, which are competitive to larger-capacity nuclear power plants and fossil-fired plants. (author)

Areva - Nuclear Safety Policy 2013-2016

International Nuclear Information System (INIS)

2013-03-01

The objectives of Areva's Nuclear Safety Policy cover three areas: 1 - Safety of facilities: - Establish a group wide process to maintain the regulatory compliance of facilities and to ensure the execution of improvements required by periodic reviews of safety. - Put in place proactive measures to reduce source terms present in facilities, and in particular with regard to fire, operational waste and legacy waste on AREVA sites. - Ensure the performance of arrangements and activities central to risk prevention, in particular in the areas of containment, criticality safety and radiological protection through compliance with the associated safety requirements. - Strengthen the emergency planning arrangements to be implemented in case of accidents and test these through regular exercises. 2 - Operational Safety: - Develop and verify the level of safety culture of our staff and subcontractors and increase the presence of operational managers on the ground. - Improve the requirements and responsibilities within documentation associated with operations and interventions on the basis of a significant involvement of our staff and subcontractors. - Implement robust and formal risk prevention processes to manage temporary or transitional situations, uncommon situations, or specific risks, including but not limited to parallel activities, administrative lockout/tag-out, working with naked flames, gamma radiation, work in a radioactive environment. - Integrate human and organizational factors (HOF) in the analysis of safety-related modifications of facilities; undertake detailed reviews of the causes of all significant events inside the group and improve the communication and implementation of operating experience within all group entities. - 3 Safety Management: - Maintain an organization based on clear principles of shared responsibility and delegation of authority, and have in place a robust process to assess the impact on safety of any organizational change. - Strengthen

Annual report 2014. Report on subcontracting within the AREVA group in France

International Nuclear Information System (INIS)

2015-07-01

This report presents quantitative data and actions undertaken by the AREVA group regarding subcontracting in its nuclear activities in France in 2014. After a presentation of AREVA, it addresses innovative practices in the 'commissioner-supplier' relationship, describes how the subcontracting option corresponds to an industrial choice, describes how subcontracting is supervised through an operational acquisition process, how abilities and training of external interveners are controlled, how operations performed by external interveners are prepared and accompanied. It outlines how issues related to health, safety and security are addressed exactly the same way for all interveners, and finally comments how observations made by the different stakeholders are sources of progress

Responsible Development On Areva's Mining Activities - Report 2016

International Nuclear Information System (INIS)

2017-01-01

Constituting the first link in the nuclear fuel cycle, New Areva's mining activities cover research, production and commercialization of uranium throughout the world. New Areva counts among the world's leading producers of uranium enjoying competitive production costs and with mines in operation in Canada, Kazakhstan and Niger. Committed to its role as a responsible mining company, New Areva conducts its mining activities in a manner that fully respects people and the environment, and contributes to the economic development of local regions and their populations. Thanks to a presence spanning five continents, they ensure the long-term supply to customers of uranium for electricity production while maintaining a responsible attitude towards people and the environment. It has a diverse portfolio of both active mines (Canada, Kazakhstan and Niger) and mines under development (Africa). This document is Areva's Mining Activities responsible Development report for 2016. Content: profile (Overview, Keys events, Worldwide presence, Governance and Organization, Uranium market); CSR approach (Top management statement, Risk management, Ethics and human rights, Voluntary initiatives, Materiality); Commitments (Health, occupational safety and radiation protection, Environment and Biodiversity, Social involvement, Commitment to employees, Mining closure, R and D and Innovation); Performance (CSR objectives, Key indicators, Reporting parameters); Case Studies; Annexes (GRI Index)

Dose constraint implementation in AREVA group: an optimization tool

International Nuclear Information System (INIS)

Decobert, Veronique

2008-01-01

AREVA offers customers reliable technology solutions for CO 2 free power generation and electricity transmission and distribution. The group counts 68000 employees worldwide and for its nuclear activities there are about 33.000 people who work under ionizing radiation. Risk management and prevention is one of the ten engagements of the sustainable development policy of AREVA, to establish and maintain the highest level of nuclear and occupational safety in all of the group's operations to preserve public and worker health, and to protect the environment. The implementation of these engagements is founded on a voluntary continuous improvement program, AREVA Way: objectives, common for the all entities, are laid down in the policies documents. Indicators are defined and a common reporting method for each indicator and the result of performance self-assessment is set up. AREVA chose to federate the whole of the nuclear entities around a common policy, the Nuclear Safety Charter, implemented at the beginning of 2005. This charter sets up principles of organization, action and engagements of transparency. Regarding radiation protection, the Charter reaffirms the engagement to limit in the installations of the group, at a level as low as reasonably possible, the exposure of the workers, through the implementation of the ALARA principle and the implementation of a continuous improvement policy. This approach, basically different from the simple respect of imposed limits, radically modifies the dynamics of progress. In the activities of engineering, the optimization of protection against radiation is also integrated in the design, by taking account the experience feedback of the operational activities. This determination of constraints is taken on all levels of the organization. Thus sustainable development performance indicators and especially those relating to protection against radiation are discussed between the managers in charge of Units Business and the Top managers

Areva attracted to Slovakia by engineers

International Nuclear Information System (INIS)

Slovak, K.

2006-01-01

The expected growth of demand in nuclear power stations and technologies compelled the French-German company Areva NP to look for other possibilities for expansion. The company belongs to the French energy concern, Areva, which employs almost sixty thousand people worldwide and which last year achieved revenues of ten billion EUR. A joint venture between the French company and the German company Siemens - Areva NP - designs and manufactures software and hardware for security and automation technologies in nuclear power stations. Areva NP Controls, a subsidiary of the company, has been operating in Bratislava from 1 July. The plan is that Slovak engineers will design hardware and software to be used in nuclear power station security systems around the world. The decision to open an engineering office in Bratislava was made after the management at the German head office realised the need for three hundred new engineers. T his many quality people are not available in Germany right now , said Franz Hilbert, the boss of the Slovak subsidiary. The company decided between the Czech Republic, Russia and India. In the end, Bratislava was chosen. F. Hilbert added that Slovakia has many quality people, but that lower labour costs also played a role in the decision-making process. The company plans to employ half of the required three hundred engineers in Bratislava and the remainder in Erlangen. About a dozen engineers are currently working in this Slovak company, some of whom are currently borrowed from partners. The view is that within five years about one hundred engineers will work in Slovakia under domestic management. According to F. Hilbert, the meeting of the Slovak and German cultures is trouble free, even though some differences can still be seen. 'We are better in planning and in fulfilling those plans, while the Slovaks are great at improvising. We are able to complement and learn from each other', said F. Hilbert. (authors)

Developing Nuclear Safety Culture within a Supplier Organization: An Insight from AREVA

International Nuclear Information System (INIS)

L’Epinois, B. de

2016-01-01

AREVA is present throughout the entire nuclear cycle, from uranium mining to used fuel recycling, including nuclear reactor design, equipment delivery and operating services. AREVA is recognised by utilities around the world for its expertise, its skills in cutting-edge technologies, and its dedication to the highest level of safety. This presentation will focus on the ways the safety culture applies to the supplier missions, along with the traditional focus on quality, costs and schedule. It will develop how the safety culture traits developed for nuclear operators by, for example, WANO or the IAEA, can be adequately be imported and embedded into the supply industry. This will be illustrated with some examples in this field. (author)

AREVA net income: 649 million euros

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-03-15

This document presents the financial statements for 2006 of Areva group: net income: 649 million euros; backlog up by 24.6% to 25.6 billion euros; steady growth of sales revenue: + 7.3%1 to 10.863 billion euros; operating income of 407 million euros: excellent divisional performance and constitution of a significant provision for the OL3 project in Finland; dividend proposed to Annual General Meeting of Shareholders: 8.46 euros per share.

AREVA net income: 649 million euros

International Nuclear Information System (INIS)

2007-03-01

This document presents the financial statements for 2006 of Areva group: net income: 649 million euros; backlog up by 24.6% to 25.6 billion euros; steady growth of sales revenue: + 7.3%1 to 10.863 billion euros; operating income of 407 million euros: excellent divisional performance and constitution of a significant provision for the OL3 project in Finland; dividend proposed to Annual General Meeting of Shareholders: 8.46 euros per share

75 FR 10525 - In the Matter of: AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility) and All Other...

Science.gov (United States)

2010-03-08

...: AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility) and All Other Persons Who Seek or Obtain... for the Implementation of a Safeguards Information Program (Effective Immediately) I AREVA Enrichment... it to construct and operate a uranium enrichment facility in Bonneville County, Idaho. AES submitted...

Areva - 2014 Half-year results

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2014-01-01

The group posted a net loss in the first half of the year. This is the consequence of losses recorded in renewable operations, additional project-related provisions, asset write-downs and a nuclear market environment that has still deteriorated. Areva's backlog has strengthened thanks to the signing of the agreement through 2020 with EDF for used fuel treatment and MOX fuel production. Though it has a short-term adverse impact on the group's results, it provides these operations with long-term visibility and strengthens our strategic partnership with EDF. Despite a decline in revenue that was greater than anticipated, the group achieved positive free operating cash flow, an increase compared with the first half of 2013. The success of Areva's recovery actions partially offset the downturn in activity. These actions will be reinforced in the second half of the year to adapt to market conditions. The group continues to restructure its operations in renewable energies by entering into partnerships in promising markets, such as offshore wind and energy storage, and by discontinuing loss-making operations, such as concentrated solar power. 2014 Half-year results: - Backlog: euro 44.9 bn (euro +3.5 bn vs. 12/31/2013 thanks to the treatment-recycling agreement with EDF); - Negative net income attributable to equity owners of the parent (euro -694 m): Losses in discontinued renewable activities (euro -373 m), One-off impact of treatment-recycling agreement with EDF (euro -95 m), Provisions and assets impairment: - Positive free operating cash flow despite lower activity level: Revenue: euro 3.889 bn (-12.4% LFL), EBITDA: euro 256 m (euro -231 m vs. H1 2013), Free operating cash flow: euro 98 m (euro +256 m vs. H1 2013); - Strengthened recovery actions in an unfavorable economic environment: 2015 cost reduction objective secured and raised to euro 1.2 bn by 2016, Capital expenditure reduced over 2014-16; - Revised financial outlook

Areva. Half-year 2015 results

International Nuclear Information System (INIS)

Repaire, Philippine du

2015-01-01

This document presents the financial statements of Areva Group for the period ended June 30, 2015. During the first half, AREVA made determining decisions in refocusing on its core business, the nuclear fuel cycle direction. The group has announced an ambitious competitiveness plan, is engaged in strong social dialogue with its social partners, and has worked to improve the management of its large projects, which up to now have weighed heavily on its financial trajectory. It pursued its strategic roadmap for its refocusing and the redefinition of the partnership with EDF. The agreements found with EDF represent very significant progress. The group also worked on its financing plan whose aim is to allow AREVA to refinance its mid-term needs on the markets. Content: Key figures, Highlights of the period, Transformation plan (Performance plan, Strategic roadmap, Financing plan, Financial outlook)

EPR by AREVA. An evolutionary reactor

International Nuclear Information System (INIS)

Horstmann, Marion

2010-01-01

The EPR development goals are as follows: 1. Evolutionary design to fully capitalize on the design, construction and operating experience based on the 86 AREVA's PWR operating worldwide; 2. Enhanced Safety compared to operating PWRs: reduce core damage frequency (CDF), accommodate severe accidents with no long-term population effect, Withstand large airplane crash (APC); 3. High availability; 4. Simplified operation and maintenance; and 5. Generation cost at least 10 % lower than 1500 MWe series in operation.The design builds on the achievements of the N4 and Konvoi reactors. The main plant data are tabulated. The PWR structure is shown as an example of the stepwise improvement. Focus of the presentation is on the construction techniques, supply chain, and project delivery. (P.A.)

Responsible Development of Areva's Mining Activities - 2010 Report

International Nuclear Information System (INIS)

2011-07-01

Areva's mining activities place it among the world leaders in uranium production. The main objective of Areva's mining activities is ensuring uranium supply over the long term to produce nuclear power while emitting less CO 2 , reducing risks to people and the environment and contributing to the development of areas where mining activities take place. Areva's mining activities span five continents. This diversified portfolio allows the group to carry out exploration, project development and production activities in various geopolitical and technological contexts with the support of its staff's multi-cultural backgrounds. This document is the first Responsible Development report of Areva's Mining Activities. Content: 1 - All about Areva's Mining Activities (Interview with Sebastien de Montessus, General Director of Areva's Mining Activities, Ongoing Progress, The Core of Areva's Mining Activities Work); 2 - The Foundation of Areva's Mining Activities Approach (Values and Principles, Governance, Commitments); 3 - Reporting on Areva's Mining Activities (Scope, Relevance of Indicators, Outlook); 4 - Being a Responsible Mining Stakeholder (Actions, Reducing Industrial Risks, Ensuring the Protection of Workers and Populations, Consuming Water and Energy Resources in a Rational Way, Preserving Biodiversity, Managing Waste Rock and Mine Tailings over Time, Sustainable Presence, Contribution to Social Development); 5 - Glossary

T and D on sale, Areva on punishment

International Nuclear Information System (INIS)

Maincent, G.

2009-01-01

Areva group, the world leader of the nuclear industry, is looking for 5 billion euros to finance its investments. However, the French government which owns 90% of the group, mainly through the CEA, is not willing to supply this financial help. Therefore, about 40% of Areva group's turnover could change hands soon. In fact, the French government has asked Areva to consider the selling of its daughter company T and D (Transmission and Distribution) which is one of the major poles of the group's activity. Thanks to T and D, Areva can propose a complete range of products, services and systems from the low- to the extra-high voltage, and can be present on other energy markets, from the conventional to the renewable power generation. Already weakened by the departure of Siemens, Areva, without T and D would lose its full power in front of competitors like GE-Hitachi, Toshiba-Westinghouse or Rosatom-Siemens. (J.S.)

Nuclear - the faint hope Areva

International Nuclear Information System (INIS)

Dupin, Ludovic

2015-01-01

This article discusses the future of Areva as a part of its activities (nuclear reactor building and maintenance) is now managed by EDF. The author notices that Areva's present situation looks like the Cogema's one before its merge with Framatome and some CEA activities to give birth to Areva. The main problem is the debt for a group which possesses important assets (hyper-profitable uranium mines, advanced technology plants for nuclear fuel processing) and opportunities (the possibility to become a leader in the dismantling activity, to take advantage of the increasing uranium demand), but is unable to self-finance, suffers from its heavy organisation which needs to be reviewed and even separated into two companies, and is also threatened by the cost of new reactors and by being too small to launch new projects in front of the giants of the mining sector

Areva - First half 2008 sales revenue; Areva - Chiffre d'affaires du 1. semestre 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

As of June 30, 2008, AREVA's backlog stood at 38.1 billion euro, for 13.6% growth since June 30, 2007, with 9.9% growth in Nuclear and 40.7% growth in Transmission and Distribution. In Nuclear, the backlog came to 32.3 billion euro as of the end of June 2008. In the front end of the cycle, AREVA signed multi-year contracts in the first half of the year with Japanese and American utilities and with EDF, for a combined total of more than 1 billion euro. Of note in the back end of the cycle is the contract AREVA signed with the U.S. Department of Energy to build a MOX fuel fabrication facility. In Transmission and Distribution, the backlog came to 5.8 billion euro as of the end of period. A total of 3.2 billion euro in orders was booked in the first half, an increase of 20.0% year-on-year. The division won several important contracts, most notably a contract with Dubai Electricity (more than 130 million euro), a contract with National Grid and RTE for the renovation of the IFA 2000 grid interconnection between France and Great Britain (more than 60 million euro), and, in the industrial field, a contract with Rio Tinto Alcan (close to 65 million euro). The group cleared revenue of 6.2 billion euro in the first half of 2008, up 14.8% (+16.4% like-for-like) compared with the first half of 2007. Sales outside France were up 14.3% to 4.2 billion euro or 68.6% of total sales; the latter were stable compared with the first half of 2007. All businesses were up, with growth of 15.9% in Nuclear operations (+19.1% LFL1) - particularly in Reactors and Services (+31.3% LFL1) - and 13.0% growth in Transmission and Distribution operations (+12.0% LFL T 1). Foreign exchange had a negative impact of 155 million euro, primarily due to the change in the U.S. dollar in relation to the euro. Changes in the consolidated group had a positive impact of 97 million euro, mainly reflecting acquisitions in the Transmission and Distribution division and in Renewable Energies. Sales revenue

Areva at September 30, 2016: Stable revenue in an unfavorable market environment

International Nuclear Information System (INIS)

Lachaux, Manuel; Jugean, Anne-Sophie

2016-01-01

At September 30, 2016, AREVA had 32.160 billion euros in backlog, up 10.9% in relation to December 31, 2015 (28.990 billion euros). This represents close to eight years of revenue. The backlog at September 30 does not include contracts for uranium supply, conversion services and enrichment services signed with EDF and NNB in connection with the Hinkley Point C project. Those contracts will be included in backlog upon signature of the Notice to Proceed. The order intake for the first nine months of the year totaled 7.2 billion euros, compared with 1.2 billion euros for the same period last year. Over the first nine months of 2016, AREVA generated consolidated revenue of 2.810 billion euros, which was stable in relation to the same period in 2015 (+1.1% like for like). Foreign exchange had a negative impact of 5 million euros over the period. Revenue for the third quarter of 2016 totaled 880 million euros, a decrease of 6.0% (-5.5% like for like) in comparison to the third quarter of 2015. Foreign exchange had a negative impact of 5 million euros over the period. The operations of AREVA NP (excluding the OL3 project), Nuclear Measurements, and Propulsion and Research Reactors meet the criteria of IFRS 5 for classification as 'operations held for sale and discontinued operations' at September 30, 2016. The backlog of the operations held for sale was 13.265 billion euros at September 30, 2016, compared with 13.693 billion euros at the end of 2015. It does not include the contracts for two nuclear steam supply systems and for the supply of fuel and of the operational instrumentation and control system related to Hinkley Point C, which will be recorded upon signature of the Notice to Proceed. Revenue from the operations held for sale and discontinued operations totaled 2.595 billion euros at September 30, 2016, a decrease of 10.1% compared with the same period in 2015. This change is essentially due to: - A drop in the activity of AREVA NP, with lower volumes

Areva - Press release from the Supervisory Board; Areva - Communique de presse du Conseil de Surveillance

Energy Technology Data Exchange (ETDEWEB)

Marie, Patricia; Briand, Pauline; Floquet-Daubigeon, Fleur; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du

2012-02-14

properly applied. Moreover, it asked the Executive Board to finalize in the shortest possible time frame the internal procedure applicable to the review and validation of the various projects and decisions creating a commitment, and the procedures for monitoring their execution. In addition, it noted that the deliberations of the Executive Board, like those of the bodies or authorities having received delegation of authority from it, must be systematically documented in writing, and asked the Executive Board to ensure that this rule is thoroughly applied. It asked the Executive Board to install a resources and reserves committee under its direct authority, responsible for validating each year the resource and reserve estimates appearing in the Reference Document, based on the work of the Reserves Department. This committee, which will involve one or more recognized external experts, shall specify the methods and schedule for updating resources and reserves. Its work shall be reported on an annual basis to the Audit Committee. Reference to the installation and operation of this committee shall appear in the Reference Document published by AREVA. Lastly, it asked the Executive Board to study the transformation of the legal form of the company into a limited liability company with a board of directors. A summary of the ad hoc committee's report to the Supervisory Board is given in appendix

Status of the nuclear measurement stations for the process control of spent fuel reprocessing at AREVA NC/La Hague

Energy Technology Data Exchange (ETDEWEB)

Eleon, Cyrille; Passard, Christian; Hupont, Nicolas; Estre, Nicolas [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 St Paul-lez-Durance (France); Battel, Benjamin; Doumerc, Philippe; Dupuy, Thierry; Batifol, Marc [AREVA NC, La Hague plant - Nuclear Measurement Team, F-50444 Beaumont-Hague (France); Grassi, Gabriele [AREVA NC, 1 place Jean-Millier, 92084 Paris-La-Defense cedex (France)

2015-07-01

Nuclear measurements are used at AREVA NC/La Hague for the monitoring of spent fuel reprocessing. The process control is based on gamma-ray spectroscopy, passive neutron counting and active neutron interrogation, and gamma transmission measurements. The main objectives are criticality and safety, online process monitoring, and the determination of the residual fissile mass and activities in the metallic waste remained after fuel shearing and dissolution (empty hulls, grids, end pieces), which are put in radioactive waste drums before compaction. The whole monitoring system is composed of eight measurement stations which will be described in this paper. The main measurement stations no. 1, 3 and 7 are needed for criticality control. Before fuel element shearing for dissolution, station no. 1 allows determining the burn-up of the irradiated fuel by gamma-ray spectroscopy with HP Ge (high purity germanium) detectors. The burn-up is correlated to the {sup 137}Cs and {sup 134}Cs gamma emission rates. The fuel maximal mass which can be loaded in one bucket of the dissolver is estimated from the lowest burn-up fraction of the fuel element. Station no. 3 is dedicated to the control of the correct fuel dissolution, which is performed with a {sup 137}Cs gamma ray measurement with a HP Ge detector. Station no. 7 allows estimating the residual fissile mass in the drums filled with the metallic residues, especially in the hulls, from passive neutron counting (spontaneous fission and alpha-n reactions) and active interrogation (fission prompt neutrons induced by a pulsed neutron generator) with proportional {sup 3}He detectors. The measurement stations have been validated for the reprocessing of Uranium Oxide (UOX) fuels with a burn-up rate up to 60 GWd/t. This paper presents a brief overview of the current status of the nuclear measurement stations. (authors)

Status of the nuclear measurement stations for the process control of spent fuel reprocessing at AREVA NC/La Hague

International Nuclear Information System (INIS)

Eleon, Cyrille; Passard, Christian; Hupont, Nicolas; Estre, Nicolas; Battel, Benjamin; Doumerc, Philippe; Dupuy, Thierry; Batifol, Marc; Grassi, Gabriele

2015-01-01

Nuclear measurements are used at AREVA NC/La Hague for the monitoring of spent fuel reprocessing. The process control is based on gamma-ray spectroscopy, passive neutron counting and active neutron interrogation, and gamma transmission measurements. The main objectives are criticality and safety, online process monitoring, and the determination of the residual fissile mass and activities in the metallic waste remained after fuel shearing and dissolution (empty hulls, grids, end pieces), which are put in radioactive waste drums before compaction. The whole monitoring system is composed of eight measurement stations which will be described in this paper. The main measurement stations no. 1, 3 and 7 are needed for criticality control. Before fuel element shearing for dissolution, station no. 1 allows determining the burn-up of the irradiated fuel by gamma-ray spectroscopy with HP Ge (high purity germanium) detectors. The burn-up is correlated to the 137 Cs and 134 Cs gamma emission rates. The fuel maximal mass which can be loaded in one bucket of the dissolver is estimated from the lowest burn-up fraction of the fuel element. Station no. 3 is dedicated to the control of the correct fuel dissolution, which is performed with a 137 Cs gamma ray measurement with a HP Ge detector. Station no. 7 allows estimating the residual fissile mass in the drums filled with the metallic residues, especially in the hulls, from passive neutron counting (spontaneous fission and alpha-n reactions) and active interrogation (fission prompt neutrons induced by a pulsed neutron generator) with proportional 3 He detectors. The measurement stations have been validated for the reprocessing of Uranium Oxide (UOX) fuels with a burn-up rate up to 60 GWd/t. This paper presents a brief overview of the current status of the nuclear measurement stations. (authors)

Areva new fuel designs; increased reliability, operating margins and operating efficiency; Nuevos disenos de combustible Areva: aumento de fiabilidad, margenes operativos y eficiencia del funcionamiento

Energy Technology Data Exchange (ETDEWEB)

Mollard, P.; Vollmer, N.; Curca-Tivig, F.; Cole, S.; Louf, H. P.

2015-07-01

AREVA is continuously working on the improvement of the fuel design to address immediate and future needs of the utilities. This improvement process regularly leads to incremental changes but also to breakthrough changes addressing the next needs of the market. Since a few years now, the improvements of the fuel design and licensing benefit from the improvement and upgrade in codes and methods and computational capabilities. Changes in design are sustained by these more powerful and phenomenological tools which secure and fasten the fuel design optimization and its implementation. (Author)

Areva - 2011 Reference document

International Nuclear Information System (INIS)

2011-01-01

After having indicated the person responsible of this document and the legal account auditors, and provided some financial information, this document gives an overview of the different risk factors existing in the company: law risks, industrial and environmental risks, operational risks, risks related to large projects, market and liquidity risks. Then, after having recalled the history and evolution of the company and the evolution of its investments over the last five years, it proposes an overview of Areva's activities on the markets of nuclear energy and renewable energies, of its clients and suppliers, of its strategy, of the activities of its different departments. Other information are provided: company's flow chart, estate properties (plants, equipment), an analysis of its financial situation, its research and development policy, the present context, profit previsions or estimations, management organization and operation

Areva - Half year 2016 results: Improvement of EBITDA margin to 16% (vs. 12% in H1 2015) in a still unfavorable environment

International Nuclear Information System (INIS)

Lachaux, Manuel; Jugean, Anne-Sophie

2016-01-01

The first half was an extremely active one for the consolidation of Areva's base of operations and for the deployment of the strategic road-map, where numerous milestones have been achieved. Areva's backlog and revenue are rising, while operating profitability continues to improve notably thanks to the group performance plans. On June 15, Areva presented its action plan for the creation of NEW CO, which detailed the achievements necessary to the complete and effective transformation of Areva. In particular, they include the plan to sell AREVA NP's operations, which met a new milestone with the signing of a memorandum of understanding with EDF, confirming the sale price and the schedule for closing by the end of 2017. Added to this memorandum of understanding was the completion of the sale of Canberra, the shut-down of the Bioenergy business and the upcoming sale of Adwen. The group intensified its discussions aimed at attracting strategic investors which could participate in the capital increase for NEW CO. Signs of interest have already been given. Meanwhile, liquidity requirements were secured for 2016. Armed with these actions and achievements, the group refines its objective for net cash flow from company operations, putting it at -1.5 billion euros for the current year, in the upper end of the range indicated at the beginning of the year

AREVA and sustainable development - 2003 report

International Nuclear Information System (INIS)

Lauvergeon, A.

2003-01-01

The first report helped establish the status of Areva entities sustainable development performance and identify areas for improvement. This second report will report on the continuous improvement process, including accomplishments and projects initiated as well as difficulties encountered and ground yet to be covered. It includes, the Areva role in key sustainable development issues, the commitments and the governance, the risk management, the economic responsibility, the social responsibility and the environmental responsibility. (A.L.B.)

Areva. 2005 half year report; Areva. Rapport semestriel 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

With manufacturing facilities in over 40 countries and a sales network in over 100, AREVA offers customers technological solutions for nuclear power generation and electricity transmission and distribution. The group also provides interconnect systems to the telecommunications, computer and automotive markets. This half-year report of Areva group presents the key financial data of the group for the first half of 2005: 1 - Highlights of the period; 2 - Transition to the International Financial Reporting Standards: Group's application of IFRS, Impact of IAS 32 and 39 adoption on the Group's financial statements; 3 - Key data: summary data, summary data by business Division, backlog, income statement, review by business Division, cash flow statement, balance sheet items; 4 - events subsequent to the half-year-end; 5 - consolidated financial statements: statutory Auditors' report on the 2005 half-year financial statements - period from January 1 to June 30, 2005, consolidated income statement, consolidated balance sheet, consolidated cash flow statement, change in consolidated shareholders' equity, data by business Division and region, notes to the consolidated financial statements; 6 - Outlook.

Areva. 2005 half year report; Areva. Rapport semestriel 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

With manufacturing facilities in over 40 countries and a sales network in over 100, AREVA offers customers technological solutions for nuclear power generation and electricity transmission and distribution. The group also provides interconnect systems to the telecommunications, computer and automotive markets. This half-year report of Areva group presents the key financial data of the group for the first half of 2005: 1 - Highlights of the period; 2 - Transition to the International Financial Reporting Standards: Group's application of IFRS, Impact of IAS 32 and 39 adoption on the Group's financial statements; 3 - Key data: summary data, summary data by business Division, backlog, income statement, review by business Division, cash flow statement, balance sheet items; 4 - events subsequent to the half-year-end; 5 - consolidated financial statements: statutory Auditors' report on the 2005 half-year financial statements - period from January 1 to June 30, 2005, consolidated income statement, consolidated balance sheet, consolidated cash flow statement, change in consolidated shareholders' equity, data by business Division and region, notes to the consolidated financial statements; 6 - Outlook.

Developing talent at AREVA: Investing in people and building our future

International Nuclear Information System (INIS)

Vivien, Philippe

2008-01-01

AREVA employs 65,000 people today and will recruit 12,000 new employees worldwide in 2008 to support business strategy. The group forecasts that recruitment needs will significantly rise to 40,000 by 2012, representing 50% of the workforce. In order to meet the challenges of rapid international expansion and a highly competitive talent market, AREVA has developed initiatives to accelerate its investment in people, to reinforce recruitment and retain high quality talents and valuable skills and knowledge. The group human resources department's mission is based on shaping talents for sustainable business performance. It established its five-point human resources policy, Talent Builder, to attract, develop, retain, reward and mobilize employees across all businesses. In the context of a global talent market, dynamic recruitment programs are implemented to attract top talent. A global Campus Management program builds on relationships with colleges and universities to attract the future generation of engineers and managers. Talent development initiatives include processes and management tools, such as the People Review to identify and nurture key skills and talents, a group-wide integration program, professional training, and priority to internal mobility. AREVA places particular importance to diversity, a keystone of HR policy, and a socio-economic lever of development. The rich variety of people and cultures in the group reflect the markets, customers and the civil society in which AREVA operates. The group is actively committed to equal opportunities for all. The European agreement on equal opportunities in the workplace sets out measures for promoting gender equality and professional career paths, with the principal themes of recruitment, career development, training, remuneration and parental support. In addition, the WE network of men and women was set up with the support of Anne Lauvergeon, Chief Executive of AREVA with the objectives of promoting gender equality

Developing talent at AREVA: Investing in people and building our future

Energy Technology Data Exchange (ETDEWEB)

Vivien, Philippe [Human Resources AREVA (France)

2008-07-01

AREVA employs 65,000 people today and will recruit 12,000 new employees worldwide in 2008 to support business strategy. The group forecasts that recruitment needs will significantly rise to 40,000 by 2012, representing 50% of the workforce. In order to meet the challenges of rapid international expansion and a highly competitive talent market, AREVA has developed initiatives to accelerate its investment in people, to reinforce recruitment and retain high quality talents and valuable skills and knowledge. The group human resources department's mission is based on shaping talents for sustainable business performance. It established its five-point human resources policy, Talent Builder, to attract, develop, retain, reward and mobilize employees across all businesses. In the context of a global talent market, dynamic recruitment programs are implemented to attract top talent. A global Campus Management program builds on relationships with colleges and universities to attract the future generation of engineers and managers. Talent development initiatives include processes and management tools, such as the People Review to identify and nurture key skills and talents, a group-wide integration program, professional training, and priority to internal mobility. AREVA places particular importance to diversity, a keystone of HR policy, and a socio-economic lever of development. The rich variety of people and cultures in the group reflect the markets, customers and the civil society in which AREVA operates. The group is actively committed to equal opportunities for all. The European agreement on equal opportunities in the workplace sets out measures for promoting gender equality and professional career paths, with the principal themes of recruitment, career development, training, remuneration and parental support. In addition, the WE network of men and women was set up with the support of Anne Lauvergeon, Chief Executive of AREVA with the objectives of promoting gender

The Areva Group

International Nuclear Information System (INIS)

2004-08-01

This document provides information on the Areva Group, a world nuclear industry leader, offering solutions for nuclear power generation, electricity transmission and distribution and interconnect systems to the telecommunications, computer and automotive markets. It presents successively the front end division including the group business lines involved in producing nuclear fuel for electric power generation (uranium mining, concentration, conversion and enrichment and nuclear fuel fabrication); the reactors and services division which designs and builds PWR, BWR and research reactors; the back end division which encompasses the management of the fuel that has been used in nuclear power plants; the transmission and distribution division which provides products, systems and services to the medium and high voltage energy markets; the connectors division which designs and manufactures electrical, electronic and optical connectors, flexible micro circuitry and interconnection systems. Areva is implemented in Europe, north and south america, africa and asia-pacific. (A.L.B.)

Areva - First half 2008 sales revenue

International Nuclear Information System (INIS)

2008-01-01

As of June 30, 2008, AREVA's backlog stood at 38.1 billion euro, for 13.6% growth since June 30, 2007, with 9.9% growth in Nuclear and 40.7% growth in Transmission and Distribution. In Nuclear, the backlog came to 32.3 billion euro as of the end of June 2008. In the front end of the cycle, AREVA signed multi-year contracts in the first half of the year with Japanese and American utilities and with EDF, for a combined total of more than 1 billion euro. Of note in the back end of the cycle is the contract AREVA signed with the U.S. Department of Energy to build a MOX fuel fabrication facility. In Transmission and Distribution, the backlog came to 5.8 billion euro as of the end of period. A total of 3.2 billion euro in orders was booked in the first half, an increase of 20.0% year-on-year. The division won several important contracts, most notably a contract with Dubai Electricity (more than 130 million euro), a contract with National Grid and RTE for the renovation of the IFA 2000 grid interconnection between France and Great Britain (more than 60 million euro), and, in the industrial field, a contract with Rio Tinto Alcan (close to 65 million euro). The group cleared revenue of 6.2 billion euro in the first half of 2008, up 14.8% (+16.4% like-for-like) compared with the first half of 2007. Sales outside France were up 14.3% to 4.2 billion euro or 68.6% of total sales; the latter were stable compared with the first half of 2007. All businesses were up, with growth of 15.9% in Nuclear operations (+19.1% LFL1) - particularly in Reactors and Services (+31.3% LFL1) - and 13.0% growth in Transmission and Distribution operations (+12.0% LFL T 1). Foreign exchange had a negative impact of 155 million euro, primarily due to the change in the U.S. dollar in relation to the euro. Changes in the consolidated group had a positive impact of 97 million euro, mainly reflecting acquisitions in the Transmission and Distribution division and in Renewable Energies. Sales revenue for

Areva - first half 2007 financial results; Areva - resultats du 1. semestre 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This document presents the financial statements of Areva group for the first half of 2007 as submitted by the Executive Board: Sales revenue: euro 5.373 billion, up by 6.7%; Operating income: euro 207 million, i.e. 3.9% operating margin, up 1.6 point compared with H1 2006; Consolidated net income: euro 295 million, i.e. euro 8.31 per share in H1 2007 against euro 6.92 per share in H1 2006, a 20% increase. All Group performance indicators were up the first half of 2007. Growth was robust and profitability strengthened significantly in terms of both operating income and net income. Consolidated sales revenue rose 6.7% for the first half of 2007 alone, after growth of more than 7% in 2006. This positive trend will continue: the backlog grew by 31% in the first half to more than euro 33 billion, compared with euro 26 billion six months ago and euro 21 billion at year-end 2005. Business is up sharply in the Transmission and Distribution division, which had operating margin of 8.7% in the first half of the year.

Experience of Areva in fuel services for PWR and BWR; Experiencia de Areva en servicios de combustible para PWR y BWR

Energy Technology Data Exchange (ETDEWEB)

Morales, I.

2015-07-01

AREVA being an integrated supplier of fuel assemblies has included in its strategy to develop services and solutions to customers who desire to improve the performance and safety of their fuel. These services go beyond the simple 'after sale' services that can be expected from a fuel supplier: The portfolio of AREVA includes a wide variety of services, from scientific calculations to fuel handling services in a nuclear power plant. AREVA is committed to collaborate and to propose best-in-class solutions that really make the difference for the customer, based on 40 years of Fuel design and manufacturing experience. (Author)

Areva: a profit that has more than doubled in 2005

International Nuclear Information System (INIS)

Anon.

2006-01-01

The turnover of Areva reached 10.125 milliard euros in 2005 which means a 3.1% increase. The sale of its connector department has enabled Areva to double its net profit to 1.049 milliard euros. This strategic move aims at re-centering the group's activities on the energy domain. Areva foresees a global improvement in the nuclear industry as nuclear energy begins appearing as an adequate answer to the growth of energy needs and to the environmental concerns linked to the emission of greenhouse gases. Areva expects to take one third of the worldwide nuclear market by 2010 with a 2-figure annual profit. (A.C.)

The 2003 essential. AREVA; L'essentiel 2003. AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

This document presents the essential activities of the Areva Group, a world nuclear industry leader. This group proposes technological solutions to produce the nuclear energy and to transport the electric power. It develops connection systems for the telecommunication, the computers and the automotive industry. Key data on the program management, the sustainable development activities and the different divisions are provided. (A.L.B.)

AREVA Logistics Business Unit Transportation Risk Management Initiative

International Nuclear Information System (INIS)

Anne, C.

2009-01-01

A safe, secure and reliable transportation organization is a key component for the success of the nuclear industry. With the forecasted increase of radioactive material transport flows in future and the changing environment, AREVA Logistic Business Unit (L-BU) must ensure that safety and security risks are minimized but also ensure of the chain supply for its various facilities (mines, conversion, enrichment, fuel manufacturing, reprocessing, etc). AREVA L-BU Unit is implementing a transportation risk management initiative for the radioactive shipments of the AREVA group across all the Business Unit involved in shipments of radioactive and nuclear materials. The paper will present the four main components of the risk management. (authors)

The Areva Group back-end division - challenges and prospects; Le pole aval dans le groupe Areva - enjeux et perspectives

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-06-01

This document presents the Areva Group back-end division challenges and prospects. Areva, a world nuclear industry leader, analyzes in this document, the high-profile mix of complementary activities of the nuclear energy industry, concerning the back-end division the full range of services for the end of the fuel cycle, the fuel cycle back-end markets, the economic and financial associated considerations. (A.L.B.)

Areva at September 30, 2013: Backlog of euro 42 bn Robust revenue growth to euro 6.847 bn: +4.7% vs. Sept. 2012 (+7.6% like for like) Strong organic growth (+9.9%) in the nuclear operations

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2013-01-01

After a remarkable first half and as anticipated, Areva's third quarter revenue was stable in the nuclear operations compared with the third quarter of 2012. Globally, Areva's nuclear operations generated organic growth of 10% in the first nine months of 2013. This performance demonstrates the strength of Areva's commercial positions in the installed base market, where the company continues to innovate while improving its competitiveness. The success of Areva's integrated offers and of its Safety Alliance and Forward Alliance programs are perfect examples of this. Moreover, agreements signed for the EDF project at Hinkley Point strengthen Areva's position in the new builds market and bolster the credibility of Areva's EPR TM offers to other customers. In the Renewable Energies BG, revenue is below Areva's Action 2016 plan outlook, mainly due to the current indecisiveness in the renewable markets. Based on Areva's performance over the past nine months, the company confirms its revenue outlook for its business as a whole in 2013. AREVA generated consolidated revenue of 6.847 billion euros in the first nine months of 2013, representing growth of 4.7% (+7.6% like for like) compared with the same period in 2012. Revenue growth was fueled by a 7.7% increase in recurring business (+11.0% like for like). Revenue from nuclear operations was 6.453 billion euros in the first nine months of 2013, compared with 6.035 billion euros in the first nine months of 2012, a 6.9% increase (+9.9% like for like). Revenue was led by growth in all nuclear Business Groups (BG): the Mining BG (+31.8% like for like), the Front End BG (+9.8% like for like), the Reactors and Services BG (+1.5% like for like) and the Back End BG (+10.3% like for like). Revenue fell 24.6% like for like in the renewable operations. Foreign exchange had a negative impact of 71 million euros during the period. The change in consolidation scope had a negative impact of 106 million euros. In the third quarter of 2013

Prescription by the 2013-2015 PNGMDR defined at the article 7.1 of the decree Nr 2013-1304: historical storages of radioactive wastes

International Nuclear Information System (INIS)

2014-01-01

Within the frame of the French national plan for the management of radioactive wastes (PNGMDR), this report aims at confirming that, within basic nuclear installations, secrete basic nuclear installations, or in areas which have been historically used as outbuildings or satellite of these installations, there isn't any historical waste storage site which would not have been mentioned in statements made to the Andra for the inventory of radioactive materials and wastes. Thus, the report contains a synthesis of information on various sites: Areva NC La Hague, Somanu, Areva NC Malvesi, Areva NC Melox, Areva NC Pierrelatte, SET (Plant Georges Besse II), Eurodif Production, Socatri, FBFC Romans, SIGN Veurey, and SIGN Annecy

Areva's challenge for ''Georges Besse 2''

International Nuclear Information System (INIS)

Jemain, A.

2003-01-01

For its future uranium enrichment plant of its Tricastin site (Drome, France), the world nuclear leader Areva has abandoned the gaseous diffusion technique (of French origin) for the centrifugation technique, more economical and modular. This future plant, named 'Georges Besse 2' will require 3 billions of euros of investment and will supply a world market also estimated to 3 billions of euros and shared between Areva, Urenco (UK), Usec (US), Minatom (Russia), JNC (Japan) and CNNC (China). The first batches of enriched uranium will be produced using a thousand of centrifuges by 2007. (J.S.)

AREVA HTR concept for near-term deployment

Energy Technology Data Exchange (ETDEWEB)

Lommers, L.J., E-mail: lewis.lommers@areva.com [AREVA Inc., 2101 Horn Rapids Road, Richland, WA 99354 (United States); Shahrokhi, F. [AREVA Inc., Lynchburg, VA (United States); Mayer, J.A. [AREVA Inc., Marlborough, MA (United States); Southworth, F.H. [AREVA Inc., Lynchburg, VA (United States)

2012-10-15

This paper introduces AREVA's High Temperature Reactor (HTR) steam cycle concept for near-term industrial deployment. Today, nuclear power primarily impacts only electricity generation. The process heat and transportation fuel sectors are completely dependent on fossil fuels. In order to impact this energy sector as rapidly as possible, AREVA has focused its HTR development effort on the steam cycle HTR concept. This reduces near-term development risk and minimizes the delay before a useful contribution to this sector of the energy economy can be realized. It also provides a stepping stone to longer term very high temperature concepts which might serve additional markets. A general description of the current AREVA steam cycle HTR concept is provided. This concept provides a flexible system capable of serving a variety of process heat and cogeneration markets in the near-term.

AREVA HTR concept for near-term deployment

International Nuclear Information System (INIS)

Lommers, L.J.; Shahrokhi, F.; Mayer, J.A.; Southworth, F.H.

2012-01-01

This paper introduces AREVA's High Temperature Reactor (HTR) steam cycle concept for near-term industrial deployment. Today, nuclear power primarily impacts only electricity generation. The process heat and transportation fuel sectors are completely dependent on fossil fuels. In order to impact this energy sector as rapidly as possible, AREVA has focused its HTR development effort on the steam cycle HTR concept. This reduces near-term development risk and minimizes the delay before a useful contribution to this sector of the energy economy can be realized. It also provides a stepping stone to longer term very high temperature concepts which might serve additional markets. A general description of the current AREVA steam cycle HTR concept is provided. This concept provides a flexible system capable of serving a variety of process heat and cogeneration markets in the near-term.

Within AREVA, FRAMATOME ANP and its worldwide experience with PWR and BWR fuels

International Nuclear Information System (INIS)

Watteau, Michel; Esteve, Bernard; Giese, Ulrich; Matheson, John

2002-01-01

Faced with obvious energy procurement security needs and the increasing concern about global warming, many countries are making a lucid analysis of their energy situation and reconsidering the multiple assets of nuclear energy. After the European Commission's Green Paper evaluation which was endorsed by the European Parliament, the United States gave a strong signal to the whole world by deciding to extent the operating life time of its existing NPPs and by envisioning the construction of new ones. In Asia, here in Korea, and in Japan, the People's Republic of China, Taiwan, large-scale nuclear power plant programs are being pursued. It was in this context, with the aim of ever-greater competitiveness, that the AREVA group was conceived. The aim is for all our skills to have a higher profile on the international markets, so that we are in a stronger position to develop a leadership in our two main high tech sectors of interconnect - electronics and nuclear. In the nuclear sector, the pooling of the Cogema and Framatome ANP forces is enabling AREVA to offer a comprehensive service package ranging from uranium mining to decommissioning, encompassing the design and construction of plants and their fuel; AREVA's experience is grounded in unequalled know-how. Further, with the CEA, a multidisciplinary research organization in charge of anticipating the emerging technologies, as a close partner, AREVA has a unique strategic vision. With this set-up, AREVA has the financial resources it needs to forge the alliances necessary for its development, so that it can best confront international competition and meet the requirements of its customers world-wide

EDF and Areva: a hazardous and risky strategy

International Nuclear Information System (INIS)

Teule, Rianne; Thomas, Steve

2009-06-01

As EDF and Areva have been developing for several years a strategy exclusively based on a nuclear revival in the world, this document proposes a synthesis of a study in which the author describes and analyses this strategy, as well as the actual trade perspectives of the sector, and outlines the many uncertainties regarding development projects. It addresses the financial and political context for EDF (a record indebtedness) and Areva (an inability to face investments) and outlines the supporting role of the Coface (the only way for the French government to support EDF and Areva). It highlights and discusses the failures of both ERP projects, in Flamanville (cost overruns and consequences) and in Finland. It addresses the actual status of markets, notices that France's strategy (lifetime extension for the existing reactors) implies that the construction of new EPRs might finally be postponed, that which would mean a loss of prospects for Areva and a catastrophe for the EPR program. It comments the commitment of EDF in the UK and outlines that the success of the development of new nuclear plants still depends on public subsidies which are not yet decided. The author considers that investments made by EDF in the USA seem rather speculative, and outlines that there are still financial issues and uncertainties like in the UK. The presence and activities of EDF and Areva in China are also commented, and more briefly for the rest of the world

AREVA NP decontamination concept for decommissioning. A comprehensive approach based on over 30 years experience

International Nuclear Information System (INIS)

Stiepani, Christoph

2011-01-01

Decontamination prior to Decommissioning and Dismantlement is imperative. Not only does it provide for minimization of personnel dose exposure but also maximization of the material volume available for free release. Since easier dismantling techniques in lower dose areas can be applied, the licensing process is facilitated and the scheduling and budgeting effort is more reliable. The most internationally accepted approach for Decontamination prior to Decommissioning projects is the Full System Decontamination (FSD). FSD is defined as the chemical decontamination of the primary cooling circuit, in conjunction with the main auxiliary systems. AREVA NP has long-term experience with Full System Decontamination for return to service of operating nuclear power plants as well as for decommissioning after shutdown. Since 1976, AREVA NP has performed over 500 decontamination applications and, from 1986, Decontaminations prior to Decommissioning projects which comprise virtually all NPP designs and plant conditions were performed: NPP designs: HPWR, PWR, and BWR by AREVA, Westinghouse, ABB and GE. Decontaminations performed shortly after final shutdown or several years later, and even after re-opening Safe Enclosure. High Alpha inventory and or low gamma/alpha ratio. Main Coolant chemistry (e.g., with and without Zn injection during operation). Fifteen Decontaminations prior to Decommissioning Projects have been performed successfully to date and the sixteenth FSD is now in the detailed engineering phase and is scheduled to commence late 2010. AREVA NP has developed a fully comprehensive approach for decontamination based on the CORD® (Chemical Oxidation Reduction Decontamination) Family, applied using the in-house designed decontamination equipment AMDA TM (Automatic Modular Decontamination Appliance). Based on the vast experience of AREVA NP in the field of decontamination, the Decontamination Concept for Decommissioning was developed. This concept ensures that the

AREVA in the Republic of South Africa

International Nuclear Information System (INIS)

2007-01-01

the field of nuclear energy, will play a vital role to be the anchor for the coordination of all nuclear energy R and D and innovation, to undertake and lead the development of uranium conversion capabilities, to develop nuclear fuel fabrication capabilities and obtain established fuel fabrication technologies, and to investigate the viability of building an indigenous reprocessing facility. Already, NECSA has managed a low and medium level waste storage site in Vaalputs since 1986. In 2005, the government issued the national radwaste management policy based on the recycling of used fuel and minimizing packaging and storage of waste volumes. On January, 2008, AREVA submitted its proposal for the construction of two EPRs within the scope of the 'Nuclear-1' program and possibly 10 other EPR within the scope of 'Fleet' program. The proposal is accompanied by the first elements of a global partnership aiming at the joint development of a South African nuclear industry and related skills development. AREVA achieved overall revenues of 94 million euros in South Africa in 2007, comprising 55 million euros in its Reactors and Services Division, 12 million euros in its Fuel Division and 27 million euros in its T and D Division in 2006. AREVA built the twin units of the Koeberg nuclear power plant. In 2006, the two reactors provided 10 TWh net of electricity, which represents 4.4% of the country's total electricity production. Today AREVA is present in Koeberg in the fields of utility services, technical assistance and fuel supply. Utility services mainly comprise inspection operations, maintenance, repair and component replacement as well as engineering and upgrading services. AREVA supplies fuel to the Koeberg nuclear power plant and provides NECSA with technical support for the conversion and fabrication of low enriched uranium for the SAFARI research reactor. Half of the installed transmission and distribution base in South Africa has been supplied by AREVA 's T and D

78 FR 19197 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Request for...

Science.gov (United States)

2013-03-29

...., AREVA NC, and AREVA NC, Inc. (collectively, ``Areva) India: Certain Preserved Mushrooms, A-533-813...: Certain Preserved 2/1/12-1/31/13 Mushrooms,\\5\\ A-570-851 Ayecue (Liaocheng) Foodstuff Co., Ltd. Blue Field... exporters of Certain Preserved Mushrooms from the PRC who have not qualified for a separate rate are deemed...

Areva 2009 responsible growth report: more energy, less CO2

International Nuclear Information System (INIS)

2009-01-01

This document is the 2009 annual responsible growth report of AREVA which presents itself as having consolidated its leadership position in its original business of nuclear power while expanding considerably in renewable energies (wind, solar, bio-energies and hydrogen/storage) to become a leading provider of solutions for carbon-free power generation. The main chapters of the report are: the group and its strategy, Areva's nuclear power solutions (is nuclear a sustainable energy source?, supply, technological excellence, safety, recycling and waste, acceptability, non-proliferation), Areva's renewable energy solutions (how much of the energy mix should be renewable?, rising demand, competitiveness and efficiency, responsible development), Areva's human resources (gender balance, health and safety, diversity and opportunity, hiring and training). Data and balanced scorecard for sustainable development are also given

Complementary safety assessment assessment of nuclear facilities - Tricastin facility - AREVA; Evaluation complementaire de la surete des installations nucleaires de base - Site du Tricastin - AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-01

This complementary safety assessment analyses the robustness of the Areva part of the Tricastin nuclear site to extreme situations such as those that led to the Fukushima accident. This study includes the following facilities: Areva NC Pierrelatte, EURODIF production, Comurhex Pierrelatte, Georges Besse II plant and Socatri. Robustness is the ability for the plant to withstand events beyond which the plant was designed. Robustness is linked to safety margins but also to the situations leading to a sudden deterioration of the accidental sequence. Moreover, safety is not only a matter of design or engineered systems but also a matter of organizing: task organization (including subcontracting) as well as the setting of emergency plans or the inventory of nuclear materials are taken into consideration in this assessment. This report is divided into 10 main chapters: 1) the feedback experience of the Fukushima accident; 2) description of the site and its surroundings; 3) featuring of the site's activities and installations; 4) accidental sequences; 5) protection from earthquakes; 6) protection from floods; 7) protection from other extreme natural disasters; 8) the loss of electrical power and of the heat sink; 9) the management of severe accidents; and 10) subcontracting policy. This analysis has identified 5 main measures to be taken to limit the risks linked to natural disasters: -) continuing the program for replacing the current conversion plant and the enrichment plant; -) renewing the storage of hydrofluoric acid at the de-fluorination workshop; -) assessing the seismic behaviour of some parts of the de-fluorination workshop and of the fluorine fabrication workshop; -) improving the availability of warning and information means in case of emergency; and -) improving the means to mitigate accidental gaseous releases. (A.C.)

Areva group. Result, first half 2004; Resultats du 1. semestre 2004. Groupe Areva

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-09-01

Areva, a world nuclear industry leader, provides by this document information and key data on the performance and detailed financial data of the first half 2004. The transmission and distribution integration plan 2004-2006 is also detailed. (A.L.B.)

Areva - Press release from the Supervisory Board

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Floquet-Daubigeon, Fleur; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du

2012-01-01

. Moreover, it asked the Executive Board to finalize in the shortest possible time frame the internal procedure applicable to the review and validation of the various projects and decisions creating a commitment, and the procedures for monitoring their execution. In addition, it noted that the deliberations of the Executive Board, like those of the bodies or authorities having received delegation of authority from it, must be systematically documented in writing, and asked the Executive Board to ensure that this rule is thoroughly applied. It asked the Executive Board to install a resources and reserves committee under its direct authority, responsible for validating each year the resource and reserve estimates appearing in the Reference Document, based on the work of the Reserves Department. This committee, which will involve one or more recognized external experts, shall specify the methods and schedule for updating resources and reserves. Its work shall be reported on an annual basis to the Audit Committee. Reference to the installation and operation of this committee shall appear in the Reference Document published by AREVA. Lastly, it asked the Executive Board to study the transformation of the legal form of the company into a limited liability company with a board of directors. A summary of the ad hoc committee's report to the Supervisory Board is given in appendix

AREVA sustainable development indicators guidelines; Guide methodologique des indicateurs developpement durable AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-12-01

These guidelines set out the procedures used to measure and report the sustainable development and continuous progress data and indicators used within the Areva Group. It defines the scope of the guide, the list of indicators, the measurement and calculation procedures, the internal and external audits. (A.L.B.)

Environmental, social, and corporate report 2012 - Cezus Jarrie (Areva)

International Nuclear Information System (INIS)

2013-01-01

CEZUS, an AREVA group subsidiary, is the global leader in the market for nuclear-grade zirconium. Zirconium is a metal used for fuel cladding, among other applications. CEZUS operates at six sites; the Jarrie site in the Isere department of France produces zirconium sponge. This document shows details of the CEZUS Jarrie facility and its 2012 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

Complementary safety assessment assessment of nuclear facilities - Tricastin facility - AREVA

International Nuclear Information System (INIS)

2011-01-01

This complementary safety assessment analyses the robustness of the Areva part of the Tricastin nuclear site to extreme situations such as those that led to the Fukushima accident. This study includes the following facilities: Areva NC Pierrelatte, EURODIF production, Comurhex Pierrelatte, Georges Besse II plant and Socatri. Robustness is the ability for the plant to withstand events beyond which the plant was designed. Robustness is linked to safety margins but also to the situations leading to a sudden deterioration of the accidental sequence. Moreover, safety is not only a matter of design or engineered systems but also a matter of organizing: task organization (including subcontracting) as well as the setting of emergency plans or the inventory of nuclear materials are taken into consideration in this assessment. This report is divided into 10 main chapters: 1) the feedback experience of the Fukushima accident; 2) description of the site and its surroundings; 3) featuring of the site's activities and installations; 4) accidental sequences; 5) protection from earthquakes; 6) protection from floods; 7) protection from other extreme natural disasters; 8) the loss of electrical power and of the heat sink; 9) the management of severe accidents; and 10) subcontracting policy. This analysis has identified 5 main measures to be taken to limit the risks linked to natural disasters: -) continuing the program for replacing the current conversion plant and the enrichment plant; -) renewing the storage of hydrofluoric acid at the de-fluorination workshop; -) assessing the seismic behaviour of some parts of the de-fluorination workshop and of the fluorine fabrication workshop; -) improving the availability of warning and information means in case of emergency; and -) improving the means to mitigate accidental gaseous releases. (A.C.)

Monitoring of the radiological environmental impact of the AREVA site of Tricastin; Suivi de l'impact radiologique environnemental des activites du site AREVA du Tricastin

Energy Technology Data Exchange (ETDEWEB)

Mercat, C.; Brun, F.; Florens, P.; Petit, J. [AREVA NC Pierrelatte, Direction surete environnement du site du Tricastin, 26 (France); Garnier, F. [EURODIF Production, Direction qualite securite surete environnement, 26 (France); Devin, P. [AREVA NC Pierrelatte, Direction surete, sante, securite, environnement, 26 (France)

2010-06-15

Set up at the beginning of the site's operations, in 1962, the monitoring of the radiological environmental impact of the AREVA site of Tricastin has evolved over time to meet more specifically the multiple objectives of environmental monitoring: to prove the respect of the commitments required by the authorities, to be able to detect a dysfunction in the observed levels, to enable the assessment of impacts of industrial activities, to ensure the balance between environmental quality and the use made by the local population and to inform the public of the radiological state of the environment. Thousands of data were acquired on the radioactivity of all environmental compartments as well as on the functioning of local ecosystems. Today, the Network of Environmental Monitoring of AREVA Tricastin goes beyond the requirements of routine monitoring to provide innovative solutions for monitoring the radioactivity (especially for uranium) in the environment. (author)

AREVA in the United States

International Nuclear Information System (INIS)

2007-01-01

civilian nuclear power program, which had been wound down by the Carter Administration in 1979. More than 30 projects are underway, of which almost half are the subject of a Construction and Operating License (COL) application to the NRC. According to the report published in February 2007 by the EPRI, installed nuclear power in the United States could have increased by 64 GWe in 2030 and by 24 GWe in 2020. The document presents Areva's position in the US market for nuclear products and services, AREVA's integrated offer covering the entire nuclear energy cycle, AREVA's support in the revival of the U.S. nuclear sector, and the forward-thinking approach for AREVA's T and D division

75 FR 77675 - AREVA NP, Inc.; Confirmatory Order (Effective Immediately)

Science.gov (United States)

2010-12-13

... cause. VI Any person adversely affected by this Confirmatory Order, other than AREVA, may request a..., appropriate notification of regulatory authorities, safety culture and safety conscious work environment...., outside the global AREVA organization), safety culture assessment in accordance with an accepted nuclear...

Experience of Areva in fuel services for PWR and BWR

International Nuclear Information System (INIS)

Morales, I.

2015-01-01

AREVA being an integrated supplier of fuel assemblies has included in its strategy to develop services and solutions to customers who desire to improve the performance and safety of their fuel. These services go beyond the simple 'after sale' services that can be expected from a fuel supplier: The portfolio of AREVA includes a wide variety of services, from scientific calculations to fuel handling services in a nuclear power plant. AREVA is committed to collaborate and to propose best-in-class solutions that really make the difference for the customer, based on 40 years of Fuel design and manufacturing experience. (Author)

Environmental assessment, continual improvement and adaptive management within the AREVA sustainable development framework

International Nuclear Information System (INIS)

Rosaasen, A.; Frostad, S.

2006-01-01

COGEMA Resources Inc. (which is part of the AREVA Group) is a Canadian company with its head office in Saskatoon, Saskatchewan. It owns and operates mining and milling facilities in northern Saskatchewan, which produce uranium concentrate. The McClean Lake Operation commenced production in 1999 and its environmental management system represents an integrated approach to environmental assessment, continual improvement and adaptive management based on operational results. In Canada, sustainable development is promoted through the application of the Canadian Environmental Assessment Act (CEAA). Environmental Assessment (EA) is a planning tool, which incorporates environmental considerations before irrevocable decisions are taken. The basic tenet of the Act is the determination of whether the potential environmental effects of a project are adverse, significant and likely, taking into consideration mitigation measures. Thus, project planning and design entails an iterative process that incorporates mitigation measures to minimize potentially significant adverse effects. As part of the EA process conservative approaches are taken to predict potential effects. Several important elements are generated through the EA process including: a set of environmental effects predictions, a compliance and environmental effects monitoring program, a follow-up program to address uncertainties in the prediction of environmental effects, and the identification of contingency measures that could be implemented should non-conservative assumptions be identified in the original assessment framework. The challenge is to integrate each of these elements into the environmental management framework of the operating facility and develop an iterative mechanism to evaluate operational performance relative to what was originally predicted. In Saskatchewan, a requirement of operational licenses is the periodic evaluation of the 'Status of the Environment' surrounding operational facilities. These

Environmental, social, and corporate report 2010 - Cezus Ugine (Areva)

International Nuclear Information System (INIS)

2011-01-01

CEZUS, a subsidiary of AREVA, is the global leader in the market for zirconium, the metal used, among other things, for nuclear fuel cladding. CEZUS's operations are distributed over six sites. The site in Ugine handles production of ingots and transformation of zirconium, titanium, tantalum, and hafnium into semi-finished products. This document shows details of the CEZUS Ugine facility and its 2010 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

Environmental, social, and corporate report 2012 - Cezus Rugles (Areva)

International Nuclear Information System (INIS)

2013-01-01

CEZUS, a subsidiary of AREVA, is the global leader in the zirconium market, the metal used, among other things, for fuel assembly tube cladding in the heart of nuclear reactors. CEZUS's operations are distributed over six sites: the Rugles site manufactures flat products originated from the pilgering of rectangular billets. This document shows details of the CEZUS Rugles facility and its 2012 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

Environmental, social, and corporate report 2012 - Cezus Ugine (Areva)

International Nuclear Information System (INIS)

2013-01-01

CEZUS, a subsidiary of AREVA, is the global leader in the market for zirconium, the metal used, among other things, for nuclear fuel cladding. CEZUS's operations are distributed over six sites. The site in Ugine handles production of ingots and transformation of zirconium, titanium, tantalum, and hafnium into semi-finished products. This document shows details of the CEZUS Ugine facility and its 2012 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

75 FR 69878 - Drawbridge Operation Regulation; Neuse River, New Bern, NC

Science.gov (United States)

2010-11-16

... Operation Regulation; Neuse River, New Bern, NC AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from regulations. SUMMARY: The Commander, Fifth Coast Guard District, has issued a temporary... is given. NSR has requested a temporary deviation to the existing regulations for the Neuse River...

EPR by Areva. EPR the 1600+ MWe reactor

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This brochure presents the GEN III+ EPR reactor designed by the Areva and Siemens consortium. The EPR reactor is a direct descendent of the well-proven N4 and KONVOI reactors, the most modern reactors in France and Germany. The EPR was designed by teams from KWU/Siemens and Framatome, EDF in France and the major German utilities, working in collaboration with both French and German safety authorities. The EPR integrates the results of decades of R and D programs, in particular those performed by the CEA (French Atomic Energy Commission) and the Karlsruhe Research Center in Germany. The EPR benefits from the experience of several thousand reactor-years of operation of pressurized water reactor technology. This experience has put 87 AREVA PWRs online throughout the world. Innovative Features: - An outer shell covering the reactor building, the spent fuel building and two of the four safeguard buildings provides protection against large commercial or military aircraft crash. - A heavy neutron reflector that surrounds the reactor core lowers uranium consumption. - An axial economizer inside the steam generator allows a high level of steam pressure and therefore high plant efficiency. - A core catcher allows passive collection and retention of the molten core should the reactor vessel fail in the highly unlikely event of a core melt. - A digital technology and a fully computerized control room with an operator friendly man-machine interface improve the reactor protection system.

EPR by Areva. EPR the 1600+ MWe reactor

International Nuclear Information System (INIS)

2008-01-01

This brochure presents the GEN III+ EPR reactor designed by the Areva and Siemens consortium. The EPR reactor is a direct descendent of the well-proven N4 and KONVOI reactors, the most modern reactors in France and Germany. The EPR was designed by teams from KWU/Siemens and Framatome, EDF in France and the major German utilities, working in collaboration with both French and German safety authorities. The EPR integrates the results of decades of R and D programs, in particular those performed by the CEA (French Atomic Energy Commission) and the Karlsruhe Research Center in Germany. The EPR benefits from the experience of several thousand reactor-years of operation of pressurized water reactor technology. This experience has put 87 AREVA PWRs online throughout the world. Innovative Features: - An outer shell covering the reactor building, the spent fuel building and two of the four safeguard buildings provides protection against large commercial or military aircraft crash. - A heavy neutron reflector that surrounds the reactor core lowers uranium consumption. - An axial economizer inside the steam generator allows a high level of steam pressure and therefore high plant efficiency. - A core catcher allows passive collection and retention of the molten core should the reactor vessel fail in the highly unlikely event of a core melt. - A digital technology and a fully computerized control room with an operator friendly man-machine interface improve the reactor protection system

AREVA announces US$ 7.75 Per share friendly cash offer for UraMin

International Nuclear Information System (INIS)

2007-01-01

AREVA and UraMin Inc. ('UraMin') entered on June 15, 2007 into an agreement in respect of AREVA's friendly cash offer for 100% of the share capital of UraMin. UraMin is listed in London (AIM) and Toronto (TSX). AREVA (Euronext Paris) already owns 5.5% of UraMin's share capital. This cash offer of AREVA will be made through its indirect wholly-owned subsidiary CFMM Development ('AREVA') based on a price of US$ 7.75 per UraMin share. The total offer consideration amounts to more than USD 2.5 billion for 100% of the fully diluted share capital of UraMin. This represents a premium of 21% over UraMin 20-day weighted average trading price ending on June 8, 2007. The UraMin Board of Directors, after consulting with its financial advisors, has determined that the offer is fair and in the best interest of the UraMin shareholders and it has resolved to recommend acceptance of the Offer. BMO Capital Markets has provided an opinion that the offer is fair, from a financial point of view, to the UraMin shareholders. In connection with the offer, all directors and certain other shareholders representing approximately 25% of the outstanding UraMin shares (calculated on a fully diluted basis) have entered into lock-up agreements with AREVA pursuant to which they have agreed to tender all their UraMin shares to AREVA's offer. The support agreement entered into between AREVA and UraMin provides for, among other things, in case a superior proposal is accepted by UraMin, a right to match in favour of AREVA. The support agreement also includes a break up fee in favour of AREVA of US$ 75 million under certain circumstances. Concurrently with the closing of the proposed offer, UraMin will declare a dividend payable in shares of the capital of Niger Uranium Limited held by UraMin (where permitted by law) or a cash equivalent of the value of such shares

Complementary Safety Assessments: technical and organisational proposals from Areva

International Nuclear Information System (INIS)

Anon.

2012-01-01

The safety experts of the Areva group have worked on the definition of a hard core of safety measures necessary to assure the vital functions in any situation (event the most unlikely) of the following nuclear facilities: La Hague, Tricastin, Melox, and FBFC Romans. Areva proposes to reinforce its crisis management by deploying new equipment for the intervention and communication (pumps, robots, diesel sets, measuring devices, satellite phone...). More than 1500 people with training and skills related to nuclear crisis will be able to help local teams on nuclear facilities if necessary. Areva has announced that it will invest more than 2 billion euros for upgrading the industrial plants, the implementation of new technologies and the improvement of safety. (A.C.)

Virtual reality boosts performance at AREVA Projects

International Nuclear Information System (INIS)

Bernasconi, F.

2017-01-01

AREVA Projects is one of the 6 business units of New AREVA and it is dedicated to engineering works in a vast fan of activities from mining to waste management via uranium chemistry and nuclear fuel recycling. AREVA projects has opted for innovation to improve performance. Since 2012 virtual reality has been used through the creation of a room equipped with a high-definition screen and stereoscopic goggles. At the beginning virtual reality was used to test and validate procedures for handling equipment thanks to a dynamical digital simulation of this equipment. Now virtual reality is massively used to validate the design phase of projects without having to fabricate a physical mock-up which saves time. The next step in the use of virtual reality is the implementation of a new version of devices like helmets, gloves... that will allow a better interaction with the virtual world. The continuously increasing of computer power is always pushing back the limits of what is possible in virtual reality. (A.C.)

AREVA in the Republic of South Africa

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

for research and development in the field of nuclear energy, will play a vital role to be the anchor for the coordination of all nuclear energy R and D and innovation, to undertake and lead the development of uranium conversion capabilities, to develop nuclear fuel fabrication capabilities and obtain established fuel fabrication technologies, and to investigate the viability of building an indigenous reprocessing facility. Already, NECSA has managed a low and medium level waste storage site in Vaalputs since 1986. In 2005, the government issued the national radwaste management policy based on the recycling of used fuel and minimizing packaging and storage of waste volumes. On January, 2008, AREVA submitted its proposal for the construction of two EPRs within the scope of the 'Nuclear-1' program and possibly 10 other EPR within the scope of 'Fleet' program. The proposal is accompanied by the first elements of a global partnership aiming at the joint development of a South African nuclear industry and related skills development. AREVA achieved overall revenues of 94 million euros in South Africa in 2007, comprising 55 million euros in its Reactors and Services Division, 12 million euros in its Fuel Division and 27 million euros in its T and D Division in 2006. AREVA built the twin units of the Koeberg nuclear power plant. In 2006, the two reactors provided 10 TWh net of electricity, which represents 4.4% of the country's total electricity production. Today AREVA is present in Koeberg in the fields of utility services, technical assistance and fuel supply. Utility services mainly comprise inspection operations, maintenance, repair and component replacement as well as engineering and upgrading services. AREVA supplies fuel to the Koeberg nuclear power plant and provides NECSA with technical support for the conversion and fabrication of low enriched uranium for the SAFARI research reactor. Half of the installed transmission and distribution base in

Areva's privatization uncertainties

International Nuclear Information System (INIS)

Jemain, A.

2004-01-01

The French nuclear public group Areva (the fusion of CEA-Industrie, Framatome and Cogema companies) will actively prepare its privatization and stock exchange introduction before the end of the first half of 2005, in order to re-launch its acquisitions and associations policy. However, the advantages of this privatization with a preponderant public share-holding will depend on the intentions of the French government. Short paper. (J.S.)

Environmental, social, and corporate report 2012 - Cezus Paimboeuf (Areva)

International Nuclear Information System (INIS)

2013-01-01

CEZUS, a subsidiary of AREVA, is the global leader in the market for zirconium, the metal used, among other things, for fuel cladding in the heart of nuclear reactors. CEZUS's operations are distributed over six sites. The site in Paimboeuf, in the Loire-Atlantique department, fabricates zirconium-alloy cladding tubes and guide tubes. This document shows details of the CEZUS Paimboeuf facility and its 2012 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

The Areva Group back-end division - challenges and prospects

International Nuclear Information System (INIS)

2004-06-01

This document presents the Areva Group back-end division challenges and prospects. Areva, a world nuclear industry leader, analyzes in this document, the high-profile mix of complementary activities of the nuclear energy industry, concerning the back-end division the full range of services for the end of the fuel cycle, the fuel cycle back-end markets, the economic and financial associated considerations. (A.L.B.)

'Action 2016': AREVA's strategic action plan to improve performance

International Nuclear Information System (INIS)

Marie, Patricia; Floquet-Daubigeon, Fleur; Michaut, Maxime; De Scorbiac, Marie; Du Repaire, Philippine

2011-01-01

On December 12, 2011, Luc Oursel, Executive Officer of AREVA, and Pierre Aubouin, Chief Financial Executive Officer, presented the group's 'Action 2016' strategic action plan based on an in-depth analysis of the market's outlook. This document makes, first, a Detailed presentation of the 'Action 2016' plan and then presents the group's financial outlook: - Full-year 2011 immediate accounting consequences of the new market environment: operating losses expected in 2011; - 2012-2013 transition period Objective: self-finance capex in cumulative terms; - 2014-2016: safe growth and cash generation, free operating cash flow at break-even beginning in 2013, above euro 1 bn per year beginning in 2015

Full system decontamination. AREVAs experience in decontamination prior to decommissioning

International Nuclear Information System (INIS)

Topf, Christian

2010-01-01

Minimizing collective radiation exposure and producing free-release material are two of the highest priorities in the decommissioning of a Nuclear Power Plant (NPP). Full System Decontamination (FSD) is the most effective measure to reduce source term and remove oxide layer contamination within the plant systems. FSD is typically a decontamination of the primary coolant circuit and the auxiliary systems. In recent years AREVA NP has performed several FSDs in PWRs and BWRs prior to decommissioning by applying the proprietary CORD copyright family and AMDA copyright technology. Chemical Oxidation Reduction Decontamination or CORD represents the chemical decontamination process while AMDA stands for Automated Mobile Decontamination Appliance, AREVA NPs decontamination equipment. Described herein are the excellent results achieved for the FSDs applied at the German PWRs Stade in 2004 and Obrigheim in 2007 and for the FSDs performed at the Swedish BWRs, Barsebaeck Unit 1 in 2007 and Barsebaeck Unit 2 in 2008. All four FSDs were performed using the AREVA NP CORD family decontamination technology in combination with the AREVA NP decontamination equipment, AMDA. (orig.)

AREVA invests 610 million euro in new uranium conversion plants

International Nuclear Information System (INIS)

2007-05-01

AREVA today announced the launch of the Comurhex II project which will see the group build new uranium conversion facilities on the Malvesi site in Narbonne and Tricastin. Through this 610 million euro investment, AREVA aims to maintain its position as world no. 1 for conversion within a context of global nuclear energy. COMURHEX II integrates technological innovations from major R and D programs and return of experience from processes in operation for over forty years. Nuclear safety and reducing the impact on the environment were top priorities when designing the project. These future facilities will also lead to major savings of water and energy consumption and reduce effluents. The groundwork of the Comurhex II project has taken 150,000 hours of engineering over the past three years. Four hundred people will work on the site which will be launched in summer 2007. First industrial production is scheduled for 2012, based on 15,000 metric tons of uranium per year. This figure may be increased to 21,000 tons to meet market requirements

Monitoring of the radiological environmental impact of the AREVA site of Tricastin

International Nuclear Information System (INIS)

Mercat, C.; Brun, F.; Florens, P.; Petit, J.; Garnier, F.; Devin, P.

2010-01-01

Set up at the beginning of the site's operations, in 1962, the monitoring of the radiological environmental impact of the AREVA site of Tricastin has evolved over time to meet more specifically the multiple objectives of environmental monitoring: to prove the respect of the commitments required by the authorities, to be able to detect a dysfunction in the observed levels, to enable the assessment of impacts of industrial activities, to ensure the balance between environmental quality and the use made by the local population and to inform the public of the radiological state of the environment. Thousands of data were acquired on the radioactivity of all environmental compartments as well as on the functioning of local ecosystems. Today, the Network of Environmental Monitoring of AREVA Tricastin goes beyond the requirements of routine monitoring to provide innovative solutions for monitoring the radioactivity (especially for uranium) in the environment. (author)

AREVA in the United States

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

public message about his determination to revive the civilian nuclear power program, which had been wound down by the Carter Administration in 1979. More than 30 projects are underway, of which almost half are the subject of a Construction and Operating License (COL) application to the NRC. According to the report published in February 2007 by the EPRI, installed nuclear power in the United States could have increased by 64 GWe in 2030 and by 24 GWe in 2020. The document presents Areva's position in the US market for nuclear products and services, AREVA's integrated offer covering the entire nuclear energy cycle, AREVA's support in the revival of the U.S. nuclear sector, and the forward-thinking approach for AREVA's T and D division.

Transmission and Distribution: AREVA takes further action to reinforce its presence in China

International Nuclear Information System (INIS)

2007-05-01

Following the recent opening of its new gas-insulated switchgear factory last month in Suzhou, China, AREVA's Transmission and Distribution (T and D) division has announced additional actions to increase its market share in the country. The division has just signed an agreement to form a 50/50 joint venture with the Chinese company, Sunten Electric Co. Ltd., a leading manufacturer of distribution transformers, whose 2006 annual sales reached circa euro 120 million. Through this joint venture, AREVA T and D will become No 1 in China for dry-type transformers, Sunten Electric Co. Ltd.'s specialization. AREVA T and D has also established a partnership with the China Electric Power Research Institute (C-EPRI), a leading Chinese organization specialized in electrical technologies. Under the agreement, C-EPRI will be the official licensee for AREVA T and D's H-400 high-voltage direct current (HVDC) Thyristor valves in China. The partnership will enable AREVA T and D to enter the fast-growing domestic HVDC market. The T and D sector in China represents 24% of the worldwide transmission and distribution market. AREVA T and D's turnover in China, where demand for T and D equipment is growing strongly, should significantly contribute to the division's objective to reach euro 5 billion in sales by 2010

Areva in China - Press kit April 2013

International Nuclear Information System (INIS)

2013-04-01

increasingly key market for the AREVA Group. AREVA, which is focused on and committed to both nuclear and renewable energies, supports the Chinese utilities to reach the ambitious targets set by their government. This document summarizes the present activities of Areva in China: 1 - More than 30 years of cooperation with China: Key Dates; AREVA Group in China and partnerships with the Chinese Nuclear Industry; 2 - Chinese energy and policies: Economy and Energy in China, Nuclear energy in China, Overview of the Chinese nuclear fleet, Renewable energies in China; 3 - Activities in China: Mining, Front-End, Reactors and Services, Back-End, Renewable Energies; 4 - Taishan 1 and 2 EPRTM project: General Description, Scope of AREVA, AREVA Supply Chain, Key Milestones, Progress of Taishan 1 and 2, at the end of 2012

The 2003 essential. AREVA

International Nuclear Information System (INIS)

2004-07-01

This document presents the essential activities of the Areva Group, a world nuclear industry leader. This group proposes technological solutions to produce the nuclear energy and to transport the electric power. It develops connection systems for the telecommunication, the computers and the automotive industry. Key data on the program management, the sustainable development activities and the different divisions are provided. (A.L.B.)

Areva - first half 2007 financial results

International Nuclear Information System (INIS)

2007-01-01

This document presents the financial statements of Areva group for the first half of 2007 as submitted by the Executive Board: Sales revenue: euro 5.373 billion, up by 6.7%; Operating income: euro 207 million, i.e. 3.9% operating margin, up 1.6 point compared with H1 2006; Consolidated net income: euro 295 million, i.e. euro 8.31 per share in H1 2007 against euro 6.92 per share in H1 2006, a 20% increase. All Group performance indicators were up the first half of 2007. Growth was robust and profitability strengthened significantly in terms of both operating income and net income. Consolidated sales revenue rose 6.7% for the first half of 2007 alone, after growth of more than 7% in 2006. This positive trend will continue: the backlog grew by 31% in the first half to more than euro 33 billion, compared with euro 26 billion six months ago and euro 21 billion at year-end 2005. Business is up sharply in the Transmission and Distribution division, which had operating margin of 8.7% in the first half of the year

Track record of the AREVA NP Nuclear Fuel in the United States of America

International Nuclear Information System (INIS)

Robertson, Scott T.; Bordy, Michelaristide

2006-01-01

Having its American, German and French legacy, AREVA NP has been and is supplying nuclear fuel assemblies and associated core components to PWR and BWR reactors around the world. To develop its action on the world market, AREVA NP has organized its activities on its major locations in Europe (France, Germany and Belgium) and in the USA. Also AREVA NP is strongly represented in the other nuclear countries (Asia, Eastern Europe, South America, South Africa and remaining European countries). Today AREVA NP has supplied more than 110,000 PWR and 51,000 BWR fuel assemblies to the world market. In the USA, AREVA NP has produced about 28,000 PWR fuel assemblies. Representing almost a quarter of the PWR American fuel market, AREVA NP is currently supplying or starting to supply 22 reactors from its 2 manufacturing plants located at Lynchburg (VA) and Richland (WA). This supply is currently based on HTP and Mark-BW designs, which have been distributed to all types of the US reactors and satisfy the NRC requirements. Also they are prepared for the current development of reactors, including AREVA NP's EPR reactor. At the time being our US PWR fuel takes the advantage of the thorough review performed on all our products, in order to keep the most proven and best performance features and allow US to better respond to each customer need. We propose the AGORA products with enough flexibility and variants to offer customized products, well suited to each customer's needs. These products incorporate a set of common characteristics and associated features, which are: · the use of the M5R alloy, as cladding material and as structural material. · a welded structure comprising the HMP alloy 718 bottom end grid, the MONOBLOC guide thimbles and the ROBUST FUELGUARD as lower tie plate. AREVA NP's fuel activities are supported by their engineering, manufacturing and fuel services which enable AREVA NP to provide utilities with licensed fuel design, a complete fuel package and suitable

AREVA sustainable development indicators guidelines

International Nuclear Information System (INIS)

2003-12-01

These guidelines set out the procedures used to measure and report the sustainable development and continuous progress data and indicators used within the Areva Group. It defines the scope of the guide, the list of indicators, the measurement and calculation procedures, the internal and external audits. (A.L.B.)

Setting UP a decontamination and dismantling (D and D) scenario - methodology and tools developed leopard

International Nuclear Information System (INIS)

Pradoura, F.

2009-01-01

At the AREVA NC La Hague site, the former nuclear spent fuel reprocessing plant UP2-400 was shutdown on December 30, 2003. Since then, the cleaning up and dismantling activities have been carried by the DV/PRO project, which is the program management organization settled by AREVA NC, for valorization projects. SGN, part of the AREVA NC Engineering Business Unit, operates as the main contractor of the DV/PRO project and provides project management services related to decommissioning and waste management. Hence, SGN is in charge of building D and D's scenarios for all the facilities of the UP2-400 plant, in compliance with safety, technical and financial requirements. Main outputs are logic diagrams, block flow diagrams, wastes and effluents throughputs. In order to meet with AREVA NC's requirements and expectations, SGN developed specific process and tools methods adapted to the scale and complexity of decommissioning a plant with several facilities, with different kind of processes (chemical, mechanical), some of which are in operation and other being dismantled. Considering the number of technical data and inputs to be managed, this methodology leads to complex outputs such as schedules, throughputs, work packages... The development, the maintenance and the modification of these outputs become more and more difficult with the complexity and the size of the plant considered. To cope with these issues, SGN CDE/DEM UP2-400 project team has developed a dedicated tool to assist and optimize in elaborating D and D scenarios. This tool is named LEOPARD (Logiciel d'Elaboration et d'Optimisation des Programmes d'Assainissement Radiologique et de Demantelement) (Software for the Development and Optimization of Radiological Clean up and Dismantling Programs). The availability of this tool allowed the rapid construction of a test case (demonstrator) that has convinced DV/PRO of its numerous advantages and of the future further development potentials. Presentations of LEOPARD

Areva group. Result, first half 2004

International Nuclear Information System (INIS)

2004-09-01

Areva, a world nuclear industry leader, provides by this document information and key data on the performance and detailed financial data of the first half 2004. The transmission and distribution integration plan 2004-2006 is also detailed. (A.L.B.)

Environmental, social, and corporate report 2009 - Cezus Montreuil- Juigne (Areva)

International Nuclear Information System (INIS)

2010-01-01

CEZUS, a subsidiary of AREVA, is the global leader in the market for zirconium, the metal used, among other things, for the cladding on fuel assembly tubes. CEZUS's operations are distributed over six sites. The site in Montreuil-Juigne, in western France, pilgers zirconium and titanium alloy tubes and blanks for the fabrication of fuel assembly tubes. This document shows details of the CEZUS Montreuil-Juigne facility and its 2009 initiatives on: consumption and waste management, risk management, environmental and safety management, social and corporate responsibilities

76 FR 387 - Atomic Safety and Licensing Board; AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility)

Science.gov (United States)

2011-01-04

... and Licensing Board; AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility) December 17, 2010... construction and operation of a gas centrifuge uranium enrichment facility--denoted as the Eagle Rock... site at http://www.nrc.gov/materials/fuel-cycle-fac/arevanc.html . These and other documents relating...

Areva. 2005 half year report

International Nuclear Information System (INIS)

2005-01-01

With manufacturing facilities in over 40 countries and a sales network in over 100, AREVA offers customers technological solutions for nuclear power generation and electricity transmission and distribution. The group also provides interconnect systems to the telecommunications, computer and automotive markets. This half-year report of Areva group presents the key financial data of the group for the first half of 2005: 1 - Highlights of the period; 2 - Transition to the International Financial Reporting Standards: Group's application of IFRS, Impact of IAS 32 and 39 adoption on the Group's financial statements; 3 - Key data: summary data, summary data by business Division, backlog, income statement, review by business Division, cash flow statement, balance sheet items; 4 - events subsequent to the half-year-end; 5 - consolidated financial statements: statutory Auditors' report on the 2005 half-year financial statements - period from January 1 to June 30, 2005, consolidated income statement, consolidated balance sheet, consolidated cash flow statement, change in consolidated shareholders' equity, data by business Division and region, notes to the consolidated financial statements; 6 - Outlook

Responsible Development of Areva's Mining Activities. 2010 report

International Nuclear Information System (INIS)

2010-01-01

After a map indicating the location of the main Areva's mining sites, this report provides several key figures and data and discusses the evolution of this activity which is part of the business core of the AREVA company. It gives a statement of values and principles, governance and commitments related to this activity. In order to report this activity, it addresses several topics: reduction of industrial risks, protection of workers and populations, rational consumption of water and energy resources, biodiversity preservation, management over time of waste rock and mining tailings, sustainable integration into territories, and contribution to social development. This document is proposed in French and in English

AREVA Technical Days (ATD) session 1: Energy outlook and presentation of the Areva Group; AREVA Technical Days (ATD) session 1: enjeux energetiques et presentation du groupe AREVA

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This first session deals with energy challenges and nuclear, public acceptance of nuclear power, mining activities, chemistry activities, enrichment activities, fuel assembly, reactors and services activities, nuclear measurements activities, reprocessing and recycling activities, logistics activities and connectors activities. (A.L.B.)

Responsible Development On Areva's Mining Activities - Report 2013-2014

International Nuclear Information System (INIS)

2014-01-01

Mining activities are the first link in the nuclear fuel cycle and in the integrated model of the Areva Group. Areva was one of the top producers worldwide in 2013, producing 9,330 metric tons of uranium (Areva's financially consolidated share). The group works to maintain resources and weighted reserves equivalent to 20 years of production at all times. Thanks to a presence spanning five continents, they ensure the long-term supply to customers of uranium for electricity production while maintaining a responsible attitude towards people and the environment. It has a diverse portfolio of both active mines (Canada, Kazakhstan and Niger) and mines under development (Africa). This document is Areva's Mining Activities responsible Development report for 2013 and 2014. Content: profile (Overview, Keys events, Worldwide presence, Governance and Organization, Uranium market); CSR approach (Message from the Senior Executive Vice President, Fundamentals, Responsible Commitments Plan, Materiality); Commitments (Health and radiation protection, Occupational safety, Environment and Biodiversity, Community involvement, Commitment to employees, Relationships with stakeholders, Innovation); Performance (Main Key indicators, 2013-2016 Objectives, Reporting parameters); Annexes (Cases studies, Focus post-mining, Audit and GRI certifications)

Convincing about the advanced use of nuclear energy closing the fuel cycle: from a burden to a solution

International Nuclear Information System (INIS)

Neau, Henry Jacques

2007-01-01

France has associated a closed fuel cycle with its nuclear program, and developed the corresponding treatment recycling capabilities accordingly. This choice was recently consolidated by law. according to the sustainable management of radioactive materials and waste act of June 2006, the volume and radio toxicity reduction of nuclear waste is an objective that can notably be reached with their treatment and conditioning. Presently, used fuel valuable components (U and Pu) are recycled into MOX fuel and RepU, when fission products are conditioned under an extremely solid and resistant form which cannot disperse and dissolve in the environment (High Level Vitrified Waste). Safety and waste minimisation remain the AREVA constant objective. Presently operated treatment and recycling AREVA NC facilities are using mature industrial technologies, which address environment preservation and non proliferation concerns. This french national choice requires a permanent global acceptance strategy towards politicians, media, associations and more generally public opinion: to. be accepted, in needs to be understood. Transparency, dialogue and information are keywords for AREVA NC to be sure that closing the fuel cycle is considered as the best option available now for responsibly managing the waste, respecting the environment, preserving the resource and securing the future. Partnering in this Global Acceptance policy with other countries and customers, who already rely- or plan to do so - on this recycling strategy is both a reality and a permanent axis of development for AREVA NC

AREVA - 2013 Reference document

International Nuclear Information System (INIS)

2014-01-01

This Reference Document contains information on the AREVA group's objectives, prospects and development strategies, as well as estimates of the markets, market shares and competitive position of the AREVA group. Content: 1 - Person responsible for the Reference Document; 2 - Statutory auditors; 3 - Selected financial information; 4 - Description of major risks confronting the company; 5 - Information about the issuer; 6 - Business overview; 7 - Organizational structure; 8 - Property, plant and equipment; 9 - Situation and activities of the company and its subsidiaries; 10 - Capital resources; 11 - Research and development programs, patents and licenses; 12 - Trend information; 13 - Profit forecasts or estimates; 14 - Management and supervisory bodies; 15 - Compensation and benefits; 16 - Functioning of the management and supervisory bodies; 17 - Human resources information; 18 - Principal shareholders; 19 - Transactions with related parties; 20 - Financial information concerning assets, financial positions and financial performance; 21 - Additional information; 22 - Major contracts; 23 - Third party information, statements by experts and declarations of interest; 24 - Documents on display; 25 - Information on holdings; Appendix 1: report of the supervisory board chairman on the preparation and organization of the board's activities and internal control procedures; Appendix 2: statutory auditors' reports; Appendix 3: environmental report; Appendix 4: non-financial reporting methodology and independent third-party report on social, environmental and societal data; Appendix 5: ordinary and extraordinary general shareholders' meeting; Appendix 6: values charter; Appendix 7: table of concordance of the management report; glossaries

High mechanical performance of Areva upgraded fuel assemblies for PWR in USA

International Nuclear Information System (INIS)

Gottuso, Dennis; Canat, Jean-Noel; Mollard, Pierre

2007-01-01

operating environments, in high duty conditions and at extended burnups. AREVA's new family of upgraded products is offered to our customers worldwide. After first LFA's (Lead Fuel Assemblies) in Europe in 2006, and in the US in 2007, a first reload in a European 15x15 reactor will be loaded in 2007. This supply of upgraded products to our customers fully supports the more demanding requirements requested by utilities. The well proven characteristics of all components and their combination bring proven robustness to the products of AREVA's new family of fuel assemblies. (authors)

Joining the Nuclear Renaissance with the Engineering Business Unit of AREVA

Energy Technology Data Exchange (ETDEWEB)

Hubert, Nathalie; Menguy, Stephane [SGN, AREVA Group, 1 rue des Herons, 78182 Saint-Quentin en Yvelines Cedex (France); Valery, Jean-Francois [AREVA NC, AREVA Group, Tour AREVA, 1 place de la Coupole, 92084 Paris La Defense Cedex (France)

2008-07-01

The reality of the nuclear renaissance is no longer a question. All over the world, new nuclear plants are going to be deployed; the whole fuel cycle has to be adjusted to fulfil their needs, the front-end to produce the fuel and the back-end to properly manage radioactive waste. AREVA fuel cycle engineering teams have been involved in the design of a variety of industrial plants covering the entire fuel cycle for 50 years. The consistency of the French nuclear policy has been a major factor to acquire and renew the competencies and workforce of AREVA Engineering Business Unit. Our partnership with our customers, French ones but also Japanese, Americans and from other countries, has led us to develop a comprehensive approach of the services that we can deliver, in order to give them the best answer. SGN teams have been involved in the R and D phases in order to take into account the industrialisation aspects as early as possible, and our work does not end with the delivery of the plants; it includes assistance to the operators to optimise and keep their facilities in line with the changing rules and constraints, which ensures the integration of a wide operational experience feedback and the ability to design flexible facilities. This paper will present through our experience how this global approach has been developed and continuously improved and how we are preparing our teams to be ready to answer to the coming needs. (authors)

Joining the Nuclear Renaissance with the Engineering Business Unit of AREVA

International Nuclear Information System (INIS)

Hubert, Nathalie; Menguy, Stephane; Valery, Jean-Francois

2008-01-01

The reality of the nuclear renaissance is no longer a question. All over the world, new nuclear plants are going to be deployed; the whole fuel cycle has to be adjusted to fulfil their needs, the front-end to produce the fuel and the back-end to properly manage radioactive waste. AREVA fuel cycle engineering teams have been involved in the design of a variety of industrial plants covering the entire fuel cycle for 50 years. The consistency of the French nuclear policy has been a major factor to acquire and renew the competencies and workforce of AREVA Engineering Business Unit. Our partnership with our customers, French ones but also Japanese, Americans and from other countries, has led us to develop a comprehensive approach of the services that we can deliver, in order to give them the best answer. SGN teams have been involved in the R and D phases in order to take into account the industrialisation aspects as early as possible, and our work does not end with the delivery of the plants; it includes assistance to the operators to optimise and keep their facilities in line with the changing rules and constraints, which ensures the integration of a wide operational experience feedback and the ability to design flexible facilities. This paper will present through our experience how this global approach has been developed and continuously improved and how we are preparing our teams to be ready to answer to the coming needs. (authors)

Our energies have a future. A future without CO{sub 2}. Areva in 2005; Nos energies ont de l'avenir. Un avenir sans CO{sub 2}. Areva en 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This document is the sustainable development and 2005 annual report altogether of Areva group. It presents first the challenges of energy for economical development, the climate change threat and the sustainability of nuclear power in particular with respect to radioactive wastes management and power blackouts. Then follows a presentation of Areva's 10 commitments for sustainable development (governance and continuous improvement, financial performance, innovation, customer satisfaction, commitment to employees, risk management and prevention, environmental protection, dialogue and consensus building, community involvement). The annual report presents: the 2005 highlights, Areva around the world, key data, corporate governance, organisation of the group, share information and shareholder relations, business review (front end division, reactors and services division, back end division, transmission and distribution division), financial report and glossary. (J.S.)

Modeling and validating tritium transfer in a grassland ecosystem in response to {sup 3}H releases

Energy Technology Data Exchange (ETDEWEB)

Le Dizes, S. [Institute for Radioprotection and Nuclear Safety, IRSN/PRP-ENV/SERIS/LM2E, Centre de Cadarache, Saint-Paul-lez-Durance (France); Maro, D.; Rozet, M.; Hebert, D. [IRSN/PRP-ENV/SERIS/LRC, Cherbourg-Octeville (France)

2015-03-15

In this paper a radioecological model (TOCATTA) for tritium transfer in a grassland ecosystem developed on an hourly time-step basis is proposed and compared with the first data set obtained in the vicinity of the AREVA-NC reprocessing plant of La Hague (France). The TOCATTA model aims at simulating dynamics of tritium transfer in agricultural soil and plant ecosystems exposed to time-varying HTO concentrations in air water vapour and possibly in irrigation and rain water. In the present study, gaseous releases of tritium from the AREVA NC nuclear reprocessing plant in normal operation can be intense and intermittent over a period of less than 24 hours. A first comparison of the model predictions with the field data has shown that TOCATTA should be improved in terms of kinetics of tritium transfer.

Control and maintenance of the Superphenix knowledge and its specific sodium skills through an innovative partnership between EDF and AREVA

International Nuclear Information System (INIS)

Calais, Thomas; Rauber, Jean-Claude

2016-01-01

Superphenix is a 1200 MWe sodium cooled Fast Breeder Reactor (FBR) located in Creys-Malville (France). Its grid coupling occurred in 1986 and its final shutdown pronounced through a decree, 12 years later, in 1998. This Superphenix final shutdown decision marked a new stage in the life of the nuclear plant. Decommissioning activities were highly challenging due to the following: - Non recurrent and first-of-a-kind (FOAK) characteristics; - Environment constraints: radiation level, high temperatures, presence of argon, sodium, NaK, soda, hydrogen, etc.; - Complexity of the primary vessel internal structures; - Numerous interfaces to manage; - Numerous technical uncertainties due to the difficulty in anticipating the effective state of components (sodium and aerosols retentions, tritium concentration, NaK alteration, etc.). At the end of 1998, exchanges took place between EDF as 'Superphenix nuclear operator' and AREVA as 'Superphenix Nuclear Steam System Supply (NSSS) designer' in order to find the best way to meet the new challenge of decommissioning Superphenix. A key ingredient to achieving success was to ensure that existing local and specific sodium skills were controlled and maintained. AREVA was selected by EDF as its industrial partner for the sodium activities on this project being entrusted with the following missions: - Maintaining and adapting a strong EDF / AREVA partnership within the project duration; - Supplying support as the 'NSSS Designer'; - Rolling-out multidisciplinary skills from the design to the on-site operations; - Relying on its best technical experts to solve each technical challenge; - Developing and adapting durable specific skills of its technical team (sodium, mechanical, process, I and C, statutory, etc.) following each stage of the decommissioning. This EDF/AREVA partnership on the sodium activities has taken different forms according to the different stages of the project. From 1998 to 2005, AREVA was

AREVA modeling and predictive capacities to support PWR fuel assembly upgrading

International Nuclear Information System (INIS)

Canat, J. N.; Mollard, P.; Gentet, G.; Uyeda, G.

2008-01-01

The first goal of the fuel designer is to closely address the customers' expectations, with the aim of providing them in the shortest possible time a flawless product fully addressing their needs. However, the designer knows from experience that designing a new fuel assembly is a task which always lasts a long time. Depending on the extent and innovative dimension of the performed changes, development and qualification of new products have lasted from a few years to as much as roughly 15 years. Experience feedback proves that developing and qualifying a cladding material is the longest-term process, requiring the determination of its behavior laws under irradiation and also under accident conditions. Regarding fuel assembly structure, new development generally requires the irradiation of Lead Test Assemblies during a period of time representative of the fuel operating conditions. This explains the critical importance of high powered, top quality modeling to adequately support the fuel assembly design development and the behavior assessment. Advanced calculation codes and methods, improved modeling tools and test facilities, are key contributors to reinforced reliability, robustness, thermal hydraulic performance and maneuverability of nuclear fuel under ever more demanding operational conditions. Sophisticated, high powered modeling tools and representative test capacities are cutting the time necessary for AREVA to develop a new product, license it and load it in the core of a reactor. This trend towards greater modeling capability has been backed up by the upgrading of computing means over the last few years, allowing the consideration of a large number of factors and a higher accuracy in the representation of the modeled phenomena. This article details how predictive tools currently play a more and more important role in the design developments engaged by AREVA. They have led to a more physical approach to finding technical solutions and allowed their analytical

75 FR 16869 - Areva Enrichment Services, LLC; Establishment of Atomic Safety and Licensing Board

Science.gov (United States)

2010-04-02

... Enrichment Services, LLC; Establishment of Atomic Safety and Licensing Board Pursuant to delegation by the... following proceeding: Areva Enrichment Services, LLC (Eagle Rock Enrichment Facility) This Board is being established pursuant to a Notice of Hearing and Commission Order regarding the application of Areva Enrichment...

Areva - 2013 revenue of euro 9.3 bn thanks to sustained level of activity. Organic growth in the nuclear operations: + 7%, above our financial outlook. Backlog of euro 41.6 bn

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2014-01-01

Two years after Fukushima, AREVA's level of activity was especially strong in 2013. The group outperformed its revenue outlook for nuclear operations with an organic growth of 7.1%. With more than 9 billion euros, the group's revenue benefited from the robustness of the recurring activities and from temporary elements, such as exceptionally high uranium sales. This growth demonstrates the resilience of Areva's end market, despite unfavourable current conditions, and the efficient match between its commercial offers and customers' expectations. Capitalizing on this dynamic, the group will continue its recovery in order to sustainably self-finance its capital expenditures. After the announcement on January 20, 2014 of exclusive negotiations with Gamesa for the creation of a joint company in the offshore wind field (50% AREVA, 50% Gamesa), and in accordance with IFRS 5 accounting standard, revenue generated by the Wind Energy business is not included in group revenue for 2012 and 2013 and the result of this business will be presented on a separate line, 'net income from discontinued operations' in the 2013 financial statements. In 2013, AREVA had consolidated revenue of 9.303 billion euros, an increase of 3.8% (+6.3% like for like) compared with 2012 benefiting from strong organic growth in the nuclear operations: - Revenue in the nuclear operations was 9.042 billion euros in 2013, compared with 8.633 billion euros in 2012, a 7.1% increase (+4.7% on a reported basis). Revenue was led by the Mining BG (+40.6% like for like) and the Front End BG (+7.5% like for like), offsetting the expected business downturn in the Reactors and Services BG (-1.5% like for like). Revenue was stable in the Back End BG (-0.6% like for like). - The Renewable Energies BG had 132 million euros in revenue, down from 2012 (-24.7% like for like). - Foreign exchange had a negative impact of 101 million euros, while the change in consolidation scope and accounting methods had a negative impact of

Responsible Development On Areva's Mining Activities - Report 2014

International Nuclear Information System (INIS)

2015-01-01

Mining activities are the first link in the nuclear fuel cycle and in the integrated model of the Areva Group. Areva was one of the top producers worldwide in 2014, producing 8,959 metric tons of uranium. The group works to maintain resources and weighted reserves equivalent to 20 years of production at all times. Thanks to a presence spanning five continents, they ensure the long-term supply to customers of uranium for electricity production while maintaining a responsible attitude towards people and the environment. It has a diverse portfolio of both active mines (Canada, Kazakhstan and Niger) and mines under development (Africa). This document is Areva's Mining Activities responsible Development report for 2014. Content: profile (Overview, Keys events, Worldwide presence, Governance and Organization, Uranium market); CSR approach (Statement from the senior executive vice president, Risk management, Ethics and human rights, Voluntary initiatives, Materiality); Commitments (Health and radiation protection, Occupational safety, Environment and Biodiversity, Community involvement, Commitment to employees, After-mines, Innovation); Performance (Key indicators, Objectives of responsibility, Reporting parameters); Case Studies; Annexes (GRI Index)

Responsible Development On Areva's Mining Activities. Report 2015

International Nuclear Information System (INIS)

2016-01-01

Mining activities are the first link in the nuclear fuel cycle and in the integrated model of the Areva Group. Areva was one of the top producers worldwide in 2015, producing 11,002 metric tons of uranium. The group works to maintain resources and weighted reserves equivalent to 20 years of production at all times. Thanks to a presence spanning five continents, they ensure the long-term supply to customers of uranium for electricity production while maintaining a responsible attitude towards people and the environment. It has a diverse portfolio of both active mines (Canada, Kazakhstan and Niger) and mines under development (Africa). This document is Areva's Mining Activities responsible Development report for 2015. Content: profile (Overview, Keys events, Worldwide presence, Governance and Organization, Uranium market); CSR approach (Statement from the senior executive vice president, Risk management, Ethics and human rights, Voluntary initiatives, Materiality); Commitments (Health and radiation protection, Occupational safety, Environment and Biodiversity, Social involvement, Commitment to employees, Mining closure, Innovation); Performance (CSR objectives, Key indicators, Reporting parameters); Case Studies; Annexes (GRI Index)

AREVA Technical Days (ATD) session 3: operations of the reactors and services division, technical and economic aspects

International Nuclear Information System (INIS)

2003-01-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This third session deals with the reactors technologies basics, the EPR and SWR 1000 issues and outlook, the nuclear systems of the future, the business opportunities and business models. (A.L.B.)

New Areva (NewCo). Annual Activity Report - Period January 1 - August 31, 2017

International Nuclear Information System (INIS)

2017-01-01

The purpose of this management report is to present the situation of New Areva Holding (the 'Company') and its subsidiaries during the year from January 1 to August 31, 2017. The 'Group' or 'New Areva' designates the Group constituted by New Areva Holding and all of the subsidiaries and interests held directly or indirectly thereby. New Areva is also called NewCo in its financial communication pending a name change expected to be made in early 2018. Areva refers to Areva SA, the parent company of New Areva Holding. Content: 1 - Highlights of the year (Restructuring of the Areva group and creation of New Areva, Other highlights of the year) 2 - Situation and activities of the company and its subsidiaries during the past year (Simplified organization chart of the Group - Subsidiaries, associates and branch offices, The businesses of the Group, Research and development activities, Financial position of the Company and the Group during the past year, Foreseeable developments and future prospects, Significant events since the date of closing); 3 - Risks and risk management (Description of the main risks and uncertainties facing the Group, Company exposure to price, credit, liquidity and cash management risk, Risk management policy and the internal control system); 4 - Board of directors' corporate governance report (Preparation and organization of the Board of Directors' work, Committees set up by the Board of Directors, Other committee, Officers, Compensation of officers and directors, Reference Corporate Governance Code, General Meetings, Agreements covered by Article L. 225-37-4 of the French Commercial Code, Elements likely to have an impact in the event of a public offering); 5 - Corporate social responsibility information (Social, environmental and societal responsibility report (CSR), Key non-financial performance indicators related to the Company's specific activities); 6 - Information on share capital (Structure and

AREVA Technical Days (ATD) session 2: operations of the back-end of the nuclear fuel cycle

International Nuclear Information System (INIS)

2002-01-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This second session deals with the reprocessing business, back-end financing mechanisms, technology transfer, environmental management, risk management programs, research and development contribution to waste volume reductions, issues and outlook of nuclear wastes, comparison of the open and closed cycles. (A.L.B.)

EDF, AREVA, Alstom and the others: where is the problem?

International Nuclear Information System (INIS)

2011-01-01

After having recalled the context of the Messmer plan of 1974 according to which the roles of the different actors of the nuclear sector were clearly distributed, this article describes and comments the evolution of this context, notably after the N4 threshold has been reached: the French industry has lost many experts (they are retired), the concurrence has evolved as well as relationships between clients and providers. The article outlines that a new balance between the main actors is now needed. It comments the case of the EPR, the emergence of new PWR concepts, the different roles EDF, AREVA, GDF-Suez or Total may have depending on the project (they can be client, investor, or operator). Principles for a new strategy and operation for this sector and its actors are formulated

Our energies have a future. A future without CO2. Areva in 2005

International Nuclear Information System (INIS)

2005-01-01

This document is the sustainable development and 2005 annual report altogether of Areva group. It presents first the challenges of energy for economical development, the climate change threat and the sustainability of nuclear power in particular with respect to radioactive wastes management and power blackouts. Then follows a presentation of Areva's 10 commitments for sustainable development (governance and continuous improvement, financial performance, innovation, customer satisfaction, commitment to employees, risk management and prevention, environmental protection, dialogue and consensus building, community involvement). The annual report presents: the 2005 highlights, Areva around the world, key data, corporate governance, organisation of the group, share information and shareholder relations, business review (front end division, reactors and services division, back end division, transmission and distribution division), financial report and glossary. (J.S.)

Our energies have a future. A future without CO{sub 2}. Areva in 2005; Nos energies ont de l'avenir. Un avenir sans CO{sub 2}. Areva en 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This document is the sustainable development and 2005 annual report altogether of Areva group. It presents first the challenges of energy for economical development, the climate change threat and the sustainability of nuclear power in particular with respect to radioactive wastes management and power blackouts. Then follows a presentation of Areva's 10 commitments for sustainable development (governance and continuous improvement, financial performance, innovation, customer satisfaction, commitment to employees, risk management and prevention, environmental protection, dialogue and consensus building, community involvement). The annual report presents: the 2005 highlights, Areva around the world, key data, corporate governance, organisation of the group, share information and shareholder relations, business review (front end division, reactors and services division, back end division, transmission and distribution division), financial report and glossary. (J.S.)

Responsible Development of Areva's Mining Activities. Report 2011

International Nuclear Information System (INIS)

2012-09-01

After a presentation of the approach to responsibility adopted by AREVA to be a responsible mining stake holder (charter of values, implemented policies, risk prevention and management, best practices), this report gives an overview of mining activities (international presence, production in constant increase) with a focus on uranium mining which is the core business (the different phases are briefly presented: exploration, project development, mining, site decommissioning). It outlines personnel qualification and commitment, actions and policy in the field of personnel health and safety. It addresses the environmental policy: key levers, environmental management system, examples throughout the entire mining life cycle, changes in site consumptions and emissions, promotion of biodiversity. The next part concerns Areva's social commitment (dialogue, development aid in mining territories). Then, performance is expressed in terms of indicators for these different issues (teams, environmental policy, social involvement)

Commissioning of Nuclear Power Plants. The AREVA approach

International Nuclear Information System (INIS)

Mateo, G.

2014-01-01

Georges Mateo, Fellow Expert at AREVA, closed the last day of conferences by detailing deeply the different phases of NPPs commissioning. He insisted on the skills required to be a Commissioning engineer and on the carrier opportunities that it offers

AREVA Technical Days (ATD) session 1: Energy outlook and presentation of the Areva Group

International Nuclear Information System (INIS)

2002-01-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This first session deals with energy challenges and nuclear, public acceptance of nuclear power, mining activities, chemistry activities, enrichment activities, fuel assembly, reactors and services activities, nuclear measurements activities, reprocessing and recycling activities, logistics activities and connectors activities. (A.L.B.)

76 FR 11523 - Atomic Safety and Licensing Board; AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility...

Science.gov (United States)

2011-03-02

... and Licensing Board; AREVA Enrichment Services, LLC (Eagle Rock Enrichment Facility); Notice of... Governmental Entities Regarding Environmental Portion of Enrichment Facility Licensing Proceeding February 24.... White. In this 10 CFR part 70 proceeding regarding the request of applicant AREVA Enrichment Services...

Areva half-year report june 30, 2006; Areva rapport semestriel 30 juin 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

This document is the half-year financial report of the Areva group for 2006. It presents: 1 - Highlights of the period; 2 - Key data: Summary data, Segment reporting, Backlog, Income statement, Review by business division, Cash flow, Balance sheet data; 3 - Outlook; 4 - Events subsequent to the half-year end; 5 - Consolidated financial statements: Statutory auditors' report on the interim consolidated financial statements for the period January 1, 2006 to June 30, 2006, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of changes in equity, Segment reporting, Notes to the consolidated financial statements.

Areva half-year report June 30, 2008; Areva rapport semestriel 30 juin 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This document is the half-year financial report of the Areva group for 2008. It presents: 1 - the highlights of the period: key data (Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet data); Outlook; 2 - the events subsequent to half-year closing; 3 - the consolidated financial statements: Statutory Auditors' report on half-year 2008 information for the period January 1, 2008 to June 30, 2008, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of change in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2008.

Areva half-year report june 30, 2006; Areva rapport semestriel 30 juin 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

This document is the half-year financial report of the Areva group for 2006. It presents: 1 - Highlights of the period; 2 - Key data: Summary data, Segment reporting, Backlog, Income statement, Review by business division, Cash flow, Balance sheet data; 3 - Outlook; 4 - Events subsequent to the half-year end; 5 - Consolidated financial statements: Statutory auditors' report on the interim consolidated financial statements for the period January 1, 2006 to June 30, 2006, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of changes in equity, Segment reporting, Notes to the consolidated financial statements.

AREVA NP Liner Repair Strategy with Adhesive Technology

International Nuclear Information System (INIS)

Georg, Kraemer; Revoirard, Sebastien; McCann, James-E.

2012-09-01

AREVA has developed a repair method for sealing leakages in austenitic stainless steel liners, especially in nuclear power plants. This technology is either a repair, when applied after failures already occurred, or a prophylaxis, when applied before failures occurred. Leakages of stainless steel pool liners can be classified into basically four mechanisms: Mechanical impact, mechanical stress, weld failures and corrosion. Damage from mechanical impact like dropping tools or equipment can be usually recognized and localized immediately. In such situations no extensive leak detection needs to be performed. Contrary to the mechanical damage, it is more difficult to localize damages due to mechanical stress, such as load changes or thermal stress. Load changes occur when a stainless steel pool is repeatedly filled and drained, thermal stress occurs when a pool is exposed to temperature gradients. Those two preconditions are given in reactor cavities (RC). Mechanical stress usually promotes other pre-existing defects. According to the experience of AREVA the weld failures are not a common root cause for leakages, found after several years of operation. They are due to the standard testing procedure in which all weld seams are checked (with e.g. Penetrate Testing (PT) for example). If failures are detected, they are repaired during the commissioning. The main root cause for leakages found after several years of operation is corrosion. Corrosion failures themselves are mainly caused by stress corrosion cracking (SCC). SCC needs certain preconditions to initiate: Mechanical stress must exist; a corrosion initiating element (e.g. chlorine) above a limiting concentration is necessary as well as a heat affected zone (HAZ). In the HAZ, which is exists near weld seams, the microstructure of the stainless steel has changed. This leads to a higher susceptibility to SCC. Those preconditions for SCC cannot be found at the front side of the liner (water side), because the water

Areva T and D market opportunities after the US and EU Blackouts

Energy Technology Data Exchange (ETDEWEB)

Hakansson, K

2004-02-01

This document presents the events on the transmission systems during August 2003 in Usa and in September 2003 in Italy. The author analyzes the causes of the blackouts (small margins in transmission system, not adequate control, weaknesses in interconnections between regions), the market opportunity arising out of the blackouts, the economic regulatory and environmental structure/issues today and developments, the scenario for Areva after the blackout (the market size today and in the future) and Areva strength in relation to blackout. (A.L.B.) opportunities.

Areva T and D market opportunities after the US and EU Blackouts

International Nuclear Information System (INIS)

Hakansson, K.

2004-02-01

This document presents the events on the transmission systems during August 2003 in Usa and in September 2003 in Italy. The author analyzes the causes of the blackouts (small margins in transmission system, not adequate control, weaknesses in interconnections between regions), the market opportunity arising out of the blackouts, the economic regulatory and environmental structure/issues today and developments, the scenario for Areva after the blackout (the market size today and in the future) and Areva strength in relation to blackout. (A.L.B.) opportunities

The AREVA's waste management strategy

International Nuclear Information System (INIS)

Poncet, Ph.

2011-01-01

In accordance with its policy of sustainable development and continuous progress, AREVA is permanently seeking to reduce the impact of the management of its waste, of whatever type, and its radioactive waste in particular. This goal is taken into consideration very early in industrial projects and concerns all the phases in the life of the installations and all the activities of the Group. The resulting actions aim to guarantee that an exhaustive inventory is made of the radioactive materials and waste, to optimise how they are characterised, to ensure their traceability and to determine the best management methods. Past and future progress relies primarily on the effectiveness of zoning (in particular the concept of radiological cleanness), how work is organized, the account taken of operating experience feedback, the search for recycling solutions or appropriate removal routes, optimisation of waste storage and, whenever possible, online processing, plus of course the professionalism of all those involved. A participatory approach by the Group will enable the focus areas and required actions to be defined: networks and multidisciplinary working groups, whenever possible in association with other stake-holders or partners from the nuclear industry. (author)

Areva in 2007, growth and profitability

International Nuclear Information System (INIS)

2007-01-01

This annual report 2007, presents the AREVA Group activities during the year. It contents the messages of the Chairman and Chief executive officer, the solutions offered by the group for CO 2 free power generation and reliable electricity transmission and distribution, the governance, the financial performance, the innovation, the environmental protection, the risk management and prevention, the audit's report and key data for the year 2007. (A.L.B.)

76 FR 9054 - Notice of Availability of Final Environmental Impact Statement for the AREVA Enrichment Services...

Science.gov (United States)

2011-02-16

... Statement for the AREVA Enrichment Services LLC Proposed Eagle Rock Enrichment Facility in Bonneville County... published the Final Environmental Impact Statement (EIS) for the AREVA Enrichment Services LLC (AES) Proposed Eagle Rock Enrichment Facility (EREF). On December 30, 2008, AES submitted a license application...

77 FR 55800 - Foreign-Trade Zone 242-Boundary County, ID; Application for Subzone AREVA Enrichment Services...

Science.gov (United States)

2012-09-11

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-68-2012] Foreign-Trade Zone 242--Boundary County, ID; Application for Subzone AREVA Enrichment Services, LLC; Bonneville County, ID An application... FTZ 242, requesting special-purpose subzone status for the facility of AREVA Enrichment Services, LLC...

Areva fatigue concept. Fast fatigue evaluation, a new method for fatigue analysis

International Nuclear Information System (INIS)

Heinz, Benedikt; Bergholz, Steffen; Rudolph, Juergen

2011-01-01

Within the discussions on the long term operation (LTO) of nuclear power plants the ageing management is on the focus of that analysis. The knowledge of the operational thermal cyclic load data on components of the power plants and their evaluation in the fatigue analysis is a central concern. The changes in fatigue requirements (e.g. the consideration of environmentally assisted fatigue - EAF) recently discussed and LTO efforts are a strong motivation for the identification of margins in the existing fatigue analysis approaches. These margins should be considered within new approaches in order to obtain realistic (or more accurate) analysis results. Of course, these new analysis approaches have to be manageable and efficient. The Areva Fatigue Concept (AFC) offers the comprehensive conceptual basis for the consideration of fatigue on different levels and depths. The combination of data logging and automated fatigue evaluation are important modules of the AFC. Besides the established simplified stress based fatigue estimation Areva develops a further automated fatigue analysis method called Fast Fatigue Evaluation (FFE). This method comprises highly automated stress analyses at the fatigue relevant locations of the component. Hence, a component specific course of stress as a function of time is determined based on FAMOS or similar temperature measurement systems. The subsequent application of the rain flow cycle counting algorithm allows for the determination of the usage factor following the rules of the design code requirements. The new FFE approach constitutes a cycle counting method based on the real stresses in the component, and determined as result a rule-conformity cumulative usage factor. (orig.)

Remarks on the Cogema-Areva project of storage of contaminated sludge and sediments on the Bellezane site (Haute-Vienne). Investigation performed by the CRIIRAD laboratory on its own funds

International Nuclear Information System (INIS)

2006-06-01

As sediments of several lakes are contaminated by uranium mines which are located upstream, and which have been exploited in the past by the Cogema (now Areva NC), this company asked for an authorization to use an old pit in Bellezane to deposit clearing sludge from water processing plants and from the clearing of ponds. This document describes the different problems raised by this project. It outlines that the site is not waterproof and that its legal status is not correct. It also reports and comments the radiological contamination of waters and soils due to site effluents, the chemical contamination of waters, and the existence of solid radioactive wastes at the vicinity of this site

Areva reached its objectives in 2002

International Nuclear Information System (INIS)

Anon.

2003-01-01

In 2002 the turnover of the Areva group has fallen by 7,1 % from 8,90 milliard euros in 2001 to 8,26 milliard euros. This fall breaks up into -3,6 % for the nuclear sector and -20,7 % for connector engineering. The sharp drop for connector engineering is not surprising and is attributed to the fact that in 2002 there was no revival of business in the market of communication equipment. (A.C.)

Status of safety at Areva group facilities. 2006 annual report

International Nuclear Information System (INIS)

2006-01-01

This report presents a snapshot of nuclear safety and radiation protection conditions in the AREVA group's nuclear installations in France and abroad, as well as of radiation protection aspects in service activities, as identified over the course of the annual inspections and analyses program carried out by the General Inspectorate in 2006. This report is presented to the AREVA Supervisory Board, communicated to the labor representation bodies concerned, and made public. In light of the inspections, appraisals and coordination missions it has performed, the General Inspectorate considers that the nuclear safety level of the AREVA group's nuclear installations is satisfactory. It particularly noted positive changes on numerous sites and efforts in the field of continuous improvement that have helped to strengthen nuclear safety. This has been possible through the full involvement of management teams, an improvement effort initiated by upper management, actions to increase personnel awareness of nuclear safety culture, and supervisors' heightened presence around operators. However, the occurrence of certain events in facilities has led us to question the nuclear safety repercussions that the changes to activities or organization on some sites have had. In these times of change, drifts in nuclear safety culture have been identified. The General Inspectorate considers that a preliminary analysis of the human and organizational factors of these changes, sized to match the impact the change has on nuclear safety, should be made to ensure that a guaranteed level of nuclear safety is maintained (allowance for changes to references, availability of the necessary skills, resources of the operating and support structures, etc.). Preparations should also be made to monitor the changes and spot any telltale signs of drift in the application phase. Managers should be extra vigilant and the occurrence of any drift should be systematically dealt with ahead of implementing

The use of nuclear data in the field of nuclear fuel recycling

Directory of Open Access Journals (Sweden)

Martin Julie-Fiona

2017-01-01

Full Text Available AREVA NC La Hague facility is the first step of the nuclear fuel recycling process implemented in France. The processing of the used fuel is governed by high standards of criticality-safety, and strong expectations on the quality of end-products. From the received used fuel assemblies, the plutonium and the uranium are extracted for further energy production purposes within the years following the reprocessing. Furthermore, the ultimate waste – fission products and minor actinides on the one hand, and hulls and end-pieces on the other hand – is adequately packaged for long term disposal. The used fuel is therefore separated into very different materials, and time scales which come into account may be longer than in some other nuclear fields of activity. Given the variety of the handled nuclear materials, as well as the time scales at stake, the importance given to some radionuclides, and hence to the associated nuclear data, can also be specific to the AREVA NC La Hague plant. A study has thus been led to identify a list of the most important radionuclides for the AREVA NC La Hague plant applications, relying on the running constraints of the facility, and the end-products expectations. The activities at the AREVA NC La Hague plant are presented, and the methodology to extract the most important radionuclides for the reprocessing process is detailed.

The use of nuclear data in the field of nuclear fuel recycling

Science.gov (United States)

Martin, Julie-Fiona; Launay, Agnès; Grassi, Gabriele; Binet, Christophe; Lelandais, Jacques; Lecampion, Erick

2017-09-01

AREVA NC La Hague facility is the first step of the nuclear fuel recycling process implemented in France. The processing of the used fuel is governed by high standards of criticality-safety, and strong expectations on the quality of end-products. From the received used fuel assemblies, the plutonium and the uranium are extracted for further energy production purposes within the years following the reprocessing. Furthermore, the ultimate waste - fission products and minor actinides on the one hand, and hulls and end-pieces on the other hand - is adequately packaged for long term disposal. The used fuel is therefore separated into very different materials, and time scales which come into account may be longer than in some other nuclear fields of activity. Given the variety of the handled nuclear materials, as well as the time scales at stake, the importance given to some radionuclides, and hence to the associated nuclear data, can also be specific to the AREVA NC La Hague plant. A study has thus been led to identify a list of the most important radionuclides for the AREVA NC La Hague plant applications, relying on the running constraints of the facility, and the end-products expectations. The activities at the AREVA NC La Hague plant are presented, and the methodology to extract the most important radionuclides for the reprocessing process is detailed.

The nuclear renaissance and AREVA's reactor designs for the 21st century. EPR and SWR-1000

International Nuclear Information System (INIS)

Stosic, Z.V.

2007-01-01

Hydro and nuclear energy are the most environmentally benign way of producing electricity on a large scale. Nuclear generated electricity releases 38 times fewer greenhouse gases than coal, 27 times fewer than oil and 15 times fewer than natural gas [9]. On a global scale nuclear power annually saves about 10% of the global CO 2 emission. European nuclear power plants save amount of CO 2 emissions corresponding with the annual emission of CO 2 from all European passenger cars [16]. Also, that is approximately twice the total estimated quantity to be avoided in Europe under the Kyoto Protocol during the period 2008-2012. In respect to main drivers - such as concerns of the global warming effect, population growth, and future energy supply shortfall, low operating costs, reduced dependence on imported gas - it is clear that 30 new nuclear reactors currently being constructed in 11 countries and another 35 and more planed during next 10 years confirm the nuclear renaissance. Participation in the construction of 100 reactors out of 443 worldwide operated in January 2006 and supplying fuel to 148 of them AREVA helps meet the 21 st century's greatest challenges: making energy available to all, protecting the planet, and acting responsibly towards future generations. With EPR and SWR-1000, AREVA NP has developed advanced design concepts of Generation III+ nuclear reactors which fully meet the most stringent requirements in terms of nuclear safety, operational reliability and economic performance. (author)

AREVA Technical Days (ATD) session 3: operations of the reactors and services division, technical and economic aspects; AREVA Technical Days (ATD) session 3: les activites du pole reacteurs et services, aspects techniques et economiques

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-07-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This third session deals with the reactors technologies basics, the EPR and SWR 1000 issues and outlook, the nuclear systems of the future, the business opportunities and business models. (A.L.B.)

76 FR 34103 - In the Matter of Areva Enrichment Services, LLC (Eagle Rock Enrichment Facility); Notice of...

Science.gov (United States)

2011-06-10

.... 10-899-02-ML-BD01] In the Matter of Areva Enrichment Services, LLC (Eagle Rock Enrichment Facility...'' portion of this proceeding regarding the December 2008 application by AREVA Enrichment Services, LLC (AES... gas centrifuge uranium enrichment facility--denoted as the Eagle Rock Enrichment Facility (EREF)--in...

AREVA Technical Days (ATD) session 2: operations of the back-end of the nuclear fuel cycle; AREVA Technical Days (ATD) session 2: les activites du pole Aval du cycle du combustible nucleaire

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This second session deals with the reprocessing business, back-end financing mechanisms, technology transfer, environmental management, risk management programs, research and development contribution to waste volume reductions, issues and outlook of nuclear wastes, comparison of the open and closed cycles. (A.L.B.)

Press kit. Cooperation between Areva and South Africa in the nuclear energy field

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-07-01

This document presents the nuclear industry business developed by Areva in South Africa. The first part offers general information on the country (political context, economy which fuels African growth, social situation and South Africa in search of sustainable development). An other part deals with the electricity supply (predominance of coal and the issue of global warming, electricity for everyone. The last parts detail the nuclear energy development (the new PBMR reactor project, the exploitation of all nuclear technology) and how Areva consolidates its presence in South Africa. (A.L.B.)

Treatment of Fukushima contaminated waters TEPCO selected Areva and Veolia solution

International Nuclear Information System (INIS)

Seberac, Philippe; Paillard, Herve; Thierry, Jean-Marie; Bae, Ho-Il; Prevost, Thierry; Piot, Gregoire; Bertrand Ytournel

2012-09-01

The Actiflo-Rad TM system successfully contributed to treat the contaminated wastewaters from the damaged Fukushima Daiichi nuclear power plant. The decontamination system jointly designed by AREVA and Veolia Water treated about 77 500 m 3 of high activity wastewater (∼10 6 Bq/cm 3 ), combining radionuclides adsorbents developed by AREVA and the know-how of Veolia in water treatment for the settlement of the adsorbed radioactive elements, producing sludge with a weight concentration of 80 g/L. Both companies delivered the treatment facility quickly with an efficient joint organization - in a very complex environment. Assembled on Fukushima site - badly damaged by the tsunami following the earthquake of March 11 th - the system was designed, built and started in a record time of 2 month 1 / 2 , instead of several years in a classical nuclear engineering project. The Actiflo-Rad TM was a key equipment to achieve a stable situation of reactors, allowing treated water to be reused for core cooling. Commissioned with the on-site support of Veolia experts, the system reduced by 10 000 the Cs-activity of the wastewater even with significant salt content (seawater diluted twice) at a flow-rate slightly below the design value of 50 m 3 /hr. The implemented technologies are already used separately on AREVA sites (la Hague, fuel reprocessing plant) and for many water treatment projects by Veolia all over the world (Actiflo TM and Multiflo TM processes, using lamellar settling devices - in addition, the first one making use of micro-sand for a better floc quality). The complete treatment process selected by TEPCO features a physico-chemical treatment and water desalination, in five steps. After de-oiling, wastewater is primarily decontaminated through zeolite columns (Kurion process). This pre-decontaminated water is then treated on the AREVA-Veolia two stages system; at each stage, more than 30 minutes contact time with radionuclides adsorbents is needed, adsorbed

Areva. 2007 figures economic, social, societal and environmental data; Areva. Chiffres 2007 donnees economiques, sociales, societales et environnementales

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This document presents the 2007 economic, social, societal and environmental data of the Areva Group. Content: 1 - Improvement initiative: Continuous improvement, Innovation; 2 - Financial performance: 2007 results; 3 - Commitment to employees: Stakeholder relations, Health and safety, Radiation protection, Radiological impacts, Technological risks, Workforce, Workforce and training; 4 - Environment: Water, Energy, Gaseous releases, Liquid releases, Conventional waste, Radioactive waste; 5 - Reporting and performance indicators: Reporting methodology, Auditors' report, Social indicators, Environmental indicators.

Development of STEP-NC Adaptor for Advanced Web Manufacturing System

Science.gov (United States)

Ajay Konapala, Mr.; Koona, Ramji, Dr.

2017-08-01

Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

Cooperation agreement between the Technical University Dresden and AREVA NP GmbH

International Nuclear Information System (INIS)

Hurtado, A.; Hansen, V.; Druschel, R.; Heyer, J.

2008-01-01

As a result of the complete refurbishment of the Technical University Dresden (TUD) training reactor AKR and its equipment with the digital safety system TELEPERM XS by AREVA NP it is actually the most advanced facility in this category in Germany. Following the positive experience gained during project execution an agreement between AREVA NP and TUD was signed to bundle each organizations competence's in the interest of new recruits in the field of nuclear technology in 2006. The content and the experience with the cooperation are described in this paper. Conclusions show that both parties found an attractive way to support fellow young nuclear engineers. (authors)

Logistics of the research reactor fuel cycle: AREVA solutions

International Nuclear Information System (INIS)

Ohayon, David; Halle, Laurent; Naigeon, Philippe; Falgoux, Jean-Louis; Franck Obadia, Franck; Auziere, Philippe

2005-01-01

The AREVA Group Companies offer comprehensive solutions for the entire fuel cycle of Research Reactors comply with IAEA standards. CERCA and Cogema Logistics have developed a full partnership in the front end cycle. In the field of uranium CERCA and Cogema Logistics have the long term experience of the shipment from Russia, USA to the CERCA plant.. Since 1960, CERCA has manufactured over 300,000 fuel plates and 15,000 fuel elements of more than 70 designs. These fuel elements have been delivered to 40 research reactors in 20 countries. For the Back-End stage, Cogema and Cogema Logistics propose customised solutions and services for international shipments. Cogema Logistics has developed a new generation of packaging to meet the various needs and requirements of the Laboratories and Research Reactors all over the world, and complex regulatory framework. Comprehensive assistance dedicated, services, technical studies, packaging and transport systems are provided by AREVA for every step of research reactor fuel cycle. (author)

Change-management. From commercial power operation to post power operation and decommissioning

International Nuclear Information System (INIS)

Wasinger, Karl

2015-01-01

Transition from power generation to decommissioning challenges utilities. Power generation is mainly characterized by a stable working environment and constant workload, decommissioning and dismantling, however, by transformation and change. Also, changing requirements for the workforce's skills challenge the organization and its senior management. Ensuring effective and efficient performance, while maintaining motivation of staff, requires adjustment of management processes as well as of operational organization and human resources management. AREVA has more than 20 years of experience in decommissioning of own nuclear fuel cycle plants in France, as well as of other large plants and power reactors in Germany, the United Kingdom and the US. Therefore, the group has developed and successfully implemented integrated change management processes. The implementation of well-established and proven methods, developed by the productive industry and adjusted to the nuclear regulatory requirements, significantly improves the performance and efficiency of means and methods in use. The AREVA Performance Improvement Process defines concrete approaches to identify and improve potential deficits of productivity in six main areas (decommissioning scenarios and stra-tegies, waste treatment and logistics, operations management, supply chain, regulatory monitoring and controls as well as dismantling operation). Nuclear plant and facility owners around the world benefit from AREVA experts well experienced in execution of large and complex decommissioning projects.

Status of safety in nuclear facilities - 2012. AREVA General Inspectorate Annual report

International Nuclear Information System (INIS)

2013-05-01

After a message from the Areva's Chief Executive Officer and a message from the senior Vice President of safety, health, security, sustainable development, a text by the inspector general comments the key safety results (events, dose levels, radiological impacts), the inspection findings, the areas of vigilance (relationship with the ASN, the management of the criticality risk, and facility compliance), some significant topics after the Fukushima accident. Then this report addresses the status of nuclear safety and radiation protection in the group's facilities and operations. It more specifically addresses the context and findings (lessons learned from the inspections, operating experience from event, employee radiation monitoring, environmental monitoring), crosscutting processes (safety management, controlling facility compliance, subcontractor guidance and management, crisis management), specific risks (criticality risk, fire hazards, transportation safety, radioactive waste management, pollution prevention, liability mitigation and dismantling), and areas for improvement and outlook

Areva. Nine-month 2007 sales revenue and data

International Nuclear Information System (INIS)

2007-10-01

The main information concerning the nine-month 2007 financial data of the Areva group is a steady growth of 9-month sales revenue, at euro 8.066 billion (+6.8% like-for-like), including euro 2.692 billion in the 3. quarter, i.e. +7.6% like-for-like. The group confirms its strong sales revenue growth objective for 2007

Areva half-year report june 30, 2007; Areva rapport semestriel 30 juin 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

Information provided in this document concerns the AREVA group as a whole. It presents the highlights and Key data of the first half of 2007, the outlook, the events subsequent to half-year closing, and the Consolidated financial statements. Contents: 1 - Highlights of the period; 2 - Key data: Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet data; 3 - Outlook; 4 - Events subsequent to half-year closing; 5 - Consolidated financial statements: Statutory Auditors' report on half-year information for the period January 1, 2007 to June 30, 2007, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of change in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2007.

Feeding the nuclear fuel cycle with a long term view; AREVA's front-end business units, uranium mining, UF6 conversion and isotopic enrichment

International Nuclear Information System (INIS)

Capus, G.A.P.; Autegert, R.

2005-01-01

As a leading provider of technological solutions for nuclear power generation and electricity transmission, the AREVA group has the unique capability of offering a fully integrated fuel supply, when requested by its customers. At the core of the AREVA group, COGEMA Front End Division is an essential part of the overall fuel supply chain. Composed of three Business Units and gathering several subsidiaries and joint 'ventures, this division enjoys several leading positions as shown by its market shares and historical production records. Current Uranium market evolutions put the natural uranium supply under focus. The uranium conversion segment also recently revealed some concerning evolutions. And no doubt, the market pressure will soon be directed also at the enrichment segment. Looking towards the long term, AREVA strongly believes that a nuclear power renewal is needed, especially to help limiting green house effect gas release. Therefore, to address future supplies needed to fuel the existing fleet of nuclear power plants, but also new ones, the AREVA group is planning very significant investments to build new facilities in all the three front-end market segments. As far as uranium mining is concerned, these new mines will be based upon uranium reserves of outstanding quality. As for uranium conversion and enrichment, two large projects will be based on the most advanced technologies. This paper is aimed at recalling COGEMA Front End Division experience, the current status of its plants and operating entities and will provide a detailed overview of its major projects. (authors)

AREVA 10x10 BWR fuel experience feedback and on going upgrading

International Nuclear Information System (INIS)

Lippert, Hans Joachim; Rentmeister, Thomas; Garner, Norman; Tandy, Jay; Mollard, Pierre

2008-01-01

Established with engineering and manufacturing operations in the US and Europe, AREVA NP has been and is supplying nuclear fuel assemblies and associated core components to boiling water reactors worldwide, representing today more than 63 000 fuel assemblies. The evolution of BWR fuel rod arrays from early 6x6 designs to the 10x10 designs first introduced in the mid 1990's yielded significant improvements in thermal mechanical operating limits, critical power level, cold shutdown margin, discharge burnup, as well as other key operational capabilities. Since first delivered in 1992, ATRIUM T M 1 0 fuel assemblies have now been supplied to a total of 32 BWR plants in the US, Europe, and Asia resulting in an operating experience over 20 000 fuel assemblies. This article presents in detail the operational experience consolidated by these more than 20 000 ATRIUM T M 1 0 BWR assemblies already supplied to utilities. Within the different 10x10 fuel assemblies available, the Fuel Assembly design is chosen and tailored to the operating strategies of each reactor. Among them, the latest versions of ATRIUM T M a re ATRIUM T M 1 0XP and ATRIUM T M 1 0XM fuel assemblies which have been delivered to several utilities worldwide. The article details key aspects of ATRIUM T M 1 0 fuel assemblies in terms of reliability and performance. Special attention is paid to key proven features, ULTRAFLOW T M s pacer grids, the use of part length fuel rods (PLFRs) and their geometrical optimization, water channel and load chain, upgraded features available for inclusion with most advanced designs. Regular upgrading of the product has been made possible thanks to a continuous improvement process with the aim of further upgrading BWR fuel assembly performance and reliability. Regarding thermal mechanical behavior of fuel rods, chromia (Cr2O3) doped fuel pellets, described in Reference 1, well illustrate this improvement strategy to reduce fission gas release, increase power thresholds for PCI

GAIA: AREVAs New PWR fuel assembly design

Energy Technology Data Exchange (ETDEWEB)

Vollmert, N.; Gentet, G.; Louf, P.H.; Mindt, M.; O' Brian, J.; Peucker, J.

2015-07-01

GAIA is the label of a new PWR Fuel Assembly design developed by AREVA with the objective to provide its customers an advanced fuel assembly design regarding both robustness and performance. Since 2012 GAIA lead fuel assemblies are under irradiation in a Swedish reactor and since 2015 in a U.S. reactor. Visual inspections and examinations carried out so far during the outages confirmed the intended reliability, robustness and the performance enhancement of the design. (Author)

33 CFR 334.410 - Albemarle Sound, Pamlico Sound, and adjacent waters, NC; danger zones for naval aircraft operations.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Albemarle Sound, Pamlico Sound... AND RESTRICTED AREA REGULATIONS § 334.410 Albemarle Sound, Pamlico Sound, and adjacent waters, NC; danger zones for naval aircraft operations. (a) Target areas—(1) North Landing River (Currituck Sound...

RIP studies at AREVA: R&D and applications for Niger and Canada projects

International Nuclear Information System (INIS)

Ling, Y.; Durupt, N.; Banton, N.

2010-01-01

Cominak in Niger owns a large stock of high grade fines which cumulated originally from underground mining discharge water. This ore is too fine to be treated with the current process because it readily blocks the cloths of the belt filters. Cominak plans to build a Resin-In-Pulp (RIP) plant. The RIP technology permits to recover U values without filtration. Some bench scale studies (at AREVA-SEPA) and two trial campaigns (on site) had been successfully conducted to implement the RIP process, which further allows, from economic point of view, a positive feasibility evaluation. As part of the Kiggavik Project managed by Areva Resources Canada (ARC), AREVA-SEPA is also being actively involved in developing a practical, cost-effective and environmentally sound process flowsheet. RIP technology has drawn significant attention due to the relatively low water consumption and capital cost. SEPA's experience with RIP technology together with the newer and better-performance resins makes this technology a viable choice. Three pilot campaigns have been accomplished at SEPA, which is believed to be of great help to reduce technical risk as well as capital risk in the decision making for Kiggavik project. (author)

AREVA: from speech to reality / The example uranium mines in Niger

International Nuclear Information System (INIS)

2008-01-01

This document presents the activities of AREVA in Niger in the field of uranium production on different sites. It recalls the interventions by the CRIIRAD in support of a local NGO, the reactions of AREVA and some means of intimidation used by this company. It outlines, criticizes and discusses the contamination of water resources and, therefore their degradation, the contamination of air by radioactive dusts and gases from the production sites, the retailing of contaminated scrap metals, and the dispersal of radioactive materials in the environment (including a hospital), and also the outdoor storage of radioactive materials. It mentions some accidents which occurred during radioactive material transport, relates uranium exploitation with the greenhouse gas effect. It stresses that public hygiene is insufficient. It discusses the current prospecting works, and finally identifies guarantees to be obtained and urgent actions to be undertaken

AREVA presents its 2016-2020 road-map and announces the group's restructuring through the creation of a new entity refocused on the nuclear fuel cycle

International Nuclear Information System (INIS)

2016-01-01

In line with the announcements made in February 2016, for the publication of its 2015 annual results, AREVA confirms its plan to restructure the group and to create a separate entity refocused on the nuclear fuel cycle, currently named 'NEW CO'. In this press release, the group presents its 2016-2020 road-map, centered on the stages foreseen for its strategic and operational refocusing plan, and its financial objectives for 2020. Pursuant to strategic choices concerning the nuclear industry, the road-map specifies the conditions for the transfer of AREVA's reactor-related operations to EDF and the refocusing of the group on fuel cycle management. Thus dissociated and simplified in their organizations, AREVA and NEW CO will each benefit from a capital increase in the combined amount of 5 billion euros (subject to the approval of the European Commission) and will have resources suited to their mission and their strategy. By means of the solutions it can provide for uranium supply, for its conversion into fuel, and for nuclear fuel recycling, waste management and dismantling, NEW CO will be in a good position to grow in global nuclear markets. The strengthened capital structure, the new industrial plants, and the reinforcement of NEW CO's technology and innovation base will underpin this strategy

AREVA first half 2007 sales revenue

International Nuclear Information System (INIS)

2007-01-01

The AREVA group's backlog as of June 30, 2007 was euros 33.5 billion, up 31% compared with that of December 31, 2006. On average, the Group's backlog increased by more than 20% annually over the last three years. It is now at the highest level since AREVA was established in 2001. All divisions contributed to this performance: - The Front End division signed in particular a major enrichment contract with KHNP (South Korea), a fuel supply contract with EDF covering the 2008-2012 period and other significant contracts with Japanese and Swedish utilities. - The Reactors and Services division added the Flamanville 3 EPR, ordered by EDF, to the backlog. Flamanville 3 is AREVA's 100. reactor order. - The Back End division also concluded a major contract with Sogin to treat used fuel stored at Italian nuclear sites. - The Transmission and Distribution division continued to record strong growth. New orders were up 24% compared with the first half of 2006 (+25.1% like-for-like). Important contracts were signed in the Middle East, Russia and with large industrial users of electricity. First half 2007 sales revenue was up 6.7% (+6.4% like-for-like) to euros 5373 million, compared with euros 5036 million for the first half of 2006. Major developments in the first half of 2007 include: - Sales revenue was down 2.8% to euros 1342 million in the Front End division (-3.6% like-for- like) due to uneven distribution of deliveries in the Fuel business unfavorable during the period. This timing issue has no impact on projected annual growth. The division continues to benefit from a gradual price increase for long-term uranium supply contracts. - Sales revenue was up 4.8% to euros 1154 million in the Reactors and Services division (+3% like-for-like). The Services business unit, especially, was a major contributor to growth on all its markets after a 2006 fiscal year marked by a weak demand. The start of construction of a second EPR reactor for EDF, Flamanville 3, also contributed to

Mortality of workers in a factory of uranium conversion in France: situation of the follow up from 1968 to 2005

International Nuclear Information System (INIS)

Guseva Canu, I.; Metz, C.; Tirmarche, M.; Caer, S.; Auriol, B.

2008-01-01

A cohort of workers of Areva NC of Pierrelatte was constituted to study the effects of the internal irradiation after the incorporation of uranium. Between 1960 and 1996, this establishment provided the uranium hexafluoride enrichment and since 1982, the chemical conversion of the different compounds of yellow cake. The cohort descriptive and the results of mortality are reported. The cohort presents a a good follow up (zero lost sight people) of workers potentially exposed to uranium. Its mortality is similar to this one of other workers (at Areva NC). The effect of the sane worker is important, due essentially to the selection of workers at hiring. The employments-exposures matrix at Pierrelatte will allow to study the effects of exposure on the mortality by cancer. (N.C.)

Areva, Chalon/St-Marcel site, Environment, social and societal report for 2010-2011

International Nuclear Information System (INIS)

2012-08-01

After a brief indication of Areva's activities and a map locating Areva's implantations, and the distribution of turnover and personnel in the different continents, a brief recall of safety commitments, and a presentation of the activity of the Reactors and Services Business Group (turnover, personnel, number of reactors in charge), this report briefly presents the different AREVA sites in Burgundy, and more precisely the Chalon/St-Marcel site which comprises a technical centre and a plant of production of heavy components. The activities of the technical centre concern welding technology, nuclear fusion, corrosion and chemistry, fluid and structure mechanics, and technologies related to the development of new energies and to the environment. Fields of intervention and clients are evoked. The activity of the plant of production of heavy components (vapor generators, pressurizers, vessels, etc.) and some characteristics of these components are presented. The environmental aspect is then addressed: evolution of resource consumption (gas, water, electricity, paper), and of releases (greenhouse gases, used waters, waste management). The social aspect comprises social relationships, health (involved actors, prevention, safety, evolution of labour accidents), ability and job management (training, career management, education). The societal commitments have been acknowledged by several labels related to social inclusion and local activities, support of sporting and cultural activities

NucLab Marcoule. A laboratory facility dedicated to support dismantling operations

International Nuclear Information System (INIS)

Dugne, O.; Houssin, A.; Pierre, D.; Bec-Espitalier, L.

2013-06-01

Formerly dedicated to plutonium production support, NucLab was renovated to perform a wide range of analyses for dismantling, plant operation and process development activities mainly on Marcoule site but also outside (Veurey, Fontenay aux Roses). The Laboratory is under a CEA AREVA partnership as a CEA entity operated by AREVA employees. It provides services to several industrial operators (nuclear process and power plant) in the fields of analytical chemistry, radioactivity measurements, in situ nuclear measurements, decontamination processes and industrial chemistry processes, waste treatments to meet the following analysis requirements. NucLab today is able to support research, production and dismantling activities in all part of dismantling operations. (authors)

Areva at March 31, 2016

International Nuclear Information System (INIS)

Lachaux, Manuel; Jugean, Anne-Sophie

2016-01-01

In the first quarter of 2016, AREVA generated consolidated revenue of 826 million euros, a decrease of 0.8% (-2.2% like for like) compared with the same period in 2015, due in particular to the schedule of uranium deliveries. Foreign exchange had a positive impact of 12 million euros over the period. At March 31, 2016, the group's backlog reached 33.6 billion euros, up sharply compared to December 31, 2015 (29 billion euros), and represented eight years of revenue. It reflects in particular multi-year commercial agreements signed with EDF in early 2016. The order intake for the first quarter of 2016 totaled 6.1 billion euros, a strong increase in relation to the first quarter of 2015 (0.3 billion euros)

An effective and sustainable D&D concept. Competencies and experiences of AREVA

International Nuclear Information System (INIS)

Rohwer, Hans-Otto

2012-01-01

Business Unit created in 2008 to manage nuclear sites dismantling projects for AREVA and external clients through: Assistance during post-closure phase /deregulation; D&D planning and assistance; Project- and Site-Management; Decontamination; Dismantling; Waste management

CEA and AREVA R and D on V/HTR fuel fabrication with the CAPRI experimental manufacturing line

International Nuclear Information System (INIS)

Charollais, Francois; Fonquernie, Sophie; Perrais, Christophe; Perez, Marc; Cellier, Francois; Vitali, Marie-Pierre

2006-01-01

In the framework of the French V/HTR fuel development and qualification program, the Commissariat a l'Energie Atomique (CEA) and AREVA through its program called ANTARES (Areva New Technology for Advanced Reactor Energy Supply) conduct R and D projects covering the mastering of UO 2 coated particle and fuel compact fabrication technology. To fulfill this task, a review of past knowledge, of existing technologies and a preliminary laboratory scale work program have been conducted with the aim of retrieving the know-how on HTR coated particle and compact manufacture: - The different stages of UO 2 kernel fabrication GSP Sol-Gel process have been reviewed, reproduced and improved; - The experimental conditions for the chemical vapour deposition (CVD) of coatings have been defined on dummy kernels and development of innovative characterization methods has been carried out; - Former CERCA compacting process has been reviewed and updated. In parallel, an experimental manufacturing line for coated particles, named GAIA, and a compacting line based on former CERCA compacting experience have been designed, constructed and are in operation since early 2005 at CEA Cadarache and CERCA Romans, respectively. These two facilities constitute the CAPRI line (CEA and AREVA PRoduction Integrated line). The major objectives of the CAPRI line are: - to recover and validate past knowledge; - to permit the optimisation of reference fabrication processes for kernels and coatings and the investigation of alternative and innovative fuel design (UCO kernel, ZrC coating); - to test alternative compact process options; - to fabricate and characterize fuel required for irradiation and qualification purpose; - to specify needs for the fabrication of representative V/HTR TRISO fuel meeting industrial standards. This paper presents the progress status of the R and D conducted on V/HTR fuel particle and compact manufacture by mid 2005. (authors)

Benchmarking of AREVA BWR FDIC-PEZOG model against first BFE3 cycle 15 application of On-Line NobleChem results

International Nuclear Information System (INIS)

Pop, M.G.; Lamanna, L.S.; Hoornik, A.; Storey, G.C.; Lemons, J.F.

2015-01-01

The combination of AREVA's BWR FDIC-PEZOG tools allows the calculation of the total liftoff as a measure of fuel performance and a risk indicator for fuel reliability. The AREVA BWR FDIC tool is a crud modeling tool. The PEZOG tool models the platinum-enhanced zirconium oxide growth of fuel cladding when exposed to platinum during operation. Continuous effort to improve these tools used for the total liftoff calculations is illustrated by the benchmarking of the tools after the application of On-Line NobleChem TM at TVA Browns Ferry Unit 3 during Cycle 15. A set of runs using the modified FDIC-PEZOG model and actual plant water chemistry for Cycle 15 and partial data for Cycle 16 were performed. The updated results' deposit thickness and deposit composition predictions for EOC15 were compared to the measured data from EOC15 and are presented in this paper. The updated predicted deposit thickness matched the actual, measured value exactly. Predicted deposit composition near the fuel rod boundary, nearer to the bulk reactor water, and as an averaged deposit, as presented in the paper, compared extremely well with the measured data at EOC15. The updated AREVA methodology resulted in lower fuel oxide thickness predictions over the life of the fuel as compared to the initial evaluations for BFE3 by incorporating more recent experimental data on the thermal conductivity of zirconia; unnecessary conservatism in the prediction of the fuel oxide thickness over the life of the fuel was removed in the improved model. (authors)

Areva. 2007 figures economic, social, societal and environmental data

International Nuclear Information System (INIS)

2007-01-01

This document presents the 2007 economic, social, societal and environmental data of the Areva Group. Content: 1 - Improvement initiative: Continuous improvement, Innovation; 2 - Financial performance: 2007 results; 3 - Commitment to employees: Stakeholder relations, Health and safety, Radiation protection, Radiological impacts, Technological risks, Workforce, Workforce and training; 4 - Environment: Water, Energy, Gaseous releases, Liquid releases, Conventional waste, Radioactive waste; 5 - Reporting and performance indicators: Reporting methodology, Auditors' report, Social indicators, Environmental indicators

Areva 2006 figures - Economic, social, societal and environmental data

International Nuclear Information System (INIS)

2006-01-01

This document presents the 2006 economic, social, societal and environmental data of the Areva Group. Content: 1 - Improvement initiative: Continuous improvement, Innovation, stakeholder relations, local economic development, Financial performance; 2 - Commitment to employees: Health and safety, Radiation protection, Radiological impacts, Technological risks, employees and training; 3 - Environment: Water, Energy, Gaseous releases, Liquid releases, Conventional waste, Radioactive waste; 4 - Reporting and performance indicators: Reporting methodology, Auditors' report, Social indicators, Environmental indicators

Analysis of the procedure proposed by AREVA to prove adequate toughness of the domes of the Flamanville 3 EPR reactor pressure vessel (RPV) lower head and closure head. Session of 30 September 2015. Public version

International Nuclear Information System (INIS)

Catteau, R.; Cadet-Mercier, S.

2015-01-01

AREVA has asked ASN to evaluate the conformity of the reactor pressure vessel (RPV) for the Flamanville 3 EPR in application of the order reference [6]. The domes of the Flamanville 3 RPV closure head and lower head were manufactured in 2006 and 2007. AREVA identified that these components displayed a risk of heterogeneity of their characteristics and therefore carried out a technical qualification. At the end of 2014, AREVA informed ASN of lower-than-expected results of impact tests conducted as part of this technical qualification on test specimens taken from a dome representative of those intended for Flamanville 3. The values measured on two series of three test specimens give a mean value of 52 joules which does not attain the quality standard expected by AREVA. This mean value is also lower than the bending rupture energy value of 60 joules mentioned in point 4 of appendix 1 of the order reference [6], with which compliance would have been sufficient to prove the toughness of the material. AREVA carried out investigations to determine the origin of these noncompliant values. The carbon concentration measurements taken at the surface of the representative dome by portable spectrometry revealed the presence of a zone of major positive segregation (high concentration of carbon) over a diameter of about one meter. Furthermore, the examinations show that the segregation extends to a depth exceeding a quarter of the thickness of the dome. AREVA explains the non-compliance with the bending rupture energy criterion by the presence of this major positive segregation which came from the ingot used for the forging and was not completely eliminated by the cropping operations. To deal with this deviation, AREVA plans proving that the material is sufficiently tough by conducting new tests on a material that is representative of the lower and upper domes of the Flamanville EPR reactor. The body of the Flamanville 3 RPV, of which the lower dome is a part, has already

Areva half-year report June 30, 2008

International Nuclear Information System (INIS)

2008-01-01

This document is the half-year financial report of the Areva group for 2008. It presents: 1 - the highlights of the period: key data (Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet data); Outlook; 2 - the events subsequent to half-year closing; 3 - the consolidated financial statements: Statutory Auditors' report on half-year 2008 information for the period January 1, 2008 to June 30, 2008, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of change in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2008

Areva half-year report june 30, 2006

International Nuclear Information System (INIS)

2006-01-01

This document is the half-year financial report of the Areva group for 2006. It presents: 1 - Highlights of the period; 2 - Key data: Summary data, Segment reporting, Backlog, Income statement, Review by business division, Cash flow, Balance sheet data; 3 - Outlook; 4 - Events subsequent to the half-year end; 5 - Consolidated financial statements: Statutory auditors' report on the interim consolidated financial statements for the period January 1, 2006 to June 30, 2006, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of changes in equity, Segment reporting, Notes to the consolidated financial statements

Areva. Nine-month 2007 sales revenue and data; Areva. Informations et chiffre d'affaires relatifs au neuf premiers mois de l'exercice 2007

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-10-15

The main information concerning the nine-month 2007 financial data of the Areva group is a steady growth of 9-month sales revenue, at euro 8.066 billion (+6.8% like-for-like), including euro 2.692 billion in the 3. quarter, i.e. +7.6% like-for-like. The group confirms its strong sales revenue growth objective for 2007.

Areva at September 30, 2014

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Repaire, Philippine du

2014-01-01

Over the first nine months of 2014, AREVA generated consolidated revenue of 5.558 billion euros, a decrease of 14.3% (-12.9% like for like) compared to the same period in 2013. In the nuclear operations, revenue totaled 5.453 billion euros over the first 9 months of 2014, versus 6.330 billion euros for the first 9 months of 2013, a 13.9% decrease (-13.1% like for like). Revenue in the Front End BG rose 13.2% (+13.8% like for like). Revenue in the Mining, Reactors and Services and Back End BGs declined 44.8% (-43.5% like for like), 7.7% (-6.5% like for like) and 24.0% (-24.3% like for like) respectively. Foreign exchange had a negative impact of 54 million euros over the period, while consolidation scope had a negative impact of 46 million euros. Third quarter 2014 revenue came to 1.669 billion euros, a 15.3% decrease (-14.1% like for like) compared to the third quarter of 2013. Consolidation scope had a negative impact of 28 million euros over the period, while foreign exchange had practically no impact. Revenue in the nuclear operations amounted to 1.655 billion euros in the 3. quarter of 2014, a drop of 14.2% compared to the 3. quarter of 2013 (-14.3% like for like). Over the first 9 months of 2014, revenue in France came to 2.645 billion euros, a 3.2% decrease compared to the first 9 months of 2013. Over the same period, revenue from international operations totaled 2.913 billion euros, a drop of 22.3% compared to the first 9 months of 2013. At September 30, 2014, the group's backlog was 46.076 billion euros, an increase of 11.4% compared to September 30, 2013 (41.365 billion euros). This is a record level for the nuclear operations since the group's creation. It should be noted that the backlog does not include all of the umbrella agreement signed with EDF, announced on October 2, 2014, for the supply of design and fuel fabrication services for the French nuclear reactors from 2015 to 2021. It should also be noted that it does not include the amount of

PCI. Mechanism, measures, rules for reactor operation

International Nuclear Information System (INIS)

Bender, D.; Bender, G.; Dewes, P.; Wensauer, A.

2009-01-01

Though modern and advanced fuel assembly designs for BWR as AREVA's ATRIUM trademark 10 fuel assemblies show a high reliability, fuel failures are still encountered. The ZTF (Zero Tolerance for Failures) initiative was launched by AREVA to further upgrade BWR fuel assembly reliability towards failure free fuel. The introduction of the zirconium liner cladding has greatly reduced pellet cladding interaction (PCI) failures. However the phenomenon of PCI in reactor operation was not completely eliminated. There were failures in AREVA's BWR fuel with liner cladding attributed to PCI, but when subject to hot cell examinations, all these have been attributed to ''non-classical'' PCI, where local cladding stress is amplified due to missing pellet surface (MPS). However, in order to support the efforts to eliminate all possible root causes for fuel failures, AREVA NP addresses PCI with a ''multi-track'' strategy. First, and most important, the development of chromia doped pellets and more favorable pellet geometries aim at fuel that by design is protected as much as possible against PCI. A high pellet quality is further assured by the final assessment of the pellet appearance by an automatic visual inspection system in the pellet manufacturing lines. In order to support these hardware improvements, AREVA NP provides software aimed to minimize PCI risks. Two main approaches are described in this paper: - The ''classical'' PCI operation and maneuvering guidelines restrict power maneuvering and limit the ramping rates with the goal to control the stress level of the cladding. AREVA's guidelines are based on ramp tests as well as on extensive power plant experience, and are updated to reflect the performance of liner cladding. - Additional effort is made to further understand the PCI phenomenon, e.g. by the use of detailed fuel rod thermal-mechanical codes that provide far better insight of the state variables that control the process of rupture due to stress corrosion

ARCADIAR - A New Generation of Coupled Neutronics / Core Thermal- Hydraulics Code System at AREVA NP

International Nuclear Information System (INIS)

Curca-Tivig, Florin; Merk, Stephan; Pautz, Andreas; Thareau, Sebastien

2007-01-01

Anticipating future needs of our customers and willing to concentrate synergies and competences existing in the company for the benefit of our customers, AREVA NP decided in 2002 to develop the next generation of coupled neutronics/ core thermal-hydraulic (TH) code systems for fuel assembly and core design calculations for both, PWR and BWR applications. The global CONVERGENCE project was born: after a feasibility study of one year (2002) and a conceptual phase of another year (2003), development was started at the beginning of 2004. The present paper introduces the CONVERGENCE project, presents the main feature of the new code system ARCADIA R and concludes on customer benefits. ARCADIA R is designed to meet AREVA NP market and customers' requirements worldwide. Besides state-of-the-art physical modeling, numerical performance and industrial functionality, the ARCADIA R system is featuring state-of-the-art software engineering. The new code system will bring a series of benefits for our customers: e.g. improved accuracy for heterogeneous cores (MOX/ UOX, Gd...), better description of nuclide chains, and access to local neutronics/ thermal-hydraulics and possibly thermal-mechanical information (3D pin by pin full core modeling). ARCADIA is a registered trademark of AREVA NP. (authors)

AREVA revenue and data for the first nine months of 2008

International Nuclear Information System (INIS)

2008-01-01

This public information sheet presents financing data of the group AREVA for the first nine months of 2008. It shows a high increase of the revenue (12,9%). The data are detailed for each activity sector, front end, reactors and services, back end, transmission and distribution. Consolidated revenue for the years 2007 are also provided. (A.L.B.)

AREVA Business and Strategy overview April, 2010

International Nuclear Information System (INIS)

2010-01-01

This document is a series of slides presenting AREVA's activities in the framework of CO 2 -free power generation: 2005-2009 Group Performance; 2010-2012 Development Plan (Build 1/3 of the new nuclear generating capacity, Secure the fuel cycle for current and future customers, Expand renewable energies offering, Ensure strong profitable growth in the T and D Division); Performances and objectives by division (Front-End, Mines and Enrichment, Reactors and Service, renewable energies, Back-End); latest key financial results; Appendices (Financial, Nuclear power, Mining business details, Conversion/Enrichment/Fuel business details, Reactors and Services business details, Back-End business details, Renewable business details)

UP1 decommissioning project: initial review of lessons learned

International Nuclear Information System (INIS)

Fontana, Ph.; Fraize, G.; Seurat, Ph.

2008-01-01

The very first French electricity-generating nuclear reactors (3 gas-graphite reactors operated between 1956 and 1984) and spent fuel reprocessing plant (UP1 and ancillary facilities operated from 1958 to 1997) were located at Marcoule, in southern France. These historic facilities, together with the research labs that contributed to the development and commissioning of the processes implemented, are being decontaminated and dismantled. Other facilities near these nuclear plants will also be shut down in the next few years: the Phenix fast breeder reactor, the Celestin reactors and other ancillary units. Because the UP1 reprocessing plant and its related facilities were used for both commercial and defense activities, a dedicated group comprising three state-owned or private companies (CEA, EdF and COGEMA) was set up as the contracting authority from 1996 to 2004. Today the CEA is the contracting authority at Marcoule and has replaced AREVA NC as the site nuclear operator. AREVA acts as prime contractor for both operation of the main facilities and engineering of the dismantling projects. (authors)

UP1 decommissioning project: initial review of lessons learned

Energy Technology Data Exchange (ETDEWEB)

Fontana, Ph.; Fraize, G. [CEA Valrho, Dir. de l' Energie Nucleaire (DEN/DPAD), 30 - Marcoule (France); Seurat, Ph. [AREVA NC, 75 - Paris (France)

2008-07-01

The very first French electricity-generating nuclear reactors (3 gas-graphite reactors operated between 1956 and 1984) and spent fuel reprocessing plant (UP1 and ancillary facilities operated from 1958 to 1997) were located at Marcoule, in southern France. These historic facilities, together with the research labs that contributed to the development and commissioning of the processes implemented, are being decontaminated and dismantled. Other facilities near these nuclear plants will also be shut down in the next few years: the Phenix fast breeder reactor, the Celestin reactors and other ancillary units. Because the UP1 reprocessing plant and its related facilities were used for both commercial and defense activities, a dedicated group comprising three state-owned or private companies (CEA, EdF and COGEMA) was set up as the contracting authority from 1996 to 2004. Today the CEA is the contracting authority at Marcoule and has replaced AREVA NC as the site nuclear operator. AREVA acts as prime contractor for both operation of the main facilities and engineering of the dismantling projects. (authors)

Loading and transport of high-active waste (HAW) with the TN85 flask in 2008

International Nuclear Information System (INIS)

Rys, Michael; Horn, Thomas; Graf, Wilhelm; Bonface, Jean-Michael

2009-01-01

As a part of the operation of nuclear power plants, it is essential to safely manage the radioactive waste. With new developments in science and technology, it is a dynamic process to adapt procedures, equipment and flasks to be used in the future. This is a task for specialists - a task for GNS Gesellschaft fuer Nuklear-Service mbH and for TN International. Until 1994 reprocessing of spent fuel from German nuclear power plants was mandatory for the Utilities (EVU) in Germany. Basis for the reprocessing was the German Atomic Act. The German Utilities concluded contracts on reprocessing with Compagnie Generale des Matieres Nucleaires (COGEMA, now AREVA NC) in France and British Nuclear Fuels plc (BNFL, now INS) in England. The total amount to be reprocessed comes to 5309 t HM contracted to AREVA NC and 768 t HM contracted to INS. The waste generated from reprocessing - or an equivalent amount of radioactive material - has to be returned to the country of origin. In 1979 already an exchange of notes took place between the German and the French government with the obligation of both sides to enable and support the return of reprocessing residues or equivalents. The return of high-active waste (HAW) from France has started in 1996 with the first attribution of 28 glass canisters (one flask) to German Utilities by AREVA NC. Until 2007, 75 flasks loaded with vitrified residue (VR) canisters have been transported to Gorleben. For these transports CASTOR registered HAW 20/28 CG flasks have been used. This presentation will give some background information about the last HAW transport in 2008 with the new flask generation of the type TN85. It will also describe the assembly of the new flask, the preparation of the flask for the loading campaign as well as the loading procedure. (orig.)

Loading and transport of high-active waste (HAW) with the TN85 flask in 2008

Energy Technology Data Exchange (ETDEWEB)

Rys, Michael; Horn, Thomas; Graf, Wilhelm [GNS Gesellschaft fuer Nuklear-Service mbH (Germany); Bonface, Jean-Michael [TN International, Montigny-le-Bretonneux (France)

2009-07-01

As a part of the operation of nuclear power plants, it is essential to safely manage the radioactive waste. With new developments in science and technology, it is a dynamic process to adapt procedures, equipment and flasks to be used in the future. This is a task for specialists - a task for GNS Gesellschaft fuer Nuklear-Service mbH and for TN International. Until 1994 reprocessing of spent fuel from German nuclear power plants was mandatory for the Utilities (EVU) in Germany. Basis for the reprocessing was the German Atomic Act. The German Utilities concluded contracts on reprocessing with Compagnie Generale des Matieres Nucleaires (COGEMA, now AREVA NC) in France and British Nuclear Fuels plc (BNFL, now INS) in England. The total amount to be reprocessed comes to 5309 t HM contracted to AREVA NC and 768 t HM contracted to INS. The waste generated from reprocessing - or an equivalent amount of radioactive material - has to be returned to the country of origin. In 1979 already an exchange of notes took place between the German and the French government with the obligation of both sides to enable and support the return of reprocessing residues or equivalents. The return of high-active waste (HAW) from France has started in 1996 with the first attribution of 28 glass canisters (one flask) to German Utilities by AREVA NC. Until 2007, 75 flasks loaded with vitrified residue (VR) canisters have been transported to Gorleben. For these transports CASTOR {sup registered} HAW 20/28 CG flasks have been used. This presentation will give some background information about the last HAW transport in 2008 with the new flask generation of the type TN85. It will also describe the assembly of the new flask, the preparation of the flask for the loading campaign as well as the loading procedure. (orig.)

AREVA main steam line break fully coupled methodology based on CATHARE-ARTEMIS - 15496

International Nuclear Information System (INIS)

Denis, L.; Jasserand, L.; Tomatis, D.; Segond, M.; Royere, C.; Sauvage, J.Y.

2015-01-01

The CATHARE code developed since 1979 by AREVA, CEA, EDF and IRSN is one of the major thermal-hydraulic system codes worldwide. In order to have at disposal realistic methodologies based on CATHARE for the whole transient and accident analysis in Chapter 15 of Safety Reports, a coupling with the code ARTEMIS was developed. ARTEMIS is the core code in AREVA's new reactor simulator system ARCADIA, using COBRA-FLX to model the thermal-hydraulics in the core. The Fully Coupled Methodology was adapted to the CATHARE-ARTEMIS coupling to perform Main Steam Line Break studies. This methodology, originally applied to the MANTA-SMART-FLICA coupling, is dedicated to Main Steam Line Break transients at zero power. The aim of this paper is to present the coupling between CATHARE and ARTEMIS and the application of the Fully Coupled Methodology in a different code environment. (authors)

Areva Resources Namibia. Report to Stakeholders 2015

International Nuclear Information System (INIS)

2016-01-01

This document is Areva Namibia's stakeholder report for 2015. After some turbulent years, the company has now settled into the routine of care and maintenance and expect it to continue until the over-supply of uranium on the world market is depleted and the market conditions improve sustainably. Until then the Care and Maintenance team will continue protecting the mine's infrastructure so that it can be commissioned without delay as soon as the economic conditions become more favourable. The company also maintains its focus on process development and optimisation, on safety, occupational health and protection of the environment. The care and maintenance phase is giving an opportunity to thoroughly research the alkaline heap leach process and make improvements to the uranium recovery methods. The third phase of metallurgical test work will explore some new options to further reduce the cost of production and enhance the economic viability of Trekkopje mine. Preliminary bench testing carried out in mid-2015 at the Process Development Laboratory in France delivered promising results. The on-site testing program started in October 2015 and will continue into 2016. Areva Namibia has been very active in the community. Thanks to the desalination plant NamWater has been able to meet the water demand of the other uranium mines when pumping from the Omaruru Delta (Omdel) aquifer had to be reduced. Negotiations about the sale of the plant are at an advanced stage. The company is supporting social projects in the areas of economic development, education, culture and sport in its neighbouring communities of Arandis and Swakopmund and in the wider Erongo region. This report presents some of the highlights of this active engagement with stakeholders at the local, regional and national level. Content: Health and Safety; People; Environment; Community; Care and Maintenance; Process Development; Sustainability Indicators

AREVA revenue and data for the first nine months of 2008; AREVA informations et chiffre d'affaires relatifs aux neuf premiers mois de l'exercice 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This public information sheet presents financing data of the group AREVA for the first nine months of 2008. It shows a high increase of the revenue (12,9%). The data are detailed for each activity sector, front end, reactors and services, back end, transmission and distribution. Consolidated revenue for the years 2007 are also provided. (A.L.B.)

Processing of the GALILEO fuel rod code model uncertainties within the AREVA LWR realistic thermal-mechanical analysis methodology

International Nuclear Information System (INIS)

Mailhe, P.; Barbier, B.; Garnier, C.; Landskron, H.; Sedlacek, R.; Arimescu, I.; Smith, M.; Bellanger, P.

2013-01-01

The availability of reliable tools and associated methodology able to accurately predict the LWR fuel behavior in all conditions is of great importance for safe and economic fuel usage. For that purpose, AREVA has developed its new global fuel rod performance code GALILEO along with its associated realistic thermal-mechanical analysis methodology. This realistic methodology is based on a Monte Carlo type random sampling of all relevant input variables. After having outlined the AREVA realistic methodology, this paper will be focused on the GALILEO code benchmarking process, on its extended experimental database and on the GALILEO model uncertainties assessment. The propagation of these model uncertainties through the AREVA realistic methodology is also presented. This GALILEO model uncertainties processing is of the utmost importance for accurate fuel design margin evaluation as illustrated on some application examples. With the submittal of Topical Report GALILEO to the U.S. NRC in 2013, GALILEO and its methodology are on the way to be industrially used in a wide range of irradiation conditions. (authors)

Convening of the general meeting with a view to approving the capital increase for AREVA SA. Entry of strategic investors into the capital of NewCo

International Nuclear Information System (INIS)

Lachaux, Manuel; Jugean, Anne-Sophie

2016-01-01

General meeting of shareholders of AREVA SA convened for February 3, 2017 to approve AREVA SA capital increase for an amount of 2 billion euros, subject to the approval of the European Commission; Receipt of offers from strategic investors with a view to them taking up a stake in the capital of NewCo, alongside the French State; Conditions and schedule for the completion of the capital increases to be defined subsequent to the approval of the European Commission; Signature of definitive agreements for the sale of AREVA TA. (authors)

AREVA Modular Steam Cycle – High Temperature Gas-Cooled Reactor Development Progress

International Nuclear Information System (INIS)

Lommers, L.; Shahrokhi, F.; Southworth, F.; Mayer, J. III

2014-01-01

The AREVA Steam Cycle – High Temperature Gas-Cooled Reactor (SCHTGR) is a modular graphite-moderated gas-cooled reactor currently being developed to support a wide variety of applications including industrial process heat, high efficiency electricity generation, and cogeneration. It produces high temperature superheated steam which makes it a good match for many markets currently dependent on fossil fuels for process heat. Moreover, the intrinsic safety characteristics of the SC-HTGR make it uniquely qualified for collocation with large industrial process heat users which is necessary for serving these markets. The NGNP Industry Alliance has selected the AREVA SC-HTGR as the basis for future development work to support commercial HTGR deployment. This paper provides a concise description of the SC-HTGR concept, followed by a summary of recent development activities. Since this concept was introduced, ongoing design activities have focused primarily on confirming key system capabilities and the suitability for potential future markets. These evaluations continue to confirm the suitability of the SC-HTGR for a variety of potential applications that are currently dependent on fossil fuels. (author)

33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

AREVA - Results for the first half of 2012: performance materializes as 'Action 2016' plan is rolled out

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Michaut, Maxime; Rosso, Jerome; Scorbiac, Marie de; Repaire, Philippine du

2012-01-01

The results for the first half of 2012 demonstrate the effectiveness of Areva's 'Action 2016' plan, in particular with a sharp rise in EBITDA and a significant improvement in free operating cash flow after capex. Moreover, net debt remains stable even though the Group invested more than 900 million euros in strategic projects and in improvements to safety and to competitiveness of industrial assets. Several factors made this first phase towards restoring the Group's financial performance possible: - revenue growth in the nuclear businesses together with the ramp-up of operations in renewable energies, with the Group continuing to benefit from the strong visibility provided by its backlog, which has also grown over the past twelve months; - ongoing efforts begun in late 2011 to reduce operating costs, with savings measures at the end of June 2012 implemented for nearly 20% of the objective set for the Group through 2015, on an annual basis, another 45% of the objective being secured in addition. - execution ahead of schedule in Areva's asset disposal program, with 961 million euros mainly collected during the first half year and the objective of at least 1.2 billion euros for the 2012- 2013 period to be met this year with the recently announced disposal of La Mancha Resources for about 315 million Canadian dollars. After booking provisions, in accordance with the principle of prudent management, in two areas (construction of the Olkiluoto 3 EPR reactor and the Bakouma and Ryst Kuil mining sites), the Group reports positive operating income and positive net income for the first half of 2012. Results can be summarized as follows: Backlog rises 4.8% year on year to euro 45.2 bn; - Significant revenue growth to euro 4.329 bn, up 8.3% vs. H1 2011; - Strong increase in EBITDA to euro 725 m: +euro 508 m vs. H1 2011; - Marked improvement in FCF to -euro 591 m: +euro 328 m vs. H1 2011; - Net debt stable for the half year; - Positive operating income and net income to owners

Remarks on the radiological situation in the vicinity of the uranium mines operated by SOMAIR and COMINAK (subsidiaries of AREVA) in northern Niger. Study conducted on behalf of Greenpeace International

International Nuclear Information System (INIS)

2010-01-01

The companies SOMAIR and COMINAK, subsidiaries of the AREVA group, are mining uranium deposits in northern Niger near the towns of Arlit and Akokan. In the course of a mission carried out in November 2009, a Greenpeace International team took radiation measurements in situ, collected samples, and amassed a number of documents provided by the companies. The aim of this mission was to evaluate how the radiological situation has developed in the vicinity of the industrial sites operated by SOMAIR and COMINAK. The CRIIRAD laboratory, which carried out earlier missions and studies at Arlit between 2003 and 2009 (list at Annex 1) helped to accomplish this mission by drawing up a list of documents to be requested from AREVA (Annex 2) and devising a sampling and analysis strategy. The sampling procedures and radioprotection instructions were discussed during a preliminary meeting at the CRIIRAD laboratory on 7 October 2009, between Dr Rianne Teule (chemist, Greenpeace International) and Dr. Bruno Chareyron (nuclear physics engineer in charge of the CRIIRAD laboratory). The analysis at the CRIIRAD laboratory of the samples brought back by Greenpeace in November 2009 is discussed in CRIIRAD reports nos. 10-05 (soil analysis) and 10-07 (analysis of radon in the air). The results of the radiological and chemical analysis of five water samples taken by Greenpeace in the Arlit-Akokan district and, as a control, one sample taken in the Imouraren district are reproduced in Annex 4 and discussed in the present report. The present report represents a summary of the CRIIRAD laboratory's preliminary observations and recommendations on the basis of the analysis conducted and of a preliminary examination of the documents listed in Annex 3. Three subjects are addressed: the presence of radioactive material in the environment; air contamination by a radioactive gas, radon 222; and contamination of groundwater which supplies the local population. A more in-depth analysis of the available

The AREVA customized chemical cleaning C3-concept as part of the steam generator asset management

International Nuclear Information System (INIS)

Weiss, Steffen; Drexler, Andreas

2012-09-01

with various chemical cleaning methods and their world wide applications AREVA has developed the 'C 3 ' Customized Chemical Cleaning concept. This concept covers the entire range of steam generator chemical cleaning. With this approach, also specific problems like removal of sludge piles from tube sheet can be adequately addressed. At European PWRs the above presented overall approach was applied successfully in 2009 and 2010. Prior to the chemical cleaning the steam generator status was investigated and evaluated in a common approach of all relevant AREVA departments. For example, as a result of one plant specific evaluation, a hard sludge problem was identified combined with denting indications mainly on the tube sheet. Based on this SG assessment and the expected amount of deposits an individually tailored and site specific cleaning approach was developed in close cooperation with the plant operator. Prior to the chemical cleaning an inner bundle lancing was performed to mechanically weaken the hard deposits, which allows deep penetration of the cleaning agent into the deposits. The chemical cleaning methodology for this site specific SG problem was the AREVA DART HT process selected from the C 3 toolbox. The DART HT process allows an efficient removal of hard deposits, while keeping the average corrosion below 50 μm. After the chemical cleaning a subsequent tube sheet lancing was performed, effectively removing the chemically softened deposits. This approach removed the targeted amount of deposits, thus eliminating the hard sludge denting of tubes at the tube sheet. This paper describes the joint approach of the plant operator and AREVA for the on-site chemical cleaning to the improve steam generator condition. (authors)

Participation in the IAEA Coordinated Research Project Fumex III: Final Report of AREVA NP

International Nuclear Information System (INIS)

2013-01-01

After the Coordinated Research Project (CRP) FUMEXII, participants asked for a new exercise within an IAEA CRP. This CRP started in December 2008 in Vienna with the first Research Coordination Meeting (RCM). The CRP is titled ''Improvement of Computer Codes Used for Fuel Behaviour Simulation FUMEX III''. The object of FUMEX III were the improvement of fuel rod performance codes for modeling high burnup phenomena in modern fuel. This includes transient behavior, as well as mechanical interaction between pellet and cladding and, in progression to the FUMEX II exercise, fission gas release during various conditions (steady state, load follow, transient). AREVA NP agreed on participating in this exercise under the IAEA research agreement no. 15369 and expressed interest in the modeling of pelletclad mechanical interactions as well as fission gas release under steady state and transient conditions. In this exercise AREVA NP used its new global fuel rod code GALILEO, which is still under development (formerly known under the project name COPERNIC 3). During a Consultants Meeting potential topics and a proposed selection of cases have been prepared, which were discussed during the 1st Research Coordination Meeting (RCM) in Vienna in December 2008. During the discussions a number of additional cases motivated by the participants have been identified. Finally, a case table has been agreed upon, which included several cases for the different topics. Most of the cases have been based on the International Fuel Performance Experiments (IFPE) database, but additional cases have been provided during the exercise (e.g., the AREVA idealized case

AREVA T and D wins de-icing contract in Quebec

Energy Technology Data Exchange (ETDEWEB)

Anon.

2005-04-01

The ice storm that struck Quebec in the winter of 1998 left millions of people without electricity because the accumulation of ice caused the collapse of hundreds of kilometres of high-voltage transmission lines and thousands of transmission towers. In order to optimize the security of its power grid, Hydro-Quebec contracted AREVA T and D to construct and install HVDCice{sup TM}, a transmission line de-icing system based on high-voltage direct current (HVDC) technology. The system is intended to ensure maximum electrical efficiency and guarantee a secure electricity supply. The system will generate up to 7200A of direct current in the transmission lines. This will raise their temperature thereby allowing the ice to melt and fall off. The system will be implemented at the Levis substation, a major connection point for the transmission lines of the province. The system also acts as a Static Var Compensator (SVC) to improve the power quality of the transmission network. The SVC will stabilize the voltage on the 735 kV power grid, which can fluctuate depending on the amount of electricity being consumed. This is the world's first HVDC-based de-icing and power quality system. The contract awarded to AREVA's T and D division is estimated at 25 million Euros. 1 fig.

Areva half-year report june 30, 2007

International Nuclear Information System (INIS)

2008-01-01

Information provided in this document concerns the AREVA group as a whole. It presents the highlights and Key data of the first half of 2007, the outlook, the events subsequent to half-year closing, and the Consolidated financial statements. Contents: 1 - Highlights of the period; 2 - Key data: Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet data; 3 - Outlook; 4 - Events subsequent to half-year closing; 5 - Consolidated financial statements: Statutory Auditors' report on half-year information for the period January 1, 2007 to June 30, 2007, Consolidated income statement, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of change in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2007

33 CFR 117.822 - Beaufort Channel, NC.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

Steam generator assessment for sustainable power plant operation

International Nuclear Information System (INIS)

Drexler, Andreas; Fandrich, Joerg; Ramminger, Ute; Montaner-Garcia, Violeta

2012-09-01

Water and steam serve in the water-steam cycle as the energy transport and work media. These fluids shall not affect, through corrosion processes on the construction materials and their consequences, undisturbed plant operation. The main objectives of the steam water cycle chemistry consequently are: - The metal release rates of the structural materials shall be minimal - The probability of selective / localized forms of corrosion shall be minimal. - The deposition of corrosion products on heat transfer surfaces shall be minimized. - The formation of aggressive media, particularly local aggressive environments under deposits, shall be avoided. These objectives are especially important for the steam generators (SGs) because their condition is a key factor for plant performance, high plant availability, life time extension and is important to NPP safety. The major opponent to that is corrosion and fouling of the heating tubes. Effective ways of counteracting all degradation problems and thus of improving the SG performance are to keep SGs in clean conditions or if necessary to plan cleaning measures such as mechanical tube sheet lancing or chemical cleaning. Based on more than 40 years of experience in steam-water cycle water chemistry treatment AREVA developed an overall methodology assessing the steam generator cleanliness condition by evaluating all available operational and inspection data together. In order to gain a complete picture all relevant water chemistry data (e.g. corrosion product mass balances, impurity ingress), inspection data (e.g. visual inspections and tube sheet lancing results) and thermal performance data (e.g. heat transfer calculations) are evaluated, structured and indexed using the AREVA Fouling Index Tool Box. This Fouling Index Tool Box is more than a database or statistical approach for assessment of plant chemistry data. Furthermore the AREVA's approach combines manufacturer's experience with plant data and operates with an

Mixed enrichment core design for the NC State University PULSTAR Reactor

International Nuclear Information System (INIS)

Mayo, C.W.; Verghese, K.; Huo, Y.G.

1997-12-01

The North Carolina State University PULSTAR Reactor license was renewed for an additional 20 years of operation on April 30, 1997. The relicensing period added additional years to the facility operating time through the end of the second license period, increasing the excess reactivity needs as projected in 1988. In 1995, the Nuclear Reactor Program developed a strategic plan that addressed the future maintenance, development, and utilization of the facility. Goals resulting from this plan included increased academic utilization of the facility in accordance with its role as a university research facility, and increased industrial service use in accordance with the mission of a land grant university. The strategic plan was accepted, and it is the intent of the College of Engineering to operate the PULSTAR Reactor as a going concern through at least the end of the current license period. In order to reach the next relicensing review without prejudice due to low excess reactivity, it is desired to maintain sufficient excess reactivity so that, if relicensed again, the facility could continue to operate without affecting users until new fuel assistance was provided. During the NC State University license renewal, the operation of the PULSTAR Reactor at the State University of New York at Buffalo (SUNY Buffalo) was terminated. At that time, the SUNY Buffalo facility had about 240 unused PULSTAR Reactor fuel pins with 6% enrichment. The objective of the work reported here was to develop a mixed enrichment core design for the NC State University PULSTAR reactor which would: (1) demonstrate that 6% enriched SUNY buffalo fuel could be used in the NC State University PULSTAR Reactor within the existing technical specification safety limits for core physics parameters; (2) show that use of this fuel could permit operating the NC State University PULSTAR Reactor to 2017 with increased utilization; and (3) assure that the decision whether or not to relicense the facility would

AREVA - first half 2005 sales figures; AREVA - chiffre d'affaires du 1. semestre 2005

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

First half 2005 sales for the AREVA group were up 1.1% to 5,396 million euros and 2.6% like-for-like, compared with 5,339 million euros for the same period in 2004.The change in foreign exchange rates had a negative impact of nearly (34) million euros between these two periods, which was much less than between the first half of 2003 and the same period in 2004. Sales are up 1.1% compared with the first half of 2004 (up 2.6% like-for-like); the euros (17.3) M impact of IFRS adoption is limited to the Front End division; Energy is up: Nuclear Power: up 4.4% (up 5.5% like-for-like), driven by the Front End and Reactors and Services divisions; T and D: down 3.9% (-2.1% like-for-like) due to the one time peak observed in early 2004; Connectors sales are stable (+0.3% like-for-like): Automotive performed well, while the communication market continued to be a difficult one.

AREVA in 2007, growth and profitability

International Nuclear Information System (INIS)

2008-01-01

This document is the 2007 activity report of the Areva group, the nuclear division of which is Number 1 worldwide in the front end of the nuclear cycle, in pressurized water reactors (in terms of installed capacity), and in the treatment and recycling of used nuclear fuel. The Transmission and Distribution division is Number 1 worldwide in market management software and grid management software, number 2 in high voltage products, and number 3 in medium voltage products. Content: Message from the Chairman of the Supervisory Board; Message from the Chief Executive Officer; Key data; 2007 highlights; Corporate governance; Organization of the group; Share information and shareholder relations; Solutions for CO 2 -free power generation; Solutions for reliable electricity transmission and distribution; Governance; Continuous improvement; Financial performance; Innovation; Customer satisfaction; Commitment to employees; Environmental protection; Risk management and prevention; Dialogue and consensus building; Community involvement; Auditors' report; Reporting methodology; Data verified in 2007; Glossary; and 'to learn more' references

AREVA in 2007, growth and profitability

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This document is the 2007 activity report of the Areva group, the nuclear division of which is Number 1 worldwide in the front end of the nuclear cycle, in pressurized water reactors (in terms of installed capacity), and in the treatment and recycling of used nuclear fuel. The Transmission and Distribution division is Number 1 worldwide in market management software and grid management software, number 2 in high voltage products, and number 3 in medium voltage products. Content: Message from the Chairman of the Supervisory Board; Message from the Chief Executive Officer; Key data; 2007 highlights; Corporate governance; Organization of the group; Share information and shareholder relations; Solutions for CO{sub 2}-free power generation; Solutions for reliable electricity transmission and distribution; Governance; Continuous improvement; Financial performance; Innovation; Customer satisfaction; Commitment to employees; Environmental protection; Risk management and prevention; Dialogue and consensus building; Community involvement; Auditors' report; Reporting methodology; Data verified in 2007; Glossary; and 'to learn more' references.

AREVA in 2007, growth and profitability

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

This document is the 2007 activity report of the Areva group, the nuclear division of which is Number 1 worldwide in the front end of the nuclear cycle, in pressurized water reactors (in terms of installed capacity), and in the treatment and recycling of used nuclear fuel. The Transmission and Distribution division is Number 1 worldwide in market management software and grid management software, number 2 in high voltage products, and number 3 in medium voltage products. Content: Message from the Chairman of the Supervisory Board; Message from the Chief Executive Officer; Key data; 2007 highlights; Corporate governance; Organization of the group; Share information and shareholder relations; Solutions for CO{sub 2}-free power generation; Solutions for reliable electricity transmission and distribution; Governance; Continuous improvement; Financial performance; Innovation; Customer satisfaction; Commitment to employees; Environmental protection; Risk management and prevention; Dialogue and consensus building; Community involvement; Auditors' report; Reporting methodology; Data verified in 2007; Glossary; and 'to learn more' references.

75 FR 62895 - Notice of Availability of Safety Evaluation Report; AREVA Enrichment Services LLC, Eagle Rock...

Science.gov (United States)

2010-10-13

... Evaluation Report; AREVA Enrichment Services LLC, Eagle Rock Enrichment Facility, Bonneville County, ID... report. FOR FURTHER INFORMATION CONTACT: Breeda Reilly, Senior Project Manager, Advanced Fuel Cycle, Enrichment, and Uranium Conversion, Division of Fuel Cycle Safety and Safeguards, Office of Nuclear Material...

A worldwide fuel strategy by AREVA

International Nuclear Information System (INIS)

Bordy, Michel

2004-01-01

Operating as a global company, inside AREVA the Fuel Sector implements a common strategy among three Business Units of fuel activities. These Business Units which are in Framatome ANP Zirconium, Manufacturing and Design and Sales Units, are operated in Germany (former Siemens activity), in USA (former BWFC Babcock and Wilcox Fuel Co,. and SPC Siemens Power Co. activities), in Belgium and in France (former Framatome activity). They have resources and facilities which are cooperatively working on R and D, engineering, project management, sales and services to achieve synergy on a cross-business basis. Based on its experience of worldwide activities and taking advantage of its diversified fuel design knowledge, Framatome ANP proposes a full range of fuel products and services on the BWR and PWR markets. With the ability to supply all fuel assembly arrays and fuel pellet types, supplemented by the range of stationary and movable core components, and completed by a full-range of on-site fuel services and performance of fuel packing and delivery, Framatome ANP is positioned as a major participant on the world fuel market. Today, Framatome ANP takes advantage of the cross-fertilization in the short term of existing products which include four original PWR fuel designs of HTP TM alloy as the reference material for cladding tubes, guide thimbles, and grids, -- Gradual incorporation of the valuable high-stiffiness MONOBLOC tM guide thimble, -- Progressive integressive integration of the High Mechanical Performance (HMP) Inconel end grid, -- Planned standardization of mechanical components such as nozzles, holddown systems and top and bottom connections. As a continuation of its existing technology, Framatome ANP is developing improved technical features within the scope of the Alliance fuel assembly qualification program. With an irradiation program ranging up to a burnup of 70 MWd/kgU expected to be reached in 2006, Alliance shows excellent behaviour with very low corrosion

First half 2006 financial results; Resultats du 1er semestre 2006 Groupe Areva

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-09-15

Areva provides technological solutions for highly reliable nuclear power generation and electricity transmission and distribution. The group is the world leader in nuclear power and the only company to cover all industrial activities in this field. This Press release presents the first half 2006 financial results: the overall performance and the performance by division (front end, reactors and services, back end, transmission and distribution). (A.L.B.)

AREVA in Gabon. Inquiry report on the situation of workers of the COMUF, Gabonese subsidy of the AREVA-COGEMA group

International Nuclear Information System (INIS)

2007-01-01

After a recall of the development of uranium mining activities by the COMUF Company which is now a subsidy company of the AREVA-COGEMA group, and a presentation of the inquiry, this document reports the inquiry performed in Gabon about the medical issue (with notably inadequate security measures) and about the environmental issue related to the site rehabilitation. It also reports the analysis of questionnaires sent to ex-workers in Gabon, as well as of testimonies obtained from expatriates who are suffering from health problems. The report discusses the possibilities to take legal actions for different reasons: unintentional injuries and homicide, endangering the life of others, or inexcusable error. In conclusion the report outlines that the risk was known, that there was no information about it, and that people were deliberately maintained in ignorance

Synthesis of the IRSN report on arrangements proposed by AREVA, the CEA and the ILL about the implementation of a 'hard core' for installations related to the fuel cycle and for research reactors falling within batch 1

International Nuclear Information System (INIS)

2013-01-01

After additional safety assessments performed by operators of French nuclear installations, the ASN ask them to implement a 'hard core' of material and organisational arrangements to prevent any severe accident or its propagation, to limit massive releases within a scenario of accident which could not have been controlled, and to allow the operator to ensure its assigned missions in crisis management, to present an organisation and means of crisis management which would remain operational in case of extreme aggressions, and to foresee transient arrangements before the implementation of the crisis management hard core. This report proposes a synthesis of the assessment performed by the IRSN on these issues. It addresses issues on which hard cores are defined (earthquakes, flooding, other climatic aggressions, effects induced by an extreme aggression), requirements associated with material arrangements of hard cores. The content of these hard cores is then discussed for AREVA installations (La Hague, MELOX, Romans-sur-Isere, Tricastin), CEA installations and the high flow reactor of the Laue Langevin Institute. Measures concerning crisis management and, for AREVA, the taking of human and organisational factors into account by these operators are also discussed

Evaluation of health risks related to the operation of the AREVA sites of the Tricastin platform: Georges Besse plants I and II, SOCATRI, COGEMA Pierrelatte and COMURHEX (first level approach) Assessment of health studies. Final report

International Nuclear Information System (INIS)

Mandin, C.

2006-03-01

This document reports the study of health risks related to the chemical toxicity of species related to the operation of several AREVA installations in Tricastin. A qualitative and quantitative inventory of the species released in the atmosphere and in waters is based on data supplied by the operator. A selection of health tracers has lead to a global investigation of nitrogen oxides, sulphur dioxide, fluorine, uranium, arsenic, hexavalent chromium, mercury and nickel. The hazard associated with each of these species has been characterized. Different exposure ways have been considered: inhalation, soil ingestion, by vegetable, fruit and crop ingestion, ingestion of meat, milk and eggs produced by local breeding, fish ingestion, and ingestion of water sampled from the Tricastin aquifer. Atmospheric concentrations, soil deposits, surface soil layer concentrations, and other concentrations (in meat, milk, eggs, crops, vegetables, fruits, and drinking water) have been either modelled or measured. Different exposure scenarios have been defined, and the different risks (carcinogen or not) have been assessed

Areva - Half year financial report June 30, 2009; Areva - Rapport financier semestriel 30 juin 2009

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-07-01

This half-year financial report contains statements on the objectives, prospects and growth areas for the AREVA group. It gives a view of the net worth, the financial position and the income of the company and all the companies included in consolidation. It presents the major events that occurred during the first six months of the fiscal year, of their effect on the financial statements and of the main transactions between related parties. It gives a description of the main risks and main uncertainties for the remaining six months of the financial year. Content: 1 - Half-year business report: Significant events, Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet items, Events subsequent to closing, Outlook; 2 - Statutory auditors' report on the financial information for the 2009 half-year - period January 1 to June 30, 2009: Condensed consolidated financial statements at June 30, 2009, Consolidated income statement, Consolidated comprehensive income, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of changes in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2009.

Applicability of Learning From Experience to Sellafield Post-Operation Clean Out and Decommissioning Programmes

International Nuclear Information System (INIS)

Ytournel, Bertrand; Clement, Gilles; Macpherson, Ian; Dunlop, Alister

2016-01-01

Nuclear cycle facilities, such as recycling plants, over the world differ in their design and operation history. Transferability of Learning From Experience (LFE), Best Practices and Decommissioning tools and techniques may not appear as relevant as it would be for a fleet of reactors. Moreover Regulatory, Economic and Social Drivers may differ from one country to another. Technical Drivers being comparable, AREVA and Sellafield Ltd (SL) have conducted various benchmarks and technical peer reviews to consider LFE from AREVA's Post-Operation Clean Out (POCO) and Decommissioning projects (such as UP2-400 on the La Hague site) and those performed for customers (such as CEA's UP1 on the Marcoule site). The intention is that Sellafield can benefit from AREVA experience and incorporate some recommendations in their own programmes. These reviews highlighted not only that investigation tools and methods as well as Decommissioning techniques are fully transferable, but also that strategic, technical and organizational key recommendations are applicable. 1. End-state definition (for each programme step) has a strong impact on POCO and Decommissioning scenarios. 2. A waste-driven strategy is essential for the overall programme cost and schedule management, and it avoids detrimental activities and short-term decisions made under pressure that may have negative impacts on the Programme. 3. Safety issues associated with POCO and decommissioning programmes are different from the commercial operations environment. 4. An extensive characterization plan (with physical and radiological surveys and active sampling) is essential to underpin the final POCO / decommissioning scenario and build a plant configuration baseline that will be updated as the decommissioning progresses. 5. Transition from operations to decommissioning requires a major change in culture; the organization must adapt to the new decommissioning environment. 6. Securing specific competencies, resources and

Health effects of low dose exposures to external ionizing radiation in the French cohort of nuclear workers CEA-AREVA-EDF - 5287

International Nuclear Information System (INIS)

Leuraud, K.; Fournier, L.; Samson, E.; Caer-Lorho, S.; Laurier, D.; Laroche, P.; Le Guen, B.

2015-01-01

Populations of nuclear workers are particularly relevant to study health effects of low dose and low dose-rate exposures to ionizing radiation. In France, a cohort of nuclear workers employed by CEA, AREVA NC, or EDF, and badge-monitored for radiation exposure, has been followed-up. Annual exposure to penetrating photons was reconstructed for each worker. Standardized mortality ratios were calculated using national mortality rates as the reference. Estimates of radiation dose-mortality associations were obtained using a linear excess relative risk (ERR) model. A total of 59,004 workers were followed-up between 1968 and 2004, for an average of 25 years. The mean cumulative photons dose was 16.1 mSv. At the end of the follow-up, workers were 56 years old and 6,310 workers had died. A strong healthy worker effect was observed. Positive but imprecise estimates of ERR/Sv were observed for all solid cancers and leukemia excluding chronic lymphocytic leukemia. A significant ERR/Sv was found for myeloid leukemia. This cohort study is the most informative ever conducted in France among nuclear workers. Results confirmed a healthy worker effect due to selection at hiring and health monitoring from occupational medicine. Observed dose-risk relationships were consistent with risks estimated in other studies, even if they remained associated to a large uncertainty. (authors)

AREVA advanced safety IC solutions and licensing experience for new nuclear builds and modernization projects - 15545

International Nuclear Information System (INIS)

Fourestie, B.; Pickelmann, J.; Richter, S.; Hilsenkopf, P.; Paris, P.

2015-01-01

Regulatory requirements for the Instrumentation and Control (IC) for Nuclear Power Plants have become significantly more stringent during the last 10 years in the areas of software development and qualification, traceability, diversity, or seismic requirements for instance, and with the introduction of new standards (such as the IEC 62566, or the IEC 62003). Based on a large and comprehensive experience gained from projects in several regulatory environments and different plant types (including non-OEM plants), AREVA has developed and adapted its processes and products to provide state-of-the-art IC solutions in full compliance with the regulatory demands and requirements in terms of robustness (independence, defense-in-depth, diversity and cyber-security). In this paper we present the safety IC platforms developed by AREVA. These platforms include TELEPERM XS as the computerized safety IC platform for class 1 system implementation, the Qualified Display System (QDS) for safety classified screen-based interface, and UNICORN as fully diverse analog safety IC platform for backup systems

Calibration of measurement instruments in industrial irradiation environment

International Nuclear Information System (INIS)

Cadiou, A.

2009-01-01

After having recalled the activities of the AREVA NC site in La Hague and its organization, the author describes the missions of the Calibration Laboratory within this establishment, its methods, its metrological means, and outlines the traceability of results

AREVA - first half 2005 sales figures

International Nuclear Information System (INIS)

2005-07-01

First half 2005 sales for the AREVA group were up 1.1% to 5,396 million euros and 2.6% like-for-like, compared with 5,339 million euros for the same period in 2004.The change in foreign exchange rates had a negative impact of nearly (34) million euros between these two periods, which was much less than between the first half of 2003 and the same period in 2004. Sales are up 1.1% compared with the first half of 2004 (up 2.6% like-for-like); the euros (17.3) M impact of IFRS adoption is limited to the Front End division; Energy is up: Nuclear Power: up 4.4% (up 5.5% like-for-like), driven by the Front End and Reactors and Services divisions; T and D: down 3.9% (-2.1% like-for-like) due to the one time peak observed in early 2004; Connectors sales are stable (+0.3% like-for-like): Automotive performed well, while the communication market continued to be a difficult one

Mitigation of severe accidents in AREVA's Gen 3+ nuclear power plants

Energy Technology Data Exchange (ETDEWEB)

Fischer, M., E-mail: manfred.fischer@areva.com; Henning, A.; Surmann, R.

2014-04-01

The current AREVA Gen 3+ PWR designs (EPR™ and ATMEA1) are based on the proven defense-in-depth safety concepts inherited from their predecessors, the French “N4” and the German “Konvoi” reactors. Complemented by specific enhancements, including higher redundancy and diversity as well as the use of passive systems, this leads to very low values of the core damage frequency (CDF). Notwithstanding this very low probability, dedicated design measures have been implemented to improve the response of the plant in case of a postulated severe accident (SA) with core melting. This way not only the frequency of large-early-releases (LERF) but also the related radiological consequences are drastically reduced. Situations that potentially lead to high loads that can challenge the short-term integrity of the containment, like RPV melt-through under high pressure, energetic hydrogen/steam explosions, as well as long-term containment failure caused by internal over-pressure are avoided by a combination of preventive measures and dedicated systems. At the example of the EPR{sup TM}, the paper gives an overview of the severe accident mitigation strategy and the related measures and systems of AREVAs current Gen 3+ reactors, with special focus on the function of the core melt stabilization system.

Areva - Revenue up by 6% in the first half of 2009

International Nuclear Information System (INIS)

2009-01-01

In Nuclear, the levels of activity among the various divisions and their contribution to revenues can vary significantly from one half of the year to the next, which affects relative group performance over the period in question. Like-for-like growth for the first half of 2008 had thus reached 18.6% compared to the first half of 2007, due to several positive events, in particular exceptional sales in Asia in the Front-End division, favourable seasonality in Services, and a very high concentration of production in Recycling (Back-End). These events, which resulted in achieving more than 80% of nuclear 2008 operating income in the first six months and about 48% of sales revenues, illustrate the non-representative nature of the half-year performance in terms of usual profitability profile of nuclear activities. As of June 30, 2009, AREVA had a backlog of 48.9 billion euro, up 28.2% compared to June 30, 2008 and a slight increase compared to end of year 2008. In Nuclear, the backlog of orders came to 42.9 billion euro at June 30, 2009, 32.7% ahead of figures for June 30, 2008. In Transmission and Distribution, the order backlog on June 30, 2009 came to 6.0 billion euro, an increase of 3.0% over one year. In the first half of 2009, AREVA recorded revenues of 6,522 million euro, representing a 5.7% rise (+2.8% like-for-like) compared to the first half of 2008. Revenues outside France were up 12% to 4,758 million euro or 73% of total revenues. In the first half, revenue from Nuclear businesses came to 3,906 million euro, remaining stable compared to the same period last year (-2.9% LFL). The Transmission and Distribution division recorded revenues of 2,614 million euro, up 14.5% (+12.5% LFL), illustrating a good flow in the order backlog for Products (+11.8% LFL) and Systems (+15.1% LFL). Sales revenue for the second quarter of 2009 rose to 3,519 million euro, for growth of 3.5% (+1.9% LFL) compared with the second quarter of 2008. The Nuclear division recorded sales

Lessons learned from MELOX plant operation and support to design of new MOX fuel fabrication plants

International Nuclear Information System (INIS)

Tourre, Joel; Gattegno, Robert; Guay, Philippe; Bariteau, Jean-Pierre

2005-01-01

AREVA is participating in the design of the US MOX Fuel Fabrication Facility (MFFF). To support this project and allow the U.S. Department of Energy (DOE) client to reap full benefit from the MELOX operating experience, AREVA, through COGEMA and its engineering subsidiary SGN have implemented a rigorous process to prudently apply MELOX Lessons Learned to the MFFF design. This paper describes the Lessons Learned process, how the process supports the advancement of fuel fabrication technology and, how the results of the process are benefiting the client. (author)

Headlines... Areva on the way toward centrifugation

International Nuclear Information System (INIS)

Anon.

2004-01-01

The French industrial group Areva, that gathers Cogema and Framatome-ANP, has entered into a partnership with the British nuclear consortium Urenco for creating ETC (enrichment technology company) in order to replace its uranium enrichment facility (Georges-Besse-I) that is planned to close in 2012 by a new one (George-Besse-II) that will enter into service as early as 2007. The new facility will be based on the centrifugation technique developed by Urenco, this technique will cut the consumption of electricity by 3 in comparison with the gaseous diffusion technique used in the Georges-Besse-I facility. The other asset of the centrifugation technique is that the facility can grow with the number of centrifuges that are set. In 2007 only 7% of the total number of centrifuges will be installed, which will sufficient to satisfy the demand for enriched uranium. The full size of the facility will be reached in 2016 through gradual steps of 10% more centrifuges set every year. (A.C.)

Areva revenue and data for the first quarter of 2008

International Nuclear Information System (INIS)

2008-01-01

First quarter 2008 revenue was up 12.1% year-on-year, to 2.769 billion euros. Like-for-like (at constant exchange rates and consolidation scope), growth came to 14.5%. Foreign exchange had a negative impact of 2.5%, or -69 million euros, mainly due to currency translation tied to the US dollar drop compared with the euro. The consolidation scope had a positive impact of +0.7% or 18 million euros, chiefly as a result of the consolidation of VEI Distribution (specializing in medium voltage distribution) and Passoni and Villa (world leader in the manufacture of high voltage bushings) in the Transmission and Distribution division. The main growth engines for first quarter revenue were the Reactors and Services division and the Back End division, with growth of 29.7% (+36.8% LFL1) and 13.8% (+14.1% LFL1) respectively. Outside France, revenue rose to 1.857 billion euros, compared with 1.753 billion euros in the first quarter of 2007. This represents 67% of total revenue. As a reminder, the group points out that: - revenue can vary significantly from one quarter to the next in the nuclear businesses, and quarterly operations should therefore not be taken as a reliable basis for annual projections; - the foreign exchange impact mentioned in this release comes from the translation of subsidiary accounts into the group's unit of account, and primarily reflects the US dollar in relation to the euro. AREVA also points out that its foreign exchange hedging policy for commercial operations aims to shield profitability from fluctuations in exchange rates in relation to the euro

ARTEMIS: The core simulator of AREVA NP's next generation coupled neutronics/thermal-hydraulics code system ARCADIAR

International Nuclear Information System (INIS)

Hobson, Greg; Merk, Stephan; Bolloni, Hans-Wilhelm; Breith, Karl-Albert; Curca-Tivig, Florin; Van Geemert, Rene; Heinecke, Jochen; Hartmann, Bettina; Porsch, Dieter; Tiles, Viatcheslav; Dall'Osso, Aldo; Pothet, Baptiste

2008-01-01

AREVA NP has developed a next-generation coupled neutronics/thermal-hydraulics code system, ARCADIA R , to fulfil customer's current demands and even anticipate their future demands in terms of accuracy and performance. The new code system will be implemented world-wide and will replace several code systems currently used in various global regions. An extensive phase of verification and validation of the new code system is currently in progress. One of the principal components of this new system is the core simulator, ARTEMIS. Besides the stand-alone tests on the individual computational modules, integrated tests on the overall code are being performed in order to check for non-regression as well as for verification of the code. Several benchmark problems have been successfully calculated. Full-core depletion cycles of different plant types from AREVA's French, American and German regions (e.g. N4 and KONVOI types) have been performed with ARTEMIS (using APOLLO2-A cross sections) and compared directly with current production codes, e.g. with SCIENCE and CASCADE-3D, and additionally with measurements. (authors)

Means, methods and performances of the AREVA's HTR compact controls

International Nuclear Information System (INIS)

Banchet, J.; Guillermier, P.; Tisseur, D.; Vitali, M. P.

2008-01-01

In the AREVA's HTR development program, the reactor plant is composed of a prismatic core containing graphite cylindrical fuel elements, called compacts, where TRISO particles are dispersed. Starting from its past compacting process, the latter being revamped through the use of state of the art equipments, CERCA, 100% AREVA NP's subsidiary, was able to recover the quality of past compacts production. The recovered compacting process is composed of the following manufacturing steps: graphite matrix granulation, mix between the obtained granulates and particles, compacting and calcining at low pressure and temperature. To adapt this past process to new manufacturing equipments, non destructive examination tests were carried out to assess the compact quality, the latter being assessed via in house developed equipments and methods at each step of the design of experiments. As for the manufacturing process, past quality control methods were revamped to measure compact dimensional features (diameter, perpendicularity and cone effect), visual aspect, SiC layer failure fraction (via anodic disintegration and burn leach test) and homogeneity via 2D radiography coupled to ceramography. Although meeting quality requirements, 2D radiography method could not provide a quantified specification for compact homogeneity characterization. This limitation yielded the replacement of this past technique by a method based on X-Ray tomography. Development was conducted on this new technique to enable the definition of a criterion to quantify compact homogeneity, as well as to provide information about the distances in between particles. This study also included a comparison between simulated and real compacts to evaluate the accuracy of the technique as well as the influence of particle packing fraction on compact homogeneity. The developed quality control methods and equipments guided the choices of manufacturing parameters adjustments at the development stage and are now applied for

77 FR 50376 - Drawbridge Operation Regulation, Atlantic Intracoastal Waterway (AIWW); Wrightsville Beach, NC...

Science.gov (United States)

2012-08-21

... duration that the moveable bridges will be maintained in the closed position. The races have been reserved... of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8; and the Isabel S. Holmes...

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

Status of safety at Areva group facilities. 2006 annual report; Etat de surete des installations nucleaires. Rapport annuel 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

This report presents a snapshot of nuclear safety and radiation protection conditions in the AREVA group's nuclear installations in France and abroad, as well as of radiation protection aspects in service activities, as identified over the course of the annual inspections and analyses program carried out by the General Inspectorate in 2006. This report is presented to the AREVA Supervisory Board, communicated to the labor representation bodies concerned, and made public. In light of the inspections, appraisals and coordination missions it has performed, the General Inspectorate considers that the nuclear safety level of the AREVA group's nuclear installations is satisfactory. It particularly noted positive changes on numerous sites and efforts in the field of continuous improvement that have helped to strengthen nuclear safety. This has been possible through the full involvement of management teams, an improvement effort initiated by upper management, actions to increase personnel awareness of nuclear safety culture, and supervisors' heightened presence around operators. However, the occurrence of certain events in facilities has led us to question the nuclear safety repercussions that the changes to activities or organization on some sites have had. In these times of change, drifts in nuclear safety culture have been identified. The General Inspectorate considers that a preliminary analysis of the human and organizational factors of these changes, sized to match the impact the change has on nuclear safety, should be made to ensure that a guaranteed level of nuclear safety is maintained (allowance for changes to references, availability of the necessary skills, resources of the operating and support structures, etc.). Preparations should also be made to monitor the changes and spot any telltale signs of drift in the application phase. Managers should be extra vigilant and the occurrence of any drift should be systematically dealt with ahead of

Areva revenue and data for the first quarter of 2008; Areva informations et chiffre d'affaires relatifs au 1. trimestre de l'exercice 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

First quarter 2008 revenue was up 12.1% year-on-year, to 2.769 billion euros. Like-for-like (at constant exchange rates and consolidation scope), growth came to 14.5%. Foreign exchange had a negative impact of 2.5%, or -69 million euros, mainly due to currency translation tied to the US dollar drop compared with the euro. The consolidation scope had a positive impact of +0.7% or 18 million euros, chiefly as a result of the consolidation of VEI Distribution (specializing in medium voltage distribution) and Passoni and Villa (world leader in the manufacture of high voltage bushings) in the Transmission and Distribution division. The main growth engines for first quarter revenue were the Reactors and Services division and the Back End division, with growth of 29.7% (+36.8% LFL1) and 13.8% (+14.1% LFL1) respectively. Outside France, revenue rose to 1.857 billion euros, compared with 1.753 billion euros in the first quarter of 2007. This represents 67% of total revenue. As a reminder, the group points out that: - revenue can vary significantly from one quarter to the next in the nuclear businesses, and quarterly operations should therefore not be taken as a reliable basis for annual projections; - the foreign exchange impact mentioned in this release comes from the translation of subsidiary accounts into the group's unit of account, and primarily reflects the US dollar in relation to the euro. AREVA also points out that its foreign exchange hedging policy for commercial operations aims to shield profitability from fluctuations in exchange rates in relation to the euro.

AREVA Adhesive Technology. A method to mitigate and/or prevent leaks in pools with stainless steel liners Georg Kramer AREVA GmbH IBOC-G

International Nuclear Information System (INIS)

Kraemer, G.

2013-01-01

Repair methods with conventional welding technique are not promising as a preventative measure mostly due to cost and time issues. With the provided repair method, the AREVA adhesive technology, it is possible to stop existing leaks and work as a prophylactic measure against future penetration from the concrete side of the pool. This technique can cover the failure mechanisms from weld failures over corrosion to mechanical stresses. Another advantage of the adhesive technology is the possibility of using remote-controlled underwater repair methods which are particularly beneficial in the repair of leaks in spent fuel pools. Extensive laboratory testing and longstanding successful experience in nuclear power plants have proved the suitability of the adhesive technology as active and proactive methods to minimize leakages in pools.

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

Areva at March 31, 2014: Downturn in revenue as anticipated, to euro 1.781 bn (-17.3% like for like), Backlog of euro 40.2 bn

International Nuclear Information System (INIS)

Duperray, Julien; Berezowskyj, Katherine; Grange, Aurelie; Rosso, Jerome; Thebault, Alexandre; Scorbiac, Marie de; Repaire, Philippine du

2014-01-01

Following the marked growth of the nuclear operations in 2013, thanks in particular to the strength of recurring activities and the contribution of exceptional items such as significant uranium sales volumes and non-recurring foreign contracts, revenue in the first quarter of the year fell sharply, as Areva had anticipated. A strong seasonal effect will materialize in 2014, with greater activity to be expected in the second half of the year. As indicated when releasing 2013 annual results, the current economic environment is still unfavorable, with market prices deteriorating in the front end of the cycle and lackluster demand from customers for installed base services. AREVA's operations generated consolidated revenue of 1.781 billion euros in the first quarter of 2014, a decrease of 18.1% (-17.3 % like for like) compared with the same period in 2013. The Front End Business Group (BG) reported strong growth of +59.0% (+59.8% like for like). Revenue was down in the Mining, Reactors and Services, Back End and Renewable Energies BGs, at -63.0% (-62.3% like for like), -14.1% (-12.5% like for like), -41.7% (-41.6% like for like) and -38.2% (-34.6% like for like) respectively. Foreign exchange had a negative impact of 18 million euros over the period, while the change in consolidation scope had a negative impact of 3 million euros. The group's backlog reached 40.2 billion euros at March 31, 2014, a decrease of 2.9% compared with December 31, 2013 and of 8.8% year on year

Solid cancer mortality associated with chronic external radiation exposure at the French atomic energy commission and nuclear fuel company.

Science.gov (United States)

Metz-Flamant, C; Samson, E; Caër-Lorho, S; Acker, A; Laurier, D

2011-07-01

Studies of nuclear workers make it possible to directly quantify the risks associated with ionizing radiation exposure at low doses and low dose rates. Studies of the CEA (Commissariat à l'Energie Atomique) and AREVA Nuclear Cycle (AREVA NC) cohort, currently the most informative such group in France, describe the long-term risk to nuclear workers associated with external exposure. Our aim is to assess the risk of mortality from solid cancers among CEA and AREVA NC nuclear workers and its association with external radiation exposure. Standardized mortality ratios (SMRs) were calculated and internal Poisson regressions were conducted, controlling for the main confounding factors [sex, attained age, calendar period, company and socioeconomic status (SES)]. During the period 1968-2004, there were 2,035 solid cancers among the 36,769 CEA-AREVA NC workers. Cumulative external radiation exposure was assessed for the period 1950-2004, and the mean cumulative dose was 12.1 mSv. Mortality rates for all causes and all solid cancers were both significantly lower in this cohort than in the general population. A significant excess of deaths from pleural cancer, not associated with cumulative external dose, was observed, probably due to past asbestos exposure. We observed a significant excess of melanoma, also unassociated with dose. Although cumulative external dose was not associated with mortality from all solid cancers, the central estimated excess relative risk (ERR) per Sv of 0.46 for solid cancer mortality was higher than the 0.26 calculated for male Hiroshima and Nagasaki A-bomb survivors 50 years or older and exposed at the age of 30 years or older. The modification of our results after stratification for SES demonstrates the importance of this characteristic in occupational studies, because it makes it possible to take class-based lifestyle differences into account, at least partly. These results show the great potential of a further joint international study of

REVA Advanced Fuel Design and Codes and Methods - Increasing Reliability, Operating Margin and Efficiency in Operation

Energy Technology Data Exchange (ETDEWEB)

Frichet, A.; Mollard, P.; Gentet, G.; Lippert, H. J.; Curva-Tivig, F.; Cole, S.; Garner, N.

2014-07-01

Since three decades, AREVA has been incrementally implementing upgrades in the BWR and PWR Fuel design and codes and methods leading to an ever greater fuel efficiency and easier licensing. For PWRs, AREVA is implementing upgraded versions of its HTP{sup T}M and AFA 3G technologies called HTP{sup T}M-I and AFA3G-I. These fuel assemblies feature improved robustness and dimensional stability through the ultimate optimization of their hold down system, the use of Q12, the AREVA advanced quaternary alloy for guide tube, the increase in their wall thickness and the stiffening of the spacer to guide tube connection. But an even bigger step forward has been achieved a s AREVA has successfully developed and introduces to the market the GAIA product which maintains the resistance to grid to rod fretting (GTRF) of the HTP{sup T}M product while providing addition al thermal-hydraulic margin and high resistance to Fuel Assembly bow. (Author)

Phase 1A Final Report for the AREVA Team Enhanced Accident Tolerant Fuels Concepts

Energy Technology Data Exchange (ETDEWEB)

Morrell, Mike E. [AREVA Federal Services LLC, Charlotte, NC (United States)

2015-03-19

In response to the Department of Energy (DOE) funded initiative to develop and deploy lead fuel assemblies (LFAs) of Enhanced Accident Tolerant Fuel (EATF) into a US reactor within 10 years, AREVA put together a team to develop promising technologies for improved fuel performance during off normal operations. This team consisted of the University of Florida (UF) and the University of Wisconsin (UW), Savannah River National Laboratory (SRNL), Duke Energy and Tennessee Valley Authority (TVA). This team brought broad experience and expertise to bear on EATF development. AREVA has been designing; manufacturing and testing nuclear fuel for over 50 years and is one of the 3 large international companies supplying fuel to the nuclear industry. The university and National Laboratory team members brought expertise in nuclear fuel concepts and materials development. Duke and TVA brought practical utility operating experience. This report documents the results from the initial “discovery phase” where the team explored options for EATF concepts that provide enhanced accident tolerance for both Design Basis (DB) and Beyond Design Basis Events (BDB). The main driver for the concepts under development were that they could be implemented in a 10 year time frame and be economically viable and acceptable to the nuclear fuel marketplace. The economics of fuel design make this DOE funded project very important to the nuclear industry. Even incremental changes to an existing fuel design can cost in the range of $100M to implement through to LFAs. If this money is invested evenly over 10 years then it can take the fuel vendor several decades after the start of the project to recover their initial investment and reach a breakeven point on the initial investment. Step or radical changes to a fuel assembly design can cost upwards of $500M and will take even longer for the fuel vendor to recover their investment. With the projected lifetimes of the current generation of nuclear power

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

AREVA Developments for an Efficient and Reliable use of Monte Carlo codes for Radiation Transport Applications

Science.gov (United States)

Chapoutier, Nicolas; Mollier, François; Nolin, Guillaume; Culioli, Matthieu; Mace, Jean-Reynald

2017-09-01

In the context of the rising of Monte Carlo transport calculations for any kind of application, AREVA recently improved its suite of engineering tools in order to produce efficient Monte Carlo workflow. Monte Carlo codes, such as MCNP or TRIPOLI, are recognized as reference codes to deal with a large range of radiation transport problems. However the inherent drawbacks of theses codes - laboring input file creation and long computation time - contrast with the maturity of the treatment of the physical phenomena. The goals of the recent AREVA developments were to reach similar efficiency as other mature engineering sciences such as finite elements analyses (e.g. structural or fluid dynamics). Among the main objectives, the creation of a graphical user interface offering CAD tools for geometry creation and other graphical features dedicated to the radiation field (source definition, tally definition) has been reached. The computations times are drastically reduced compared to few years ago thanks to the use of massive parallel runs, and above all, the implementation of hybrid variance reduction technics. From now engineering teams are capable to deliver much more prompt support to any nuclear projects dealing with reactors or fuel cycle facilities from conceptual phase to decommissioning.

Hearing, open to the press, of Ms Anne Lauvergeon, chairwoman of the AREVA board of management, on the company's activities and strategy

International Nuclear Information System (INIS)

2010-01-01

During the hearing, the chairwoman of AREVA's board of management answered questions about some events which occurred in Cadarache (plutonium retention in a plutonium workshop), and about the international strategy of AREVA. First, she outlines that this strategy is based on 'zero CO 2 ' objective. Thus, she evokes the various nuclear reactors her company proposes all over the world, the rather strong position in the biomass sector (transformation of vegetal wastes in electricity) in important countries, the activities in fuel cell technology and in wind energy production. She gives an assessment of the obtained security level in terms of number of accidents per million of working hours. She comments the reactions after the Cadarache incident. Then, she answers questions about these different issues

NSLS-II injector commissioning and initial operation

Energy Technology Data Exchange (ETDEWEB)

Bacha, B.; Blum, E.; Bassi, B.; Bengtsson, J.; Blednykh, A.; Buda, S.; Cheng, W.; Choi, J.; Cuppolo, J.; D Alsace, R.; Davidsaver, M.; DeLong, J.; Doom, L.; Durfee, d.; fliller, R.; Fulkerson, M.; Ganetis, G.; Gao, F.; Gardner, C.; Guo, W.; Heese, R.; Hidaka, Y.; Hu, Y.; Johanson, M.; Kosciuk, B.; Kowalski, S.; Dramer, S.; Krinsky, S.; Li, Y.; Louie, W.; Maggipinto, M.; Marino, P.; Mead, J.; Oliva, G.; Padrazo, D.; Pedersen, K.; Podobedov, B.; Rainer, R.; Rose, J.; Santana, M.; Seletskiy, S.; Shaftan, T.; Singh, O.; Singh, P.; Smalyuk, V.; Smith, R.; Summers, T.; Tagger, J.; Tian, Y.; Wahl, W.; Wang, G.; Weiner, G.; Willeke, F.; Yang, L.; Yang, X.; Zeitler, E.; Zitvogel, E.; Zuhoski, P.

2015-05-03

The injector for the National Synchrotron Light Source II (NSLS-II) storage ring consists of a 3 GeV booster synchrotron and a 200 MeV S-band linac. The linac was designed to produce either a single bunch with a charge of 0.5 nC of electrons or a train of bunches up to 300 ns long containing a total charge of 15 nC. The booster was designed to accelerate up to 15 nC each cycle in a train of bunches up to 300 ns long. Linac commissioning was completed in April 2012. Booster commissioning was started in November 2013 and completed in March 2014. All of the significant design goals were satisfied including beam emittance, energy spread, and transport efficiency. While the maximum booster charge accelerated was only 10 nC, this has proven to be more than sufficient for storage ring commissioning and operation. The injector has operated reliably during storage ring operation since then. Results will be presented showing measurements of linac and booster operating parameters achieved during commissioning and initial operation. Operating experience and reliability during the first year of NSLS-II operation will be discussed.

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

Impact of uranium exploitation by Cogema-Areva subsidiaries in Niger. Assessment of analyses performed by the CRIIRAD laboratory in 2004 and at the beginning of 2005

International Nuclear Information System (INIS)

2005-01-01

After a description of the uranium exploitation context (involved companies, production) in Arlit, Niger, by Cogema-Areva subsidiary companies, this report describes the context of controls performed by the CRIIRAD laboratory. Then, it reports and comments the contamination of underground so-called drinkable waters (contamination risks, Cogema statement, detection of a rather high concentration of alpha emitters, measurements performed in 2004 and 2005). The authors notice that water contamination is known by Cogema. Then, the report analyzes the issue of contaminated scrap metal dispersal, comments and criticizes the attitude of Cogema with respect to the associated risks. It comments the uranate transport accident which occurred in February 2004, the subsequent contamination, actions performed by Cogema, the associated health risks, and the statements made by Areva and Cogema. It also comments and analyzes the risks related to radioactive radon dusts inhalation around different sites and because of some technical practices, and Cogema statements about this issue. In conclusion, the authors outline the need of reinforced controls and of an epidemiological study, and outlines how Areva propagates wrong ideas

Left in the dust. AREVA's radioactive legacy in the desert towns of Niger

International Nuclear Information System (INIS)

Dixon, Andrea A.; Chabrol, Romain; Chareyron, Bruno; Dawe, Alexandra; Schulz, Nina; Teule, Rianne; Tumer, Aslihan

2010-04-01

In one of the poorest countries in the world, ranking last in the Human Development Index of the United Nations Development Programme (UNDP), where more than 40% of children are underweight for their age, water and access to improved water sources is scarce and almost three quarters of the population are illiterate, the French nuclear giant AREVA extracts precious-and deadly-natural resources, earning billions for its Fortune 500 corporation, and leaving little behind but centuries of environmental pollution and health risks for the citizens of Niger. (authors)

77 FR 25652 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway (AIWW), at Wrightsville Beach, NC...

Science.gov (United States)

2012-05-01

... are expected to have minimal impacts on mariners due to the short duration that the moveable bridges... North Carolina Department of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8...

Ultrasonic Examination of Double-Shell Tank 241-AY-101. Examination completed October 2007

International Nuclear Information System (INIS)

Pardini, Allan F.; Weier, Dennis R.

2008-01-01

AREVA NC Inc., under contract from CH2M Hill Hanford Group, has performed an ultrasonic examination of selected portions of Double-Shell Tank 241-AY-101. PNNL is responsible for preparing a report(s) that describes the results of the AREVA ultrasonic examinations. This report is Revision 1 - more data has been added to the original report. The purpose of this examination was to provide information that could be used to evaluate the integrity of the wall of the primary tank. The requirements for the ultrasonic examination of Tank 241-AY-101 were to detect, characterize (identify, size, and locate), and record measurements made of any wall thinning, pitting, or cracks that might be present in the wall of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan, RPP-Plan-27202 (Jensen 2005) and summarized on page 1 of this document, are to be reported to CH2M Hill Hanford Group and the Pacific Northwest National Laboratory for further evaluation. Under the contract with CH2M Hill Hanford Group, all data is to be recorded on electronic media and paper copies of all measurements are provided to Pacific Northwest National Laboratory for third-party evaluation. Pacific Northwest National Laboratory is responsible for preparing a report(s) that describes the results of the AREVA NC Inc. ultrasonic examinations.

23. ATSR congress - Proceedings

International Nuclear Information System (INIS)

2006-11-01

This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of the workers' decree; 19 - H. Mansoux

23. ATSR congress - Proceedings; 23eme congres de l'ATSR - Recueil des conferences

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-11-15

This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of

AREVA Developments for an Efficient and Reliable use of Monte Carlo codes for Radiation Transport Applications

Directory of Open Access Journals (Sweden)

Chapoutier Nicolas

2017-01-01

Full Text Available In the context of the rising of Monte Carlo transport calculations for any kind of application, AREVA recently improved its suite of engineering tools in order to produce efficient Monte Carlo workflow. Monte Carlo codes, such as MCNP or TRIPOLI, are recognized as reference codes to deal with a large range of radiation transport problems. However the inherent drawbacks of theses codes - laboring input file creation and long computation time - contrast with the maturity of the treatment of the physical phenomena. The goals of the recent AREVA developments were to reach similar efficiency as other mature engineering sciences such as finite elements analyses (e.g. structural or fluid dynamics. Among the main objectives, the creation of a graphical user interface offering CAD tools for geometry creation and other graphical features dedicated to the radiation field (source definition, tally definition has been reached. The computations times are drastically reduced compared to few years ago thanks to the use of massive parallel runs, and above all, the implementation of hybrid variance reduction technics. From now engineering teams are capable to deliver much more prompt support to any nuclear projects dealing with reactors or fuel cycle facilities from conceptual phase to decommissioning.

Feedback from the operation of the ISOCS in support to the plutonium facility decommissioning project at the Marcoule UP1 reprocessing plant (France) and possible gain for new projects with new CANBERRA systems

International Nuclear Information System (INIS)

Dogny, S.; Toubon, H.

2009-01-01

After the decision was taken in 1998 to shut-down the operations of the UP1 reprocessing plant in Marcoule (France), where more than 19,000 metric tons of spent nuclear fuel have been reprocessed, decommissioning projects started in the various buildings, particularly in the Plutonium Facility. In this facility many glove boxes had to be decontaminated before dismantling. To have waste compatible with surface storage, the main objective was to prove that each glove box had on hold up of less than 37 GBq (about 10 g) and to determine the corresponding Pu isotopic composition. Historically the method used for such characterisation was based on smears and dose rate measurements to extrapolate the mass of Pu in the glove boxes with a very high uncertainty. In 1998 AREVA-NC decided to deploy new characterization tools to meet the performance goals of the Plutonium Facility Decommissioning Project. These tools consist on portable Germanium gamma spectrometer coupled with MGA Pu isotopic composition and ISOCS 3D modelling codes. (authors)

The AREVA integrated and sustainable concept of fatigue design, monitoring and re-assessment; AREVA FATIGUE CONCEPT - ein geschlossenes Konzept zur Verfolgung und Optimierung der auf Ermuedung basierenden Schaedigungseffekte von thermisch und mechanisch beanspruchten Kraftwerksbauteilen

Energy Technology Data Exchange (ETDEWEB)

Begholz, Steffen; Rudolph, Juergen [AREVA NP GmbH, Erlangen (Germany)

2008-07-01

Prevention of fatigue damage of components is an important topic with respect to safety and availability of a nuclear power plant. The issue of fatigue monitoring should be of primary interest throughout service life. Based on the changing general framework, i.e. planning of new plants with a projected lifetime of 60 years and the lifetime extension of existing plants AREVA is focussing R and D activities on improved detection methods. Primary objective is the realistic determination of the actual usage level of reactor components. The fatigue monitoring is supposed to enhance cost optimization and minimize inspection frequency. Fatigue monitoring should be implemented at the beginning of start-up period since the high loads during this phase introduce a significant contribution to the usage level. AREVA recommends the use of the FAMOS (fatigue monitoring system) for the assessment of the realistic transient loads and the data processing with respect to fatigue evaluation. Every 10 years the actual usage levels should be evaluated in detail according to the standards, based on measured load data. The fatigue evaluation is usually performed using finite element analyses taking into account the transient temperature loads at the component, dependent on the component demands based on elastic or elasto-plastic material behaviour. Potential problematic areas can be identified reliably. Direct measurement of fatigue damage, refined analysis concepts (short crack fracture mechanics, and ratcheting simulation) are supposed to support the concept. [German] Die Vermeidung von Ermuedungsschaeden an Komponenten der nuklearen Kraftwerkstechnik ist ein wichtiges Thema in Hinblick auf die Aufrechterhaltung der Anlagensicherheit sowie auf die Erhoehung der Verfuegbarkeit. Das Thema Ermuedungsueberwachung sollte somit waehrend der gesamten Laufzeit eines Kraftwerkes mit hoher Aufmerksamkeit verfolgt werden. Vor diesem Hintergrund und den sich aendernden Rahmenbedingungen, wie z

Areva - Half year financial report June 30, 2009

International Nuclear Information System (INIS)

2009-01-01

This half-year financial report contains statements on the objectives, prospects and growth areas for the AREVA group. It gives a view of the net worth, the financial position and the income of the company and all the companies included in consolidation. It presents the major events that occurred during the first six months of the fiscal year, of their effect on the financial statements and of the main transactions between related parties. It gives a description of the main risks and main uncertainties for the remaining six months of the financial year. Content: 1 - Half-year business report: Significant events, Summary data, Segment reporting, Backlog, Income statement, Review by division, Cash flow, Balance sheet items, Events subsequent to closing, Outlook; 2 - Statutory auditors' report on the financial information for the 2009 half-year - period January 1 to June 30, 2009: Condensed consolidated financial statements at June 30, 2009, Consolidated income statement, Consolidated comprehensive income, Consolidated balance sheet, Consolidated cash flow statement, Consolidated statement of changes in equity, Segment reporting, Notes to the consolidated financial statements for the period ending June 30, 2009

AREVA General Inspectorate Annual Report 2013 - Status of safety in nuclear facilities

International Nuclear Information System (INIS)

Oursel, Luc; Riou, Jean

2014-06-01

This annual report by AREVA's General Inspectorate deals with the status of nuclear safety and radiation protection in the group's facilities and operations over the course of 2013. Based on the findings made during implementation of the annual inspection program, this annual report also includes the results of the analysis of significant events and the observations and assessments of specialists in the Safety Health Security Sustainable Development Department (SHSSDD), supplemented by regular interaction with the safety regulators, different government agencies, stakeholders and other nuclear operators. Additionally, this report presents the action plans put into motion and the directions taken for continuous improvement in risk prevention for operations conducted in France and internationally. In 2013, the level of safety in the group's nuclear facilities and operations remained satisfactory, although improvements are necessary in some domains. This report is based on established indicators, analyses of reported events, responses to commitments made to the regulators, and the results of different improvement actions reported on in the inspected and supported entities. In 2013, no level 2 event on the International Nuclear and Radiological Event Scale (INES) was reported, the bottom-up reporting of weak signals was confirmed, dose levels were low and there were no radiological impacts on the environment. The General Inspectorate conducted 45 inspections in 30 of the group's entities in 2013. Of these, 10 concerned sites outside France and 7 were conducted following events or particular situations. These inspections gave rise to 176 recommendations, which the inspected entities have translated into action plans. Verification of these different action plans according to planned procedures and announced schedules gave rise to 16 follow-up inspections. The major lessons learned from these inspections relate to project management, facility compliance and operational

Decontamination in preparation for dismantlement - AREVA's chemical decontamination technologies, projects performed and results obtained in the period 2011-2016

International Nuclear Information System (INIS)

Topf, C.; Sempere Belda, L.

2017-01-01

As a consequence of the nuclear phase-out decreed by the German government, several nuclear power plants in the country have already ceased operation. The remaining ones will cease operation by 2022. This has turned Germany into one of the most active regions worldwide in the field of nuclear decommissioning, with new and emerging technologies being deployed on the field, and already preexisting technologies being put to the test, optimized and developed into full maturity. The chemistry services division of AREVA GmbH has already performed 5 Full System Decontaminations (FSD) in preparation for decommissioning in this period - three in PWRs and two in BWRs - along with other international projects of relevance for decommissioning operations. During a FSD, the complete primary circuit of a nuclear power plant including auxiliary systems is subject to a chemical treatment; designed to remove radioactive matter accumulated onto system surfaces during operation. Through the effective removal of this radioactive accumulations contact dose rates on the different components of the primary circuit can be consistently reduced by factors larger than 50. This results in much lower ambient dose rates and, hence, in very significant dose savings for subsequent decommissioning activities. Additionally, dismantlement operations of large components are considerably simplified and can be performed under conditions that wouldn't have been possible before. The project specific objectives and challenges, the technologies employed, and the results obtained are presented and commented here. (authors)

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

DIWA trademark. AREVA's approach of intelligent computer-aided support of water chemistry monitoring in power plants

International Nuclear Information System (INIS)

Fandrich, Joerg

2011-01-01

The complexity of power plant operation makes stringent demands on the chemical quality of the coolant in process systems and loops. Optimal water chemistry ensures high corrosion resistance of these systems and is thus essential for safe and economic long term plant operation. The market offers a huge variety of commercial software packages for water chemistry control. Most of these computer programs have to be considered as data analysis or, respectively, data acquisition programs. Some of them require manual data input (Laboratory Information Management Systems), others are capable of performing a fully automated data acquisition. However, the plant operator typically is left alone with the actual interpretation of all collected and validated data, which would be the main characteristic feature of an analysis (or monitoring) system. The data validation is typical being performed by means of numerical methods in the broadest sense. This activity requires a long working experience and specific skills by the plant chemistry operator. True diagnostic systems need to be significantly more advanced. They contain the capability of data interpretation and derivation of specific diagnoses. This is combined with additional explanations on how the diagnoses were derived. Additionally, further recommendations are offered on how to proceed to reach the normal operational behavior as soon as possible. AREVA's DIWA trademark system features a fuzzy logic expert system that is based on expert knowledge. It is built on symptoms, which are combined in rules as part of the fuzzy tool set. These components can be edited without programming knowledge, which significantly reduces training efforts. It makes the system more robust, more compact and simpler compared to other so-called expert systems. DIWA trademark represents the knowledge in a natural way, in which other conventional expert system may have difficulties or need a larger set of rule algorithms. (orig.)

AREVA solutions to licensing challenges in PWR and BWR reload and safety analysis

Energy Technology Data Exchange (ETDEWEB)

Curca-Tivig, Florin [AREVA GmbH, Erlangen (Germany)

2016-05-15

Regulatory requirements for reload and safety analyses are evolving: new safety criteria, request for enlarged qualification databases, statistical applications, uncertainty propagation.. In order to address these challenges and access more predictable licensing processes, AVERA is implementing consistent code and methodology suites for PWR and BWR core design and safety analysis, based on first principles modeling and extremely broad verification and validation data base. Thanks to the high computational power increase in the last decades methods' development and application now include new capabilities. An overview of the main AREVA codes and methods developments is given covering PWR and BWR applications in different licensing environments.

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

News from the world

International Nuclear Information System (INIS)

Anon.

2009-01-01

The Chinese government has given its final approval to build the nuclear power plant in Taishan, which must be equipped with two Areva reactors in Guangdong. Areva delivers two steam generators at T.M.I.. The United arab emirates have approved a law establishing the legal framework for their development programme in civil nuclear energy, a step required before the award of a contract estimated at 41 million dollars. The emirates government undertakes to waive the local enrichment of uranium. Armenia wants to produce 40% of its electric power by nuclear energy in 2025. The Osiris reactor restarted production of radioisotopes for medical use. It ensures the provision of 7% of world production. (N.C.)

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

Industrial Program of Waste Management - Cigeo Project - 13033

Energy Technology Data Exchange (ETDEWEB)

Butez, Marc [Agence nationale pour la gestion des dechets radioactifs - Andra, 1-7, rue Jean Monnet 92298 Chatenay-Malabry (France); Bartagnon, Olivier; Gagner, Laurent [AREVA NC Tour AREVA 1 place de la Coupole 92084 Paris La Defense (France); Advocat, Thierry; Sacristan, Pablo [Commissariat a l' energie atomique et aux energies alternatives - CEA, CEA-SACLAY 91191 Gif sur Yvette Cedex (France); Beguin, Stephane [Electricite de France - EDF, Division Combustible Nucleaire, 1, Place Pleyel Site Cap Ampere93282 Saint Denis (France)

2013-07-01

The French Planning Act of 28 June 2006 prescribed that a reversible repository in a deep geological formation be chosen as the reference solution for the long-term management of high-level and intermediate-level long-lived radioactive waste. It also entrusted the responsibility of further studies and design of the repository (named Cigeo) upon the French Radioactive Waste Management Agency (Andra), in order for the review of the creation-license application to start in 2015 and, subject to its approval, the commissioning of the repository to take place in 2025. Andra is responsible for siting, designing, implementing, operating the future geological repository, including operational and long term safety and waste acceptance. Nuclear operators (Electricite de France (EDF), AREVA NC, and the French Commission in charge of Atomic Energy and Alternative Energies (CEA) are technically and financially responsible for the waste they generate, with no limit in time. They provide Andra, on one hand, with waste packages related input data, and on the other hand with their long term industrial experiences of high and intermediate-level long-lived radwaste management and nuclear operation. Andra, EDF, AREVA and CEA established a cooperation agreement for strengthening their collaborations in these fields. Within this agreement Andra and the nuclear operators have defined an industrial program for waste management. This program includes the waste inventory to be taken into account for the design of the Cigeo project and the structural hypothesis underlying its phased development. It schedules the delivery of the different categories of waste and defines associated flows. (authors)

Industrial Program of Waste Management - Cigeo Project - 13033

International Nuclear Information System (INIS)

Butez, Marc; Bartagnon, Olivier; Gagner, Laurent; Advocat, Thierry; Sacristan, Pablo; Beguin, Stephane

2013-01-01

The French Planning Act of 28 June 2006 prescribed that a reversible repository in a deep geological formation be chosen as the reference solution for the long-term management of high-level and intermediate-level long-lived radioactive waste. It also entrusted the responsibility of further studies and design of the repository (named Cigeo) upon the French Radioactive Waste Management Agency (Andra), in order for the review of the creation-license application to start in 2015 and, subject to its approval, the commissioning of the repository to take place in 2025. Andra is responsible for siting, designing, implementing, operating the future geological repository, including operational and long term safety and waste acceptance. Nuclear operators (Electricite de France (EDF), AREVA NC, and the French Commission in charge of Atomic Energy and Alternative Energies (CEA) are technically and financially responsible for the waste they generate, with no limit in time. They provide Andra, on one hand, with waste packages related input data, and on the other hand with their long term industrial experiences of high and intermediate-level long-lived radwaste management and nuclear operation. Andra, EDF, AREVA and CEA established a cooperation agreement for strengthening their collaborations in these fields. Within this agreement Andra and the nuclear operators have defined an industrial program for waste management. This program includes the waste inventory to be taken into account for the design of the Cigeo project and the structural hypothesis underlying its phased development. It schedules the delivery of the different categories of waste and defines associated flows. (authors)

75 FR 18253 - R.J. Corman Railroad Property, LLC-Acquisition Exemption-NC Railroad, Inc.

Science.gov (United States)

2010-04-09

... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Finance Docket No. 35363] R.J. Corman Railroad Property, LLC--Acquisition Exemption--NC Railroad, Inc. R.J. Corman Railroad Property... exemption in STB Finance Docket No. 35364, R.J. Corman Railroad Company/Bardstown Line--Lease and Operation...

Task Order 22 – Engineering and Technical Support, Deep Borehole Field Test. AREVA Summary Review Report

Energy Technology Data Exchange (ETDEWEB)

Denton, Mark A. [AREVA Federal Services, Charlotte, NC (United States)

2016-01-19

Under Task Order 22 of the industry Advisory and Assistance Services (A&AS) Contract to the Department of Energy (DOE) DE-NE0000291, AREVA has been tasked with providing assistance with engineering, analysis, cost estimating, and design support of a system for disposal of radioactive wastes in deep boreholes (without the use of radioactive waste). As part of this task order, AREVA was requested, through a letter of technical direction, to evaluate Sandia National Laboratory’s (SNL’s) waste package borehole emplacement system concept recommendation using input from DOE and SNL. This summary review report (SRR) documents this evaluation, with its focus on the primary input document titled: “Deep Borehole Field Test Specifications/M2FT-15SN0817091” Rev. 1 [1], hereafter referred to as the “M2 report.” The M2 report focuses on the conceptual design development for the Deep Borehole Field Test (DBFT), mainly the test waste packages (WPs) and the system for demonstrating emplacement and retrieval of those packages in the Field Test Borehole (FTB). This SRR follows the same outline as the M2 report, which allows for easy correlation between AREVA’s review comments, discussion, potential proposed alternatives, and path forward with information established in the M2 report. AREVA’s assessment focused on three primary elements of the M2 report: the conceptual design of the WPs proposed for deep borehole disposal (DBD), the mode of emplacement of the WP into DBD, and the conceptual design of the DBFT. AREVA concurs with the M2 report’s selection of the wireline emplacement mode specifically over the drill-string emplacement mode and generically over alternative emplacement modes. Table 5-1 of this SRR compares the pros and cons of each emplacement mode considered viable for DBD. The primary positive characteristics of the wireline emplacement mode include: (1) considered a mature technology; (2) operations are relatively simple; (3) probability of a

Addressing Obsolescence in Operating Power Stations by Implementation of Safety Related Digital Upgrades Paper for Spanish Nuclear Society

Energy Technology Data Exchange (ETDEWEB)

Legrand, R.

2014-07-01

Obsolescence of Instrumentation and Controls is a major problem facing operating Nuclear Power Stations globally. AREVA is the only supplier that has supported the successful licensing, engineering, procurement, installation and commissioning of a full-scope digital Instrumentation and Control (I and C) Protection System in the United States. (Author)

Call for tender - Areva-Alstom: watershed in wind energy - Technological duel on the open sea; Appel d'offres - Areva-Alstom: partage des eaux dans l'eolien - Duel technologique au grand large

Energy Technology Data Exchange (ETDEWEB)

Dupin, L.

2012-02-16

The author comments the answers to a call for tender made by the French government and concerning five offshore wind farm sites (Le Treport, Fecamp, Courseulles sur Mer, Saint-Brieuc and Saint-Nazaire). As they are present within the three consortiums, Areva and Alstom should provide the wind turbines. This would result in the construction by Alstom of two blade and mast factories and two turbine and pad factories. For both companies, this market of 500 to 600 turbines is an opportunity. Many jobs are at stake. They push themselves forward for their experience or their innovation capacity. But their wind turbines will be based on foreign (Spanish or German) technology

Potential Applications for Nuclear Energy besides Electricity Generation: AREVA Global Perspective of HTR Potential Market

International Nuclear Information System (INIS)

Soutworth, Finis; Gauthier, Jean-Claude; Lecomte, Michel; Carre, Franck

2007-01-01

Energy supply is increasingly showing up as a major issue for electricity supply, transportation, settlement, and process heat industrial supply including hydrogen production. Nuclear power is part of the solution. For electricity supply, as exemplified in Finland and France, the EPR brings an immediate answer; HTR could bring another solution in some specific cases. For other supply, mostly heat, the HTR brings a solution inaccessible to conventional nuclear power plants for very high or even high temperature. As fossil fuels costs increase and efforts to avoid generation of Greenhouse gases are implemented, a market for nuclear generated process heat will develop. Following active developments in the 80's, HTR have been put on the back burner up to 5 years ago. Light water reactors are widely dominating the nuclear production field today. However, interest in the HTR technology was renewed in the past few years. Several commercial projects are actively promoted, most of them aiming at electricity production. ANTARES is today AREVA's response to the cogeneration market. It distinguishes itself from other concepts with its indirect cycle design powering a combined cycle power plant. Several reasons support this design choice, one of the most important of which is the design flexibility to adapt readily to combined heat and power applications. From the start, AREVA made the choice of such flexibility with the belief that the HTR market is not so much in competition with LWR in the sole electricity market but in the specific added value market of cogeneration and process heat. In view of the volatility of the costs of fossil fuels, AREVA's choice brings to the large industrial heat applications the fuel cost predictability of nuclear fuel with the efficiency of a high temperature heat source free of greenhouse gases emissions. The ANTARES module produces 600 MWth which can be split into the required process heat, the remaining power drives an adapted prorated

The French approach through the SMR consortium (CEA, EDF, AREVA, DCNS)

International Nuclear Information System (INIS)

Chenais, J.; Diet, A.; Grondin, Y.; Perrier, S.

2014-01-01

The SMR (Small Modular Reactor) is a new range of nuclear reactors characterized by a low output power (less than 300 MWe) and a standardized modular factory-based construction. Moderate capital costs make this type of reactor very attractive for medium-size power utilities or small countries. A consortium made around the CEA and its industrial partners (EDF, AREVA and DCNS) has performed economic and technical feasibility studies. It appears that the competitiveness of SMR require power production costs around 100 euros/MWh and that SMR will be based on PWR technology with a power output of 150 MWe per unit. 2 types of SMR are proposed: a terrestrial unit and an immersed unit. The concept of the immersed SMR, called Flexblue, is based on an unlimited access to a cold sink (the ocean) and a complete modularity. In both types the standard of safety appears to be high. (A.C.)

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

'Action 2016': AREVA's strategic action plan

International Nuclear Information System (INIS)

Marie, Patricia; Briand, Pauline; Floquet-Daubigeon, Fleur; Michaut, Maxime; De Scorbiac, Marie; Du Repaire, Philippine

2011-01-01

On December 13, 2011, Luc Oursel, CEO, and Pierre Aubouin, Chief Financial Officer presented the group's strategic plan for the period 2012-2016. The plan has been drawn up collectively and is based on a thorough-going analysis and a realistic assessment of perspectives for all group activities and associated resources. Development of nuclear and renewable energies: the fundamentals are unchanged. In this context, the German decision remains an isolated case and the great majority of nuclear programs around the world have been confirmed. More conservative in its projections than the International Energy Agency, the group expects growth of 2.2% annually, reaching 583 GW of installed nuclear capacity by 2030, against 378 GW today. However, the Fukushima accident will lead to delays in launching new programs. 'Action 2016' plan aims to consolidate AREVA's leadership in nuclear energy and become a leading player in renewable energy. The group's strategic action plan 'Action 2016' is based on the following strategic choices: - commercial priority given to value creation, - selectivity in investments, - strengthening of the financial structure. These demand an improvement in the group's performance by 2015. This plan makes nuclear safety a strategic priority for the industrial and commercial performance of the group. This ambitious performance plan for the period 2012-2016 will give the group the wherewithal to withstand a temporary slowdown in the market resulting from the Fukushima accident and to deliver safe and sustainable growth of the business. The plan sets out the strategic direction for the group's employees for the years ahead: taking advantage of the expected growth in nuclear and renewable energies, targeted investment programs, and return to self-financing as of 2014

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Information report sent in according to the Rule's article 146 by the finance, general economy and budget control Commission related to EDF's and Areva's financial situation and perspectives - Nr 4463

International Nuclear Information System (INIS)

Goua, Marc; Rocca Serra, Camille de

2012-01-01

This report presents a synthesis of the most recent information on the both public companies, EDF and AREVA, within the context of their industrial sector. While discussing hypotheses and assessments of future expenses, the report outlines that future expenses related to the electronuclear activity are well provisioned in the accounts of both companies, but that their value is probably under-estimated. As far as EDF is concerned, the authors outline that the international development strategy impacted investment and partnership choices, and that the company should review this posture within a new context. As far as Areva is concerned, they think that the company possesses the required assets to be revived, but this requires rigorous financial and industrial choices

Call for tender - Areva-Alstom: watershed in wind energy - Technological duel on the open sea

International Nuclear Information System (INIS)

Dupin, L.

2012-01-01

The author comments the answers to a call for tender made by the French government and concerning five offshore wind farm sites (Le Treport, Fecamp, Courseulles sur Mer, Saint-Brieuc and Saint-Nazaire). As they are present within the three consortiums, Areva and Alstom should provide the wind turbines. This would result in the construction by Alstom of two blade and mast factories and two turbine and pad factories. For both companies, this market of 500 to 600 turbines is an opportunity. Many jobs are at stake. They push themselves forward for their experience or their innovation capacity. But their wind turbines will be based on foreign (Spanish or German) technology

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

Potential Hazards Relating to Pyrolysis of c-C4F8O, n-C4F10 and c-C4F8 in selected gaseous diffusion plant operations

International Nuclear Information System (INIS)

Trowbridge, L.D.

2000-01-01

As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

The AREVA C3 concept. Customized chemical cleaning as an essential part of steam generator asset management

International Nuclear Information System (INIS)

Weiss, Steffen

2011-01-01

As the nuclear industry moves forward and the world's power demand increases, the continued safe, reliable, and efficient operation of existing plants has become indispensable. For these plants asset management is an essential factor. A crucial part of the plant assets are the steam generators (SG). Not only that the SG tubes are by far the largest boundary between the primary and secondary sides, they are also instrumental in the overall performance of the plant. The main concern for operational lifetime is tube degradation due to either ID or OD corrosion. At the secondary side, sludge and corrosion products accumulate in the SG resulting in the buildup of secondary side deposits. Such deposits can negatively affect the SG performance in different ways, not only by reduction of the heat transfer rates and, thus, by reducing the efficiency of the SG but also as cause or promotion of different types of corrosion phenomena. The cleanliness of the secondary side of SG is of essential interest to all utilities. There is not just one solution for SG asset optimization. The utilities must weigh the pros and cons of SG cleaning, with the associated impact on outage time and cost, versus the potential benefits. Each plant that considers a SG chemical cleaning has different objectives and goals. AREVA has developed the C 3 (Customized Chemical Cleaning - or in short 'C cubed') concept in order to provide the utility with a chemical cleaning method that is tailored to the needs of the individual units and that addresses them directly. (orig.)

Research on NC motion controller based on SOPC technology

Science.gov (United States)

Jiang, Tingbiao; Meng, Biao

2006-11-01

With the rapid development of the digitization and informationization, the application of numerical control technology in the manufacturing industry becomes more and more important. However, the conventional numerical control system usually has some shortcomings such as the poor in system openness, character of real-time, cutability and reconfiguration. In order to solve these problems, this paper investigates the development prospect and advantage of the application in numerical control area with system-on-a-Programmable-Chip (SOPC) technology, and puts forward to a research program approach to the NC controller based on SOPC technology. Utilizing the characteristic of SOPC technology, we integrate high density logic device FPGA, memory SRAM, and embedded processor ARM into a single programmable logic device. We also combine the 32-bit RISC processor with high computing capability of the complicated algorithm with the FPGA device with strong motivable reconfiguration logic control ability. With these steps, we can greatly resolve the defect described in above existing numerical control systems. For the concrete implementation method, we use FPGA chip embedded with ARM hard nuclear processor to construct the control core of the motion controller. We also design the peripheral circuit of the controller according to the requirements of actual control functions, transplant real-time operating system into ARM, design the driver of the peripheral assisted chip, develop the application program to control and configuration of FPGA, design IP core of logic algorithm for various NC motion control to configured it into FPGA. The whole control system uses the concept of modular and structured design to develop hardware and software system. Thus the NC motion controller with the advantage of easily tailoring, highly opening, reconfigurable, and expandable can be implemented.

Information report on nuclear safety and radiation protection of the Tricastin AREVA site - Issue 2014. Figures and information about nuclear safety and radiation protection of the Tricastin AREVA site - Issue 2014

International Nuclear Information System (INIS)

2015-06-01

Published in compliance with the French code of the environment, this report first presents different aspects of the Areva's Tricastin site which comprises five basic nuclear installations or INBs, and seven ICPE (installation classified for environment protection). The activities are dedicated to uranium conversion, uranium enrichment, uranium chemistry, industrial services, and fuel manufacturing. The report presents this important industrial site, describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which occurred on this site and had to be declared, reports the management of releases by this site and the control of the environment. The next part addresses the management of the various wastes produced by the different installations present on this site. The management of other impacts is also reported. The last chapter reviews the actions undertaken in the field of transparency and information

Information report on nuclear safety and radiation protection of the Tricastin AREVA site - Issue 2013. Figures and information about nuclear safety and radiation protection of the Tricastin AREVA site - Issue 2013

International Nuclear Information System (INIS)

2014-06-01

Published in compliance with the French code of the environment, this report first presents different aspects of the Areva's Tricastin site which comprises five basic nuclear installations or INBs, and seven ICPE (installation classified for the protection of the environment). The activities are dedicated to uranium conversion, uranium enrichment, uranium chemistry, industrial services, and fuel manufacturing. The report presents this important industrial site, describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which occurred on this site and had to be declared, reports the management of releases by this site and the control of the environment. The next part addresses the management of the various wastes produced by the different installations present on this site. The management of other impacts is also reported. The last chapter reviews the actions undertaken in the field of transparency and information

77 FR 39521 - Applications and Amendments to Facility Operating Licenses and Combined Licenses Involving...

Science.gov (United States)

2012-07-03

... primary- to-secondary leakage (including locked rotor and control rod ejection) has been shown to remain... Water Reactors with AREVA Topical Report ANP- 10307PA, Revision 0, ``AREVA MCPR Safety Limit Methodology for Boiling Water Reactors,'' in the list of analytical methods that have been reviewed and approved...

Second generation of TELEPERM XS applications successful in operation

International Nuclear Information System (INIS)

Weber, P.

2008-01-01

Safety I and C plays an important part in safety and availability of nuclear power plants. AREVA NP, the nuclear technology enterprise, recently began delivery of the second generation TELEPERM XS digital safety I and C technology. Qinshan 1, the first Chinese-built reactor, had its reactor protection system replaced. The plant has been back on the grid since January 12, 2008. Moreover, the Swedish Ringhals 1 nuclear generating unit has operated a neutron flux measuring system of the second-generation TELEPERM XS since October 2007. Both systems are running to their users' full satisfaction. TELEPERM XS has meanwhile been employed in 49 plants in twelve countries. This safety I and C system by AREVA NP can be used with nearly all reactor lines, for both new reactor designs and upgrading nuclear power plants in operation. Here are some examples of successful installations of reactor protection, reactor control and limiting, neutron flux measurement and Diesel power control systems with TELEPERM XS: the Tianwan 1 and 2 units in China (VVER plants), Oskarsham 2 in Sweden (boiling water reactor), and Neckarwestheim 1 and 2 in Germany (pressurized water reactors). TELEPERM XS systems are being planned for the new plants of Olkiluoto 3 in Finland (EPR), Flamanville 3 in France (EPR), Taishan 1 and 2 in China (EPR), and Ling Ao 3 and 4 in China (CPR 1000). For quick and unproblematic implementation of TELEPERM XS in a plant, the system with all subassemblies, functions, and input/output signals is fully tested in a testing station. For this purpose, AREVA NP built one of the largest testing stations in the world for I and C cabinets, the 'TELEPERM XS Integration Center', at its German location in Erlangen. More than 200 I and C cabinets can be tested simultaneously in these installations. The 'I and C and Electrical Systems' Forum is attached to the testing station. This is where the company presents to its customers and partner firms realistic solutions, in combination

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

Safety challenges after the Fukushima accident for operated installations others than EDF reactors

International Nuclear Information System (INIS)

Sene, Monique; Rollinger, Francois; Lheureux, Yves; Lizot, Marie-Therese; Kerdelhue, M.; Py, M.E.; Leroyer, Veronique; Pultier, Marc; Kassiotis, Christophe; Chambrette, Pierre; Devaux, Pascal; Baron, Yves; Collinet, Jacques

2013-12-01

This document contains Power Point presentations which, within the perspective created by the Fukushima accident, address various aspects of safety issues for installations other than currently operated EDF reactors. These contributions propose: an agenda of additional safety assessments (ECS) performed on these installations and an examination of responses made to prescriptions made on the 16 June 2012; a presentation by the IRSN of ECS performed in Areva plants; a presentation by Areva of arrangements related to these ECS; a presentation of the Manche local information commissions (CLI) and a presentation of their approach according to a white paper for the safety of civil nuclear installations located in the Manche department; a presentation by the IRSN on ECS concerning various basic nuclear installations such as laboratories, experimental reactors and stopped reactors; a presentation by the CEA of ECS of its installations (context, approach, execution and conclusions); a presentation by the ANCCLI about ASN decision and decision projects about the hard core according to ECS (example of the High flux reactor in the ILL in Grenoble)

Palladium-catalyzed Suzuki-Miyaura coupling of amides by carbon-nitrogen cleavage: general strategy for amide N-C bond activation.

Science.gov (United States)

Meng, Guangrong; Szostak, Michal

2016-06-15

The first palladium-catalyzed Suzuki-Miyaura cross-coupling of amides with boronic acids for the synthesis of ketones by sterically-controlled N-C bond activation is reported. The transformation is characterized by operational simplicity using bench-stable, commercial reagents and catalysts, and a broad substrate scope, including substrates with electron-donating and withdrawing groups on both coupling partners, steric-hindrance, heterocycles, halides, esters and ketones. The scope and limitations are presented in the synthesis of >60 functionalized ketones. Mechanistic studies provide insight into the catalytic cycle of the cross-coupling, including the first experimental evidence for Pd insertion into the amide N-C bond. The synthetic utility is showcased by a gram-scale cross-coupling and cross-coupling at room temperature. Most importantly, this process provides a blueprint for the development of a plethora of metal catalyzed reactions of typically inert amide bonds via acyl-metal intermediates. A unified strategy for amide bond activation to enable metal insertion into N-C amide bond is outlined ().

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

Areva - Environmental, social and societal report 2014, Zirconium sites: Jarrie, Ugine, Rugles, Montreuil-Juigne, Paimboeuf

International Nuclear Information System (INIS)

2015-05-01

This report first gives an overview of Areva's zirconium-related activities: those integrated into the nuclear fuel cycle, industrial activities distributed among five production sites (Jarrie, Ugine, Rugles, Montreuil-Juigne, Paimboeuf) with an indication of the various products produced on each site (from zirconia to tubes and sheets). The history and activities of these five plants are briefly described. The next part addresses issues related to health, safety, and the environment: health and safety at work, risk prevention and management, improvement of environmental performance (consumption management, waste control and management), material flows and their management modes in the different plants (indication of input products, activities, output products, and destination). The last part addresses social and societal issues: recruiting, training, ability management, actions for local economic development

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

Operational experience for the latest generation of ATRIUM trademark 10 fuel assemblies

International Nuclear Information System (INIS)

Schoss, Volker; Hoffmann, Petra Britt; Schaefer, Jens

2011-01-01

AREVA NP's ATRIUM trademark 10 product family was first introduced to the BWR market in 1992. Lead test campaigns confirmed the outstanding product performance and justified introduction of reload quantities. Further development of particular product features was demonstrated and implemented in the fuel design to meet highest expectations for reliability and fuel economics. The latest generation called ATRIUM trademark 10XP and subsequently ATRIUM trademark 10XM was introduced in 2002 and 2005, respectively. The first lead test assemblies completed their operation successfully after seven cycles. (orig.)

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

Occurrence of Mycobacterium avium subspecies paratuberculosis and Neospora caninum in Alberta cow-calf operations.

Science.gov (United States)

Pruvot, M; Kutz, S; Barkema, H W; De Buck, J; Orsel, K

2014-11-01

Mycobacterium avium subsp. paratuberculosis (MAP) and Neospora caninum (NC) are two pathogens causing important production limiting diseases in the cattle industry. Significant impacts of MAP and NC have been reported on dairy cattle herds, but little is known about the importance, risk factors and transmission patterns in western Canadian cow-calf herds. In this cross-sectional study, the prevalence of MAP and NC infection in southwest Alberta cow-calf herds was estimated, risk factors for NC were identified, and the reproductive impacts of the two pathogens were assessed. Blood and fecal samples were collected from 840 cows on 28 cow-calf operations. Individual cow and herd management information was collected by self-administered questionnaires and one-on-one interviews. Bayesian estimates of the true prevalence of MAP and NC were computed, and bivariable and multivariable statistical analysis were done to assess the association between the NC serological status and ranch management risk factors, and the clinical effects of the two pathogens. Bayesian estimates of true prevalence indicated that 20% (95% probability interval: 8-38%) of herds had at least one MAP-positive cow, with a within-herd prevalence in positive herds of 22% (8-45%). From the Bayesian posterior distributions of NC prevalence, the median herd-level prevalence was 66% (33-95%) with 10% (4-21%) cow-level prevalence in positive herds. Multivariable analysis indicated that introducing purchased animals in the herd might increase the risk of NC. The negative association of NC with proper carcass disposal and presence of horses on ranch (possibly in relation to herd monitoring and guarding activities), may suggest the importance of wild carnivores in the dynamics of this pathogen in the study area. We also observed an association between MAP and NC serological status and the number of abortions. Additional studies should be done to further examine specific risk factors for MAP and NC, assess the

Attack Helicopter Operations: Art or Science

Science.gov (United States)

1991-05-13

ATTACK HELICOPTER OPERATIONS: ART OR SCIENCE ? BY LIEUTENANT COLONEL JAN CALLEN United States Army DISTRIBUTION STATEMENT A: Approved for public release...TASK IWORK UNIT ELEMENT NO. NO. NO. ACCESSION NC 11. TITLE (Include Socurity Classification) Attack Helicopter Operations: Art or Science ? 12. PERSONAL...OPERATIONS: ART OR SCIENCE ? AN INDIVIDUAL STUDY PROJECT by Lieutenant Colonel Jan Callen United States Army Colonel Greg Snelgrove Project Adviser U.S

Information report on nuclear safety and radiation protection of La Hague AREVA site. Issue 2014

International Nuclear Information System (INIS)

2013-01-01

Published in compliance with the French code of the environment, this report first presents the Areva's La Hague site which comprises several basic nuclear installations (INB), is dedicated to several activities related to the nuclear fuel cycle, is submitted to a constraining legal and regulatory framework, and implements a policy for a sustainable development and continuous progress. The document describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which are classified according to the INES scale and occurred and had to be declared in 2014, describes the management of effluents by the different installations present on this site and the control of the environment. It addresses the waste management and the management of other impacts. It gives an overview of actions undertaken regarding information and transparency. Recommendations of the CHSCT are reported

Information report on nuclear safety and radiation protection of La Hague AREVA site. Issue 2013

International Nuclear Information System (INIS)

2014-01-01

Published in compliance with the French code of the environment, this report first presents the Areva's La Hague site which comprises several basic nuclear installations (INB), is dedicated to several activities related to the nuclear fuel cycle, is submitted to a constraining legal and regulatory framework, and implements a policy for a sustainable development and continuous progress. The document describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which are classified according to the INES scale and occurred and had to be declared in 2013, describes the management of effluents by the different installations present on this site and the control of the environment. It addresses the waste management and the management of other impacts. It gives an overview of actions undertaken regarding information and transparency. Recommendations of the CHSCT are reported

Information report on nuclear safety and radiation protection of the Tricastin AREVA site - Issue 2012

International Nuclear Information System (INIS)

2013-06-01

Published in compliance with the French code of the environment, this report first presents different aspects of the Areva's Tricastin site which comprises five basic nuclear installations or INBs, and seven ICPE (installation classified for the protection of the environment). The activities are dedicated to uranium conversion, uranium enrichment, uranium chemistry, industrial services, and fuel manufacturing. The report presents this important industrial site, describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which occurred on this site and had to be declared, reports the management of releases by this site and the control of the environment. The next part addresses the management of the various wastes produced by the different installations present on this site. The management of other impacts is also reported. The last chapter reviews the actions undertaken in the field of transparency and information

Information report issued in application of the article 146 of the regulation by the Commission for Finances, General Economy, and Budgetary Control on the development perspectives of AREVA and the future of the nuclear sector. Nr 2952

International Nuclear Information System (INIS)

Goua, Marc; Mariton, Herve

2015-01-01

As AREVA displays an unprecedented loss, and is facing a durable and persistent stagnation of its nuclear activities after the Fukushima accident, and as these losses are the consequences of misguided strategic decisions and disputable mining acquisitions, as well as of a problematic management of the main big industrial projects, this report comes after an intervention of the French President on the future of this company. The objectives are a restoration of Areva's competitiveness, and the elaboration of a new partnership between EDF and AREVA with a new definition of their respective roles in the design, manufacturing and selling of nuclear reactors. Notably based on hearings, and on visits of the Flamanville EPR site and of the La Hague reprocessing plant this reports aims at informing the French parliament on the different faced challenges and opportunities. The authors thus give an overview of the group financial situation and describe the important reorganisation issues. They analyse how the group has been weakened by its economic performance and a development mode with uncertain results. They try to define a possible future within the frame of a reorganised nuclear sector based on a high performance group, a good governance of the nuclear sector, an industrially consistent solution, and a relevant position for the French nuclear sector

Progress in the domain of emissions tracking and environment radioactivity monitoring - Proceedings of the technical days organised by the SFRP Environment Section

International Nuclear Information System (INIS)

Calmet, Dominique; Calvez, Marianne; Rivasseau, Corinne Cea; Monfort, Marguerite; Manificat, Guillaume; Pierrard, Olivier; Couvez, Celine; Masson, Olivier; Bruno, Valerie; Renaud, Philippe; Genova, Zhana; Reynal, Nathalie; Le Coz, Eric; Tchilian, Nathalie; Diana, Jean-Jacques; Beguinel, Philippe; Cortes, Pierre; Puydarrieux, Stephane; Brun, Thierry; Devin, Patrick; Clavel, Benoit; Hemidy, Pierre-Yves; Gontier, Gilles; Delloye, Thierry; Mailliat, Alain; Ferreri, Giovanni; LECLERC, Elisabeth

2015-11-01

The Environment Section of the French Society of Radiation Protection (SFRP) organized a technical meeting on the progress made in the domain of emissions tracking and environment radioactivity monitoring. This document brings together the abstracts and the presentations (slides) of the different talks given at the meeting: 1 - Environment monitoring at the global, national and local scale: historical overview (Dominique CALMET, CEA); 2 - Evolution of radioactivity monitoring in the environment from 1960 to the present day (Guillaume MANIFICAT, IRSN); 3 - Euratom's legal framework (Zhana GENOVA, CTE); 4 - Main regulatory changes during the last decade (Nathalie REYNAL, ASN); 5 - Progress of standardization works on radioactive effluent emissions control and environment monitoring (Philippe BEGUINEL, BNEN); 6 - From operators' self-monitoring to ASN's inspections: a many components control system (Eric LE COZ, ASN); 7 - Control of effluents and emissions management at CEA Centres (Marianne CALVEZ, CEA); 8 - Liquid and gaseous effluents of ITER experimental facility: description and impacts (Pierre CORTES, IO); 9 - Effluents and emissions management strategy at AREVA NC La Hague facility (Stephane PUYDARRIEUX, AREVA); 10 - Radioactive effluents from nuclear facilities ongoing deconstruction: from dimensioning to real effluents (Benoit CLAVEL, EDF); 11 - Radionuclides decontamination process for liquid effluents using micro-algae at the laboratory scale (Corinne RIVASSEAU, CEA); 12 - Radioactive effluents from nuclear medicine services: management, monitoring and impact measurement methods (Nathalie TCHILIAN, ASN); 13 - Evolution history of effluents management and environment monitoring at the Solvay La Rochelle site (Thierry DELLOYE, SOLVAY); 14 - Different international approaches in effluents management and monitoring: example of French and German gaseous effluents - regulation, analyses, accounting rules (Jean-Jacques DIANA, ASN); 15 - Environment

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

Areva At September 30, 2010: Revenue growth to euro 6.168 bn: + 6.3%. Backlog growth to euro 42.7 bn: + 2.2%

International Nuclear Information System (INIS)

2010-01-01

AREVA generated consolidated revenue of 6.168 billion euros over the first nine months of 2010 for growth of 6.3% (+5.2% like-for-like) compared with the same period in 2009. The main revenue growth engines were the Reactors and Services Business Group and the Back End Business Group, with growth of 11.5% and 7.1% respectively. Foreign exchange had a positive impact of 82 million euros over the period, while changes in consolidation scope had negligible impact. Third quarter 2010 revenue amounted to 2.011 billion euros for growth of 6.1% (+4.4% LFL) compared with the third quarter of 2009. The Reactors and Services Business Group and the Back End Business Group, posting increases of 11.2% and 9.0% respectively, continued to lead this growth. Foreign exchange had a positive impact of 39 million euros, while changes in consolidation scope had negligible impact. The group's backlog came to 42.7 billion euros at September 30, 2010, an increase of 2.2% compared with September 30, 2009 (41.8 billion euros). For the full year of 2010, the group confirms its outlook for significant revenue and backlog growth, increased operating performance excluding particular items, negative operating income, and strong growth in net income attributable to owners of the group with the contribution of the gain on the sale of the Transmission and Distribution business

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

Burn-up credit applications for UO2 and MOX fuel assemblies in AREVA/COGEMA

International Nuclear Information System (INIS)

Toubon, H.; Riffard, C.; Batifol, M.; Pelletier, S.

2003-01-01

For the last seven years, AREVA/COGEMA has been implementing the second phase of its burn-up credit program (the incorporation of fission products). Since the early nineties, major actinides have been taken into account in criticality analyses first for reprocessing applications, then for transport and storage of fuel assemblies Next year (2004) COGEMA will take into account the six main fission products (Rh103, Cs133, Nd143, Sm149, Sm152 and Gd155) that make up 50% of the anti-reactivity of all fission products. The experimental program will soon be finished. The new burn-up credit methodology is in progress. After a brief overview of BUC R and D program and COGEMA's application of the BUC, this paper will focus on the new burn-up measurement for UO2 and MOX fuel assemblies. It details the measurement instrumentation and the measurement experiments on MOX fuels performed at La Hague in January 2003. (author)

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

Decentralized power generation from biogas

International Nuclear Information System (INIS)

2008-01-01

Areva Bioenergies proposes ready-to-use biogas production and valorization units that use industrial effluents (liquid effluents, spent water, solid wastes). Biogas valorization is performed through cogeneration plants with an output power of 500 kW to 10 MW. This brochure presents Areva's global offer in methanation projects (support, engineering, optimization). Areva Bioenergies counts 20 dual-purpose power plants in operation or under construction in the world which represent an installed power of 220 MW

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

Surveillance of the radioactivity in the environment of the Loire basin

International Nuclear Information System (INIS)

2008-12-01

The surveillance of the radioactivity in environment in the Loire catchment basin rests on the measurement of radioactivity in atmosphere, in the rain waters and continental waters as well as the follow up of radioactivity in food chain. Concerning the air radiation monitoring, that is the dose rate measurement of ambient gamma radiation, the radon measurement and the measurement of particulates and radioactive aerosols. Concerning the food chain, the follow up is made on drinking water, milk, fishes and the special case of strontium 90. The actors of this campaign are the institute of radiation protection and nuclear safety (I.R.S.N.), Electricite de France (E.D.F.) Areva NC, the associations qualified for the surveillance of air quality (A.A.S.Q.A.) and the government services. (N.C.)

Information report of AREVA La Hague site, written in compliance with article L. 125-15 of the French environment code - 2015 Edition

International Nuclear Information System (INIS)

2016-01-01

Published in compliance with the French code of the environment, this report presents, first, the Areva La Hague site with its facilities and activities in relation with spent fuel reprocessing and radioactive waste management. Then, it takes stock of the dispositions implemented for the limitation and prevention of risks and summarizes the events declared in 2015. Next, it presents the management of the site effluents and wastes and the environmental monitoring. Finally, the actions of public information are presented. The recommendations of the Health and safety Committee are included in appendix

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

Toward an Evolutive and Tightly Integrated Information System for Nuclear Materials Management

Energy Technology Data Exchange (ETDEWEB)

Dessoude, O. [Euriware (Areva Group), 25 avenue de Tourville, Equeurdreville, 50100 (France)

2009-06-15

From a nuclear materials management standpoint, spent-fuel recycling is considered a very challenging activity. This challenge has its positive counterpart as a lot has been learned from confronting a large variety of nuclear materials, complex material transfers and transformations. Since the inception of its computerized nuclear materials management system, AREVA NC La Hague has relied upon its IT subsidiary EURIWARE for software design and development. In 2003, the founding milestone was the implementation of the new GMP software package (Gestion des Matieres et des Produits - Materials and Products Management). GMP was underpinned by the following principles: reliability, transparency and close integration with the process control layer, so as to mitigate human errors and keep the management process smooth and efficient. In 2005, another major milestone was reached with CMNR (Comptabilite des Matieres Nucleaires Reglementaire - Regulatory Nuclear Materials Accountancy), a system in charge of local accounting and multi-site consolidation at corporate level. In spite of an auspicious start, GMP came up against the same stumbling block as many information systems: the multiplication of interfaces and technologies (entropy increasing over time). For the sake of maintenance, evolutions and performance, AREVA has decided a progressive modernization of its Nuclear Materials Management (NMM) information system. The underlying principle is a clear separation between the main functions: - Physical Follow-up, performed at the plant-level, - Regulatory Accountancy (for IRSN, EURATOM and IAEA safeguards), offering consolidation at the corporate level, - Patrimonial Accountancy (allocation of materials and conditioned wastes to AREVA's customers). The pivotal piece of this multi-year programme is the implementation of a dedicated data repository. We describe its main building blocks and demonstrate how it helps in managing changes to regulation, products, customers and

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

Information report on nuclear safety and radiation protection of the La Hague AREVA site- Issue 2012

International Nuclear Information System (INIS)

2013-06-01

Published in compliance with the French code of the environment, this report first presents the Areva's La Hague site which comprises several basis nuclear installations (INB), is dedicated to several activities related to the nuclear fuel cycle, is submitted to a constraining legal and regulatory framework, and implements a policy for a sustainable development and continuous progress. The document describes the various measures regarding nuclear safety and radiation protection, reports nuclear events which are classified according to the INES scale and occurred and had to be declared in 2012, describes the management of effluents by the different installations present on this site and the control of the environment. It addresses the waste management and the management of other impacts. It gives an overview of actions undertaken regarding information and transparency. Recommendations of the CHSCT are reported

Decentralized power generation from biogas; Production d'energie decentralisee a partir de biogaz

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

Areva Bioenergies proposes ready-to-use biogas production and valorization units that use industrial effluents (liquid effluents, spent water, solid wastes). Biogas valorization is performed through cogeneration plants with an output power of 500 kW to 10 MW. This brochure presents Areva's global offer in methanation projects (support, engineering, optimization). Areva Bioenergies counts 20 dual-purpose power plants in operation or under construction in the world which represent an installed power of 220 MW.

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive