WorldWideScience

Sample records for ob izostazii okhotskogo

  1. Impaired Muscle Regeneration in Ob/ob and Db/db Mice

    Directory of Open Access Journals (Sweden)

    Mai-Huong Nguyen

    2011-01-01

    Full Text Available In obesity and type 2 diabetes, efficient skeletal muscle repair following injury may be required, not only for restoring muscle structure and function, but also for maintaining exercise capacity and insulin sensitivity. The hypothesis of this study was that muscle regeneration would be impaired in ob/ob and db/db mice, which are common mouse models of obesity and type 2 diabetes. Muscle injury was produced by cardiotoxin injection, and regeneration was assessed by morphological and immunostaining techniques. Muscle regeneration was delayed in ob/ob and db/db mice, but not in a less severe model of insulin resistance – feeding a high-fat diet to wild-type mice. Angiogenesis, cell proliferation, and myoblast accumulation were also impaired in ob/ob and db/db mice, but not the high-fat diet mice. The impairments in muscle regeneration were associated with impaired macrophage accumulation; macrophages have been shown previously to be required for efficient muscle regeneration. Impaired regeneration in ob/ob and db/db mice could be due partly to the lack of leptin signaling, since leptin is expressed both in damaged muscle and in cultured muscle cells. In summary, impaired muscle regeneration in ob/ob and db/db mice was associated with reduced macrophage accumulation, angiogenesis, and myoblast activity, and could have implications for insulin sensitivity in the skeletal muscle of obese and type 2 diabetic patients.

  2. Ablation of ghrelin receptor in leptin-deficient ob/ob mice has paradoxical effects on glucose homeostasis when compared with ablation of ghrelin in ob/ob mice

    Science.gov (United States)

    The orexigenic hormone ghrelin is important in diabetes because it has an inhibitory effect on insulin secretion. Ghrelin ablation in leptin-deficient ob/ob (Ghrelin(-/-):ob/ob) mice increases insulin secretion and improves hyperglycemia. The physiologically relevant ghrelin receptor is the growth ...

  3. Genetically obese (ob/ob) mice are resistant to the lethal effects of thioacetamide hepatotoxicity

    International Nuclear Information System (INIS)

    Won, Young-Suk; Song, Ji-Won; Lim, Jong-Hwan; Lee, Mee-Young; Moon, Og-Sung; Kim, Hyoung-Chin; Son, Hwa-Young; Kwon, Hyo-Jung

    2016-01-01

    Obesity increases the risk of chronic liver diseases, including viral hepatitis, alcohol-induced liver disease, and non-alcoholic steatohepatitis. In this study, we investigated the effects of obesity in acute hepatic failure using a murine model of thioacetamide (TA)-induced liver injury. Genetically obese ob/ob mice, together with non-obese ob/+ littermates, were subjected to a single intraperitoneal injection of TA, and examined for signs of hepatic injury. ob/ob mice showed a significantly higher survival rate, lower levels of serum alanine aminotransferase and aspartate aminotransferase, and less hepatic necrosis and apoptosis, compared with ob/+ mice. In addition, ob/ob mice exhibited significantly lower levels of malondialdehyde and significantly higher levels of glutathione and antioxidant enzyme activities compared with their ob/+ counterparts. Bioactivation analyses revealed reduced plasma clearance of TA and covalent binding of [ 14 C]TA to liver macromolecules in ob/ob mice. Together, these data demonstrate that genetically obese mice are resistant to TA-induced acute liver injury through diminished bioactivation of TA and antioxidant effects. - Highlights: • ob/ob mice are resistant to lethal doses of thioacetamide, compared to ob/+ mice. • ob/ob mice show reduced oxidative stress and enhanced antioxidant enzyme activity. • ob/ob mice exhibit diminished bioactivation of thioacetamide.

  4. Genetically obese (ob/ob) mice are resistant to the lethal effects of thioacetamide hepatotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Won, Young-Suk [Laboratory Animal Resource Center, Korea Research Institute of Bioscience and Biotechnology, Chungbuk (Korea, Republic of); Song, Ji-Won [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of); Lim, Jong-Hwan [Huons Research Center, Gyonggido (Korea, Republic of); Lee, Mee-Young [Herbal Medicine Formulation Research Group, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Moon, Og-Sung; Kim, Hyoung-Chin [Laboratory Animal Resource Center, Korea Research Institute of Bioscience and Biotechnology, Chungbuk (Korea, Republic of); Son, Hwa-Young [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of); Kwon, Hyo-Jung, E-mail: hyojung@cnu.ac.kr [Department of Veterinary Pathology, College of Veterinary Medicine, Chungnam National University, Daejeon (Korea, Republic of)

    2016-01-15

    Obesity increases the risk of chronic liver diseases, including viral hepatitis, alcohol-induced liver disease, and non-alcoholic steatohepatitis. In this study, we investigated the effects of obesity in acute hepatic failure using a murine model of thioacetamide (TA)-induced liver injury. Genetically obese ob/ob mice, together with non-obese ob/+ littermates, were subjected to a single intraperitoneal injection of TA, and examined for signs of hepatic injury. ob/ob mice showed a significantly higher survival rate, lower levels of serum alanine aminotransferase and aspartate aminotransferase, and less hepatic necrosis and apoptosis, compared with ob/+ mice. In addition, ob/ob mice exhibited significantly lower levels of malondialdehyde and significantly higher levels of glutathione and antioxidant enzyme activities compared with their ob/+ counterparts. Bioactivation analyses revealed reduced plasma clearance of TA and covalent binding of [{sup 14}C]TA to liver macromolecules in ob/ob mice. Together, these data demonstrate that genetically obese mice are resistant to TA-induced acute liver injury through diminished bioactivation of TA and antioxidant effects. - Highlights: • ob/ob mice are resistant to lethal doses of thioacetamide, compared to ob/+ mice. • ob/ob mice show reduced oxidative stress and enhanced antioxidant enzyme activity. • ob/ob mice exhibit diminished bioactivation of thioacetamide.

  5. iNOS inhibits hair regeneration in obese diabetic (ob/ob) mice.

    Science.gov (United States)

    Sasaki, Mari; Shinozaki, Shohei; Morinaga, Hironobu; Kaneki, Masao; Nishimura, Emi; Shimokado, Kentaro

    2018-07-02

    Previous studies have shown that androgenic alopecia is associated with metabolic syndrome and diabetes. However, the detailed mechanism whereby diabetes causes alopecia still remains unclear. We focused on the inflammatory response that is caused by diabetes or obesity, given that inflammation is a risk factor for hair loss. Inducible nitric oxide synthase (iNOS) is known to be upregulated under conditions of acute or chronic inflammation. To clarify the potential role of iNOS in diabetes-related alopecia, we generated obese diabetic iNOS-deficient (ob/ob; iNOS-KO mice). We observed that ob/ob; iNOS-KO mice were potentiated for the transition from telogen (rest phase) to anagen (growth phase) in the hair cycle compared with iNOS-proficient ob/ob mice. To determine the effect of nitric oxide (NO) on the hair cycle, we administered an iNOS inhibitor intraperitoneally (compound 1400 W, 10 mg/kg) or topically (10% aminoguanidine) in ob/ob mice. We observed that iNOS inhibitors promoted anagen transition in ob/ob mice. Next, we administered an NO donor (S-nitrosoglutathione, GSNO), to test whether NO has the telogen elongation effects. The NO donor was sufficient to induce telogen elongation in wild-type mice. Together, our data indicate that iNOS-derived NO plays a role in telogen elongation under the inflammatory conditions associated with diabetes in mice. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.

  6. Glucose metabolism and recycling by hepatocytes of OB/OB and ob/ob mice

    International Nuclear Information System (INIS)

    Lahtela, J.T.; Wals, P.A.; Katz, J.

    1990-01-01

    Hepatocytes were prepared from livers of ob/ob (obese diabetic) mice and their lean (OB/OB) siblings that had been fasted for 24 h. The hepatocytes were incubated with [U-14C, 2-3H]-, [U-14C, 3-3H]-, and [U-14C, 6-3H]glucose at concentrations from 20 to 120 mM. 14C was recovered mainly in CO2, glycogen, and lactate. Tritium was recovered in water and glycogen. The yield in labeled products from [2-3H]glucose ranged from two to three times that from [U-14C]glucose. The yields from [3-3H]- and [6-3H]glucose were similar, and 1.3-1.7 times that from [U-14C]glucose. At 40 mM, total utilization of glucose by obese mice was about twice that for lean mice, but there was little difference at 120 mM. The rate of recycling between glucose and glucose 6-phosphate was calculated. An equation to calculate the rate of recycling of glucose from the 2-3H/U-14C ratio in glycogen is derived in the APPENDIX. Our results show that (1) the utilization of glucose by hepatocytes from obese diabetic mice exceeds that of their lean controls, (2) the rate of glucose phosphorylation in both groups greatly exceeds glucose uptake and the rate of glycogen synthesis, (3) glucose phosphorylation represents a difference between a high glucokinase rate and hydrolysis of glucose 6-phosphate, and (4) recycling of glucose carbon between glucose 6-phosphate and pyruvate occurs within mouse hepatocytes

  7. Association between Diastolic Dysfunction with Inflammation and Oxidative Stress in Females ob/ob Mice

    Science.gov (United States)

    Sartori, Michelle; Conti, Filipe F.; Dias, Danielle da Silva; dos Santos, Fernando; Machi, Jacqueline F.; Palomino, Zaira; Casarini, Dulce E.; Rodrigues, Bruno; De Angelis, Kátia; Irigoyen, Maria-Claudia

    2017-01-01

    Objective: To evaluate autonomic and cardiovascular function, as well as inflammatory and oxidative stress markers in ob/ob female mice. Methods: Metabolic parameters, cardiac function, arterial pressure (AP), autonomic, hormonal, inflammatory, and oxidative stress markers were evaluated in 12-weeks female wild-type (WT group) and ob/ob mice (OB group). Results: OB animals showed increased body weight, blood glucose, and triglyceride levels, along with glucose intolerance, when compared to WT animals. Ejection fraction (EF) and AP were similar between groups; however, the OB group presented diastolic dysfunction, as well as an impairment on myocardial performance index. Moreover, the OB group exhibited important autonomic dysfunction and baroreflex sensitivity impairment, when compared to WT group. OB group showed increased Angiotensin II levels in heart and renal tissues; decreased adiponectin and increased inflammatory markers in adipose tissue and spleen. Additionally, OB mice presented a higher damage to proteins and lipoperoxidation and lower activity of antioxidant enzymes in kidney and heart. Correlations were found between autonomic dysfunction with angiotensin II and inflammatory mediators, as well as between inflammation and oxidative stress. Conclusions: Our results showed that female adult ob/ob mice presented discrete diastolic dysfunction accompanied by autonomic disorder, which is associated with inflammation and oxidative stress in these animals. PMID:28878683

  8. Association between Diastolic Dysfunction with Inflammation and Oxidative Stress in Females ob/ob Mice

    Directory of Open Access Journals (Sweden)

    Michelle Sartori

    2017-08-01

    Full Text Available Objective: To evaluate autonomic and cardiovascular function, as well as inflammatory and oxidative stress markers in ob/ob female mice.Methods: Metabolic parameters, cardiac function, arterial pressure (AP, autonomic, hormonal, inflammatory, and oxidative stress markers were evaluated in 12-weeks female wild-type (WT group and ob/ob mice (OB group.Results: OB animals showed increased body weight, blood glucose, and triglyceride levels, along with glucose intolerance, when compared to WT animals. Ejection fraction (EF and AP were similar between groups; however, the OB group presented diastolic dysfunction, as well as an impairment on myocardial performance index. Moreover, the OB group exhibited important autonomic dysfunction and baroreflex sensitivity impairment, when compared to WT group. OB group showed increased Angiotensin II levels in heart and renal tissues; decreased adiponectin and increased inflammatory markers in adipose tissue and spleen. Additionally, OB mice presented a higher damage to proteins and lipoperoxidation and lower activity of antioxidant enzymes in kidney and heart. Correlations were found between autonomic dysfunction with angiotensin II and inflammatory mediators, as well as between inflammation and oxidative stress.Conclusions: Our results showed that female adult ob/ob mice presented discrete diastolic dysfunction accompanied by autonomic disorder, which is associated with inflammation and oxidative stress in these animals.

  9. Peripheral nervous system insulin resistance in ob/ob mice

    Science.gov (United States)

    2013-01-01

    Background A reduction in peripheral nervous system (PNS) insulin signaling is a proposed mechanism that may contribute to sensory neuron dysfunction and diabetic neuropathy. Neuronal insulin resistance is associated with several neurological disorders and recent evidence has indicated that dorsal root ganglion (DRG) neurons in primary culture display altered insulin signaling, yet in vivo results are lacking. Here, experiments were performed to test the hypothesis that the PNS of insulin-resistant mice displays altered insulin signal transduction in vivo. For these studies, nondiabetic control and type 2 diabetic ob/ob mice were challenged with an intrathecal injection of insulin or insulin-like growth factor 1 (IGF-1) and downstream signaling was evaluated in the DRG and sciatic nerve using Western blot analysis. Results The results indicate that insulin signaling abnormalities documented in other “insulin sensitive” tissues (i.e. muscle, fat, liver) of ob/ob mice are also present in the PNS. A robust increase in Akt activation was observed with insulin and IGF-1 stimulation in nondiabetic mice in both the sciatic nerve and DRG; however this response was blunted in both tissues from ob/ob mice. The results also suggest that upregulated JNK activation and reduced insulin receptor expression could be contributory mechanisms of PNS insulin resistance within sensory neurons. Conclusions These findings contribute to the growing body of evidence that alterations in insulin signaling occur in the PNS and may be a key factor in the pathogenesis of diabetic neuropathy. PMID:24252636

  10. Hydrogen sulfide improves diabetic wound healing in ob/ob mice via attenuating inflammation.

    Science.gov (United States)

    Zhao, Huichen; Lu, Shengxia; Chai, Jiachao; Zhang, Yuchao; Ma, Xiaoli; Chen, Jicui; Guan, Qingbo; Wan, Meiyan; Liu, Yuantao

    2017-09-01

    The proposed mechanisms of impaired wound healing in diabetes involve sustained inflammation, excess oxidative stress and compromised agiogenesis. Hydrogen sulfide (H 2 S) has been reported to have multiple biological activities. We aim to investigate the role of H 2 S in impaired wound healing in ob/ob mice and explore the possible mechanisms involved. Full-thickness skin dorsal wounds were created on ob/ob mice and C57BL/6 mice. Cystathionine-γ-lyase (CSE) expression and H 2 S production were determined in granulation tissues of the wounds. Effects of NaHS on wound healing were evaluated. Inflammation and angiogenesis in granulation tissues of the wounds were examined. CSE expression, and H 2 S content were significantly reduced in granulation tissues of wounds in ob/ob mice compared with control mice. NaHS treatment significantly improved wound healing in ob/ob mice, which was associated with reduced neutrophil and macrophage infiltration, decreased production of tumor necrosis factor (TNF)-α, interleukin (IL)-6. NaHS treatment decreased metalloproteinase (MMP)-9, whereas increased collagen deposition and vascular-like structures in granulation tissues of wounds in ob/ob mice. CSE down-regulation may play a role in the pathogenesis of diabetic impaired wound healing. Exogenous H 2 S could be a potential agent to improve diabetic impaired wound healing by attenuating inflammation and increasing angiogenesis. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Serotonin transporter (SERT and translocator protein (TSPO expression in the obese ob/ob mouse

    Directory of Open Access Journals (Sweden)

    Santini Ferruccio

    2011-02-01

    Full Text Available Abstract Background An ever growing body of evidences is emerging concerning metabolism hormones, neurotransmitters or stress-related biomarkers as effective modulators of eating behavior and body weight in mammals. The present study sought at examining the density and affinity of two proteins related to neurotransmission and cell metabolism, the serotonin transporter SERT and the cholesterol import-benzodiazepine site TSPO (translocator protein, in a rodent leptin-lacking mutant, the obese ob/ob mouse. Binding studies were thus carried out in brain or peripheral tissues, blood platelets (SERT and kidneys (TSPO, of ob/ob and WT mice supplied with a standard diet, using the selective radiochemical ligands [3H]-paroxetine and [3H]-PK11195. Results We observed comparable SERT number or affinity in brain and platelets of ob/ob and WT mice, whilst a significantly higher [3H]-PK11195 density was reported in the brain of ob/ob animals. TSPO binding parameters were similar in the kidneys of all tested mice. By [3H]-PK11195 autoradiography of coronal hypothalamic-hippocampal sections, an increased TSPO signal was detected in the dentate gyrus (hippocampus and choroids plexus of ob/ob mice, without appreciable changes in the cortex or hypothalamic-thalamic regions. Conclusions These findings show that TSPO expression is up-regulated in cerebral regions of ob/ob leptin-deficient mice, suggesting a role of the translocator protein in leptin-dependent CNS trophism and metabolism. Unchanged SERT in mutant mice is discussed herein in the context of previous literature as the forerunner to a deeper biochemical investigation.

  12. Find an Ob-Gyn

    Science.gov (United States)

    ... Management Education & Events Advocacy For Patients About ACOG Find an Ob-Gyn Home About ACOG Find an Ob-Gyn Page Navigation ▼ About Us ACOG ... Districts ACOG Sections Careers at ACOG Contact Us Find an Ob-Gyn Search by State Search by ...

  13. Alpha-1 adrenoceptors in brown adipose tissue of lean and ob/ob mice

    International Nuclear Information System (INIS)

    Behrens-Zaror, G.; Himms-Hagen, J.

    1986-01-01

    Obese (ob/ob) mice have a low capacity to increase thyroxine 5'-deiodinase (T4 5'-D) in brown adipose tissue (BAT) when exposed to cold. This effect is mediated by alpha-1 (A-1) adrenoceptors. The authors objective was to find out whether BAT of the ob/ob mouse has normal A-1 receptors. Saturation analysis of binding of [3H]-WB4101 at 0.05 nM to 10 μM to crude membrane preparations (100,000 g pellets from Polytron homogenates) using the LIGAND program of Munson and Rodbard, showed two populations of binding sites in BAT of lean (+/+, 11-15 wk old) mice. Acute exposure (12 h, 14 0 C) or acclimation to cold (3 wk, 14 0 C) did not alter affinity or concentration of sites. Displacement with yohimbine and prazosin indicated binding of WB4101 to A-1 receptors. Very young (5 wk) lean (+/.) and obese mice had similar affinity constants (lean 0.13 +/- 0.043 and 34.2 +/- 14.9; obese, 0.12 +/- 0.028 and 20.9 +/- 5.48 nM) and concentrations (lean 22.4 +/- 3.8 and 647 +/- 137; obese, 28.6 +/- 4.6 and 547 +/- 105 fmol/mg protein) of sites. Old (1 yr) mice had high affinity sites similar to those in younger animals (KD lean 0.19 +/- 0.028, obese, 0.25 +/- 0.075; Bmax lean, 60.2 +/- 12.1; obese, 63.1 +/- 13.5 fmol/mg protein). The authors conclude that the ob/ob mouse has normal high affinity A-1 receptors in BAT. Anomalous properties of low affinity binding in old ob/ob mice could not be characterized because of high nonspecific binding. BAT of the ob/ob mouse does not lack A-1 receptors but may have a post-receptor alteration in the A-1 adrenoceptor-mediated response

  14. Leptin differentially regulate STAT3 activation in ob/ob mouse adipose mesenchymal stem cells

    Directory of Open Access Journals (Sweden)

    Zhou Zhou

    2012-12-01

    Full Text Available Abstract Background Leptin-deficient ob/ob mice exhibit adipocyte hypertrophy and hyperplasia as well as elevated adipose tissue and systemic inflammation. Multipotent stem cells isolated from adult adipose tissue can differentiate into adipocytes ex vivo and thereby contribute toward increased adipocyte cell numbers, obesity, and inflamm ation. Currently, information is lacking regarding regulation of adipose stem cell numbers as well as leptin-induced inflammation and its signaling pathway in ob/ob mice. Methods Using leptin deficient ob/ob mice, we investigated whether leptin injection into ob/ob mice increases adipose stem cell numbers and adipose tissue inflammatory marker MCP-1 mRNA and secretion levels. We also determined leptin mediated signaling pathways in the adipose stem cells. Results We report here that adipose stem cell number is significantly increased following leptin injection in ob/ob mice and with treatment of isolated stem cells with leptin in vitro. Leptin also up-regulated MCP-1 secretion in a dose- and time-dependent manner. We further showed that increased MCP-1 mRNA levels were due to increased phosphorylation of Signal Transducer and Activator of Transcription 3 (STAT3 Ser727 but not STAT3 Tyr705 phosphorylation, suggesting differential regulation of MCP-1 gene expression under basal and leptin-stimulated conditions in adipose stem cells. Conclusions Taken together, these studies demonstrate that leptin increases adipose stem cell number and differentially activates STAT3 protein resulting in up-regulation of MCP-1 gene expression. Further studies of mechanisms mediating adipose stem cell hyperplasia and leptin signaling in obesity are warranted and may help identify novel anti-obesity target strategies.

  15. Ob/ob mouse livers show decreased oxidative phosphorylation efficiencies and anaerobic capacities after cold ischemia.

    Directory of Open Access Journals (Sweden)

    Michael J J Chu

    Full Text Available BACKGROUND: Hepatic steatosis is a major risk factor for graft failure in liver transplantation. Hepatic steatosis shows a greater negative influence on graft function following prolonged cold ischaemia. As the impact of steatosis on hepatocyte metabolism during extended cold ischaemia is not well-described, we compared markers of metabolic capacity and mitochondrial function in steatotic and lean livers following clinically relevant durations of cold preservation. METHODS: Livers from 10-week old leptin-deficient obese (ob/ob, n = 9 and lean C57 mice (n = 9 were preserved in ice-cold University of Wisconsin solution. Liver mitochondrial function was then assessed using high resolution respirometry after 1.5, 3, 5, 8, 12, 16 and 24 hours of storage. Metabolic marker enzymes for anaerobiosis and mitochondrial mass were also measured in conjunction with non-bicarbonate tissue pH buffering capacity. RESULTS: Ob/ob and lean mice livers showed severe (>60% macrovesicular and mild (<30% microvesicular steatosis on Oil Red O staining, respectively. Ob/ob livers had lower baseline enzymatic complex I activity but similar adenosine triphosphate (ATP levels compared to lean livers. During cold storage, the respiratory control ratio and complex I-fueled phosphorylation deteriorated approximately twice as fast in ob/ob livers compared to lean livers. Ob/ob livers also demonstrated decreased ATP production capacities at all time-points analyzed compared to lean livers. Ob/ob liver baseline lactate dehydrogenase activities and intrinsic non-bicarbonate buffering capacities were depressed by 60% and 40%, respectively compared to lean livers. CONCLUSIONS: Steatotic livers have impaired baseline aerobic and anaerobic capacities compared to lean livers, and mitochondrial function indices decrease particularly from after 5 hours of cold preservation. These data provide a mechanistic basis for the clinical recommendation of shorter cold storage durations in

  16. Cordyceps militaris alleviates non-alcoholic fatty liver disease in ob/ob mice.

    Science.gov (United States)

    Choi, Ha-Neul; Jang, Yang-Hee; Kim, Min-Joo; Seo, Min Jeong; Kang, Byoung Won; Jeong, Yong Kee; Kim, Jung-In

    2014-04-01

    Non-alcoholic fatty liver disease (NAFLD) is becoming an important public health problem as metabolic syndrome and type 2 diabetes have become epidemic. In this study we investigated the protective effect of Cordyceps militaris (C. militaris) against NAFLD in an obese mouse model. Four-week-old male ob/ob mice were fed an AIN-93G diet or a diet containing 1% C. militaris water extract for 10 weeks after 1 week of adaptation. Serum glucose, insulin, free fatty acid (FFA), alanine transaminase (ALT), and proinflammatory cytokines were measured. Hepatic levels of lipids, glutathione (GSH), and lipid peroxide were determined. Consumption of C. militaris significantly decreased serum glucose, as well as homeostasis model assessment for insulin resistance (HOMA-IR), in ob/ob mice. In addition to lowering serum FFA levels, C. militaris also significantly decreased hepatic total lipids and triglyceride contents. Serum ALT activities and tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6) levels were reduced by C. militaris. Consumption of C. militaris increased hepatic GSH and reduced lipid peroxide levels. These results indicate that C. militaris can exert protective effects against development of NAFLD, partly by reducing inflammatory cytokines and improving hepatic antioxidant status in ob/ob mice.

  17. Leptin Increases Striatal Dopamine D2 Receptor Binding in Leptin-Deficient Obese (ob/ob) Mice

    Energy Technology Data Exchange (ETDEWEB)

    Pfaffly, J.; Michaelides, M.; Wang, G-J.; Pessin, J.E.; Volkow, N.D.; Thanos, P.K.

    2010-06-01

    Peripheral and central leptin administration have been shown to mediate central dopamine (DA) signaling. Leptin-receptor deficient rodents show decreased DA D2 receptor (D2R) binding in striatum and unique DA profiles compared to controls. Leptin-deficient mice show increased DA activity in reward-related brain regions. The objective of this study was to examine whether basal D2R-binding differences contribute to the phenotypic behaviors of leptin-deficient ob/ob mice, and whether D2R binding is altered in response to peripheral leptin treatment in these mice. Leptin decreased body weight, food intake, and plasma insulin concentration in ob/ob mice but not in wild-type mice. Basal striatal D2R binding (measured with autoradiography [{sup 3}H] spiperone) did not differ between ob/ob and wild-type mice but the response to leptin did. In wild-type mice, leptin decreased striatal D2R binding, whereas, in ob/ob mice, leptin increased D2R binding. Our findings provide further evidence that leptin modulates D2R expression in striatum and that these effects are genotype/phenotype dependent.

  18. HSL Attenuates the Follicular Oxidative Stress and Enhances the Hair Growth in ob/ob Mice

    Directory of Open Access Journals (Sweden)

    Takeo Minematsu, PhD

    2013-10-01

    Full Text Available Summary: We demonstrated enhanced hair regeneration following topical administration of N-(3-oxododecanoyl-L-homoserine lactone (HSL in ob/ob mice. The ob/ob mice showed delayed hair regeneration (more than 6 wk after depilation, which rapidly induced transition to anagen in the hair cycle in wild-type mice. Vehicle and HSL solutions were applied to the depilated dorsal skin of ob/ob mice. The depilated skin of the HSL-treated mice was fully covered with hair, whereas no macroscopic alteration was observed in vehicle-treated group by the fourth week after depilation. Oxidative stress was drastically decreased and the expression of the antioxidative enzymes PON1 and PON3 was increased in the HSL-treated skin with highly proliferative anagen follicles. These results suggest that HSL is a candidate therapeutic agent for alopecia in metabolic syndrome.

  19. COMP-angiopoietin-1 recovers molecular biomarkers of neuropathy and improves vascularisation in sciatic nerve of ob/ob mice.

    Directory of Open Access Journals (Sweden)

    Joanna Kosacka

    Full Text Available BACKGROUND: Leptin-deficient ob/ob mice are a model of type 2 diabetes induced peripheral neuropathy. Ob/ob mice exhibit obesity, insulin resistance, hyperglycaemia, and alterations of peripheral nerve fibres and endoneural microvessels. Here we test the hypothesis that cartilage oligomeric matrix protein (COMP-Ang-1, a soluble and stabile form of Ang-1 which promotes angiogenesis and nerve growth, improves regeneration of nerve fibres and endoneural microvessels in ob/ob mice. METHODS AND FINDINGS: COMP-Ang-1 (100 ng/ml or NaCl were intraperitoneally (i.p. injected into male (N = 184, 3-month old, ob/ob or ob/+ mice for 7 and 21 days. We measured expression of Nf68, GAP43, Cx32, Cx26, Cx43, and TNFα in sciatic nerves using Western blot analysis. To investigate the inflammation in sciatic nerves, numbers of macrophages and T-cells were counted after immunofluorescence staining. In ultrathin section, number of myelinated/non-mylinated nerve fibers, g-ratio, the thickness of Schwann cell basal lamina and microvessel endothelium were investigated. Endoneural microvessels were reconstructed with intracardial FITC injection. Treatment with COMP-Ang-1 over 21 days significantly reduced fasting blood glucose and plasma cholesterol concentrations compared to saline treated ob/ob mice. In addition, COMP-Ang-1 treatment: 1 up-regulated expression of Nf68 and GAP43; 2 improved expression of gap junction proteins including connexin 32 and 26; 3 suppressed the expression of TNFα and Cx43 and 4 led to decreased macrophage and T-cell infiltration in sciatic nerve of ob/ob mice. The significant changes of sciatic nerve ultrastructure were not observed after 21-day long COMP-Ang-1 treatment. COMP-Ang-1 treated ob/ob mice displayed regeneration of small-diameter endoneural microvessels. Effects of COMP-Ang-1 corresponded to increased phosphorylation of Akt and p38 MAPK upon Tie-2 receptor. CONCLUSIONS: COMP-Ang-1 recovers molecular biomarkers of neuropathy

  20. Structural anatomy of telomere OB proteins.

    Science.gov (United States)

    Horvath, Martin P

    2011-10-01

    Telomere DNA-binding proteins protect the ends of chromosomes in eukaryotes. A subset of these proteins are constructed with one or more OB folds and bind with G+T-rich single-stranded DNA found at the extreme termini. The resulting DNA-OB protein complex interacts with other telomere components to coordinate critical telomere functions of DNA protection and DNA synthesis. While the first crystal and NMR structures readily explained protection of telomere ends, the picture of how single-stranded DNA becomes available to serve as primer and template for synthesis of new telomere DNA is only recently coming into focus. New structures of telomere OB fold proteins alongside insights from genetic and biochemical experiments have made significant contributions towards understanding how protein-binding OB proteins collaborate with DNA-binding OB proteins to recruit telomerase and DNA polymerase for telomere homeostasis. This review surveys telomere OB protein structures alongside highly comparable structures derived from replication protein A (RPA) components, with the goal of providing a molecular context for understanding telomere OB protein evolution and mechanism of action in protection and synthesis of telomere DNA.

  1. iPLA2β deficiency attenuates obesity and hepatic steatosis in ob/ob mice through hepatic fatty-acyl phospholipid remodeling.

    Science.gov (United States)

    Deng, Xiuling; Wang, Jiliang; Jiao, Li; Utaipan, Tanyarath; Tuma-Kellner, Sabine; Schmitz, Gerd; Liebisch, Gerhard; Stremmel, Wolfgang; Chamulitrat, Walee

    2016-05-01

    PLA2G6 or GVIA calcium-independent PLA2 (iPLA2β) is identified as one of the NAFLD modifier genes in humans, and thought to be a target for NAFLD therapy. iPLA2β is known to play a house-keeping role in phospholipid metabolism and remodeling. However, its role in NAFLD pathogenesis has not been supported by results obtained from high-fat feeding of iPLA2β-null (PKO) mice. Unlike livers of human NAFLD and genetically obese rodents, fatty liver induced by high-fat diet is not associated with depletion of hepatic phospholipids. We therefore tested whether iPLA2β could regulate obesity and hepatic steatosis in leptin-deficient mice by cross-breeding PKO with ob/ob mice to generate ob/ob-PKO mice. Here we observed an improvement in ob/ob-PKO mice with significant reduction in serum enzymes, lipids, glucose, insulin as well as improved glucose tolerance, and reduction in islet hyperplasia. The improvement in hepatic steatosis measured by liver triglycerides, fatty acids and cholesterol esters was associated with decreased expression of PPARγ and de novo lipogenesis genes, and the reversal of β-oxidation gene expression. Notably, ob/ob livers contained depleted levels of lysophospholipids and phospholipids, and iPLA2β deficiency in ob/ob-PKO livers lowers the former, but replenished the latter particularly phosphatidylethanolamine (PE) and phosphatidylcholine (PC) that contained arachidonic (AA) and docosahexaenoic (DHA) acids. Compared with WT livers, PKO livers also contained increased PE and PC containing AA and DHA. Thus, iPLA2β deficiency protected against obesity and ob/ob fatty liver which was associated with hepatic fatty-acyl phospholipid remodeling. Our results support the deleterious role of iPLA2β in severe obesity associated NAFLD. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Leptin differentially regulates STAT3 activation in the ob/ob mice adipose mesenchymal stem cells

    Science.gov (United States)

    Leptin-deficient genetically obese ob/ob mice exhibit adipocyte hypertrophy and hyperplasia as well as elevated adipose tissue and systemic inflammation. Studies have shown that multipotent stem cells isolated from adult adipose tissue can differentiate into adipocytes ex vivo and thereby contribute...

  3. uvby and JHKL photometry of OB stars in the association Cygnus OB2

    International Nuclear Information System (INIS)

    Torres-Dodgen, A.V.; Carroll, M.; Tapia, M.

    1991-01-01

    We have obtained uvby and JHK photometry of about 80 stars in the association Cygnus OB2 (VI Cygni), including some foreground stars and three infrared sources. We present colour-colour and colour-magnitude diagrams from which we derive the interstellar extinction and approximate spectral types. We confirm that the interstellar extinction law in the direction of Cyg OB2 is similar to the galactic mean. (author)

  4. Cordyceps militaris alleviates non-alcoholic fatty liver disease in ob/ob mice

    OpenAIRE

    Choi, Ha-Neul; Jang, Yang-Hee; Kim, Min-Joo; Seo, Min Jeong; Kang, Byoung Won; Jeong, Yong Kee; Kim, Jung-In

    2014-01-01

    BACKGROUND/OBJECTIVES Non-alcoholic fatty liver disease (NAFLD) is becoming an important public health problem as metabolic syndrome and type 2 diabetes have become epidemic. In this study we investigated the protective effect of Cordyceps militaris (C. militaris) against NAFLD in an obese mouse model. MATERIALS/METHODS Four-week-old male ob/ob mice were fed an AIN-93G diet or a diet containing 1% C. militaris water extract for 10 weeks after 1 week of adaptation. Serum glucose, insulin, free...

  5. Genetic ablation of phosphatidylcholine transfer protein/StarD2 in ob/ob mice improves glucose tolerance without increasing energy expenditure.

    Science.gov (United States)

    Krisko, Tibor I; LeClair, Katherine B; Cohen, David E

    2017-03-01

    Phosphatidylcholine transfer protein (PC-TP; synonym StarD2) is highly expressed in liver and oxidative tissues. PC-TP promotes hepatic glucose production during fasting and aggravates glucose intolerance in high fat fed mice. However, because PC-TP also suppresses thermogenesis in brown adipose tissue (BAT), its direct contribution to obesity-associated diabetes in mice remains unclear. Here we examined the effects of genetic PC-TP ablation on glucose homeostasis in leptin-deficient ob/ob mice, which exhibit both diabetes and altered thermoregulation. Mice lacking both PC-TP and leptin (Pctp -/- ;ob/ob) were prepared by crossing Pctp -/- with ob/+ mice. Glucose homeostasis was assessed by standard assays, and energy expenditure was determined by indirect calorimetry using a comprehensive laboratory animal monitoring system, which also recorded physical activity and food intake. Body composition was determined by NMR and hepatic lipids by enzymatic assays. Core body temperature was measured using a rectal thermocouple probe. Pctp -/- ;ob/ob mice demonstrated improved glucose homeostasis, as evidenced by markedly improved glucose and pyruvate tolerance tests, without changes in insulin tolerance. However, there were no differences in EE at any ambient temperature. There were also no effects of PC-TP expression on physical activity, food intake or core body temperature. Improved glucose tolerance in Pctp -/- ;ob/ob mice in the absence of increases in energy expenditure or core body temperature indicates a direct pathogenic role for PC-TP in diabetes in leptin deficient mice. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. Manta A New BroadBand OBS

    Science.gov (United States)

    Hello, Y.; Yegikyan, M.; Charvis, P.; Philippe, O.

    2017-12-01

    Manta is a new BroadBand OBS developed at Geoazur and commercialized by Osean. The design is inspired by 3-years autonomy MUG-OBS a Multiparameter Ocean Bottom System which carry a lot of sort of sensor types. As Mug-OBS, Manta-OBS rated 6000m is designed to resist a trawling. All the components are non corrosive such polyethylene, titanium and buoyancy is ensured by syntactic foam. Equipped in standard version with a Trillium compact OBS Manta has an autonomy of 18 months, but can accept on its 4 input channels any kind of signal as low as from an hydrophone or larger from other type of a seismometer or accelerometer. Tri-axial geophones unit (2 Hz or 4.5 Hz ) can replace the seismometer and will expend the lifespan for the instrument. The seismometer is encapsulated in a central well established by four panels of the main structure to protect it from sea current convection and is decoupled from main chassis. An health bulletin is recoverable by acoustic any time to facilitate the installation and during a visit when instrument is deployed. Main parameters for acquisition can be changed by acoustics command from surface at any time. Once at the bottom, release for the main sensor installation is programmed on a timer but controlled by the tilt of the OBS. If the tilt is too important based on programmed limits, sensor will not released automatically, but this can be forced by acoustic command after returning the tilt informations to the boat operator. Manta is equipped with flash light and AIS system for easy location at recovery, and can also send it's position by Iridium satellite in case of an unexpected ascent such caused by a possible trawling if deployed in shallow water. Clock drift calculation is automatically made against GPS time signal once the OBS return at the surface. The recovery of the OBS is initiated by an acoustic command. These new features made Manta a very versatile instrument for monitoring earthquakes.

  7. Kefir improves fatty liver syndrome by inhibiting the lipogenesis pathway in leptin-deficient ob/ob knockout mice.

    Science.gov (United States)

    Chen, H-L; Tung, Y-T; Tsai, C-L; Lai, C-W; Lai, Z-L; Tsai, H-C; Lin, Y-L; Wang, C-H; Chen, C-M

    2014-09-01

    Fatty liver disease is commonly associated with obesity, insulin resistance and diabetes. Severe fatty liver is sometimes accompanied by steatohepatitis and may lead to the development of hepatocellular carcinoma. At present, there is no effective treatment for non-alcoholic fatty liver disease (NAFLD); thus, recent investigations have focused on developing effective therapeutics to treat this condition. This study aimed to evaluate the effects of kefir on the hepatic lipid metabolism of ob/ob mice, which are commonly used to model fatty liver disease. In this study, we used leptin receptor-deficient ob/ob mice as an animal disease model of NAFLD. Six-week-old ob/ob mice were orally administered the dairy product kefir (140 mg kg(-1) of body weight (BW) per day) for 4 weeks. The data demonstrated that kefir improved fatty liver syndrome on BW, energy expenditure and basal metabolic rate by inhibiting serum glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) activities (Pkefir administration also significantly reduced the macrovesicular fat quantity in liver tissue. In addition, kefir markedly decreased the expression of the genes sterol regulatory element-binding protein 1 (SREBP1), fatty acid synthase (FAS) and acetyl-CoA carboxylase (ACC) (Pkefir improves NAFLD on BW, energy expenditure and basal metabolic rate by inhibiting the lipogenesis pathway and that kefir may have the potential for clinical application to the prevention or treatment of NAFLD.

  8. Hypothalamic Leptin Gene Therapy Reduces Bone Marrow Adiposity in ob/ob Mice Fed Regular and High Fat Diets

    Directory of Open Access Journals (Sweden)

    Laurence B Lindenmaier

    2016-08-01

    Full Text Available Low bone mass is often associated with increased bone marrow adiposity. Since osteoblasts and adipocytes are derived from the same mesenchymal stem cell progenitor, adipocyte formation may increase at the expense of osteoblast formation. Leptin is an adipocyte-derived hormone known to regulate energy and bone metabolism. Genetic (e.g., leptin deficiency and high fat diet-induced (e.g., leptin resistance obesity are associated with increased marrow adipose tissue (MAT and reduced bone formation. Short-duration studies suggest that leptin treatment reduces MAT and increases bone formation in leptin-deficient ob/ob mice fed a regular diet. Here, we determined the long-duration impact of increased hypothalamic leptin on marrow adipocytes and osteoblasts in ob/ob mice using recombinant adeno-associated virus (rAAV gene therapy. In a first study, eight- to ten-week-old male ob/ob mice were randomized into 4 groups: (1 untreated, (2 rAAV-Lep, (3 rAAV-green fluorescent protein (rAAV-GFP, or (4 pair-fed to rAAV-Lep. For vector administration, mice were placed in a Kopf stereotaxic apparatus, and injected intracerebroventricularly with either rAAV-Lep or rAAV-GFP (9 × 107 particles in 1.5 µl. The mice were maintained for 30 weeks following vector administration. In a second study, the impact of increased hypothalamic leptin levels on MAT was determined in mice fed high fat diets. Eight- to ten-week-old male ob/ob mice were randomized into 2 groups and treated with either rAAV-Lep or rAAV-GFP. At 7 weeks post-vector administration, half the mice in each group were switched to a high fat diet for 8 weeks. Wild type (WT controls included age-matched mice fed regular or high fat diet. Hypothalamic leptin gene therapy increased osteoblast perimeter and osteoclast perimeter with minor change in cancellous bone architecture. The gene therapy decreased MAT levels in ob/ob mice fed regular or high fat diet to values similar to WT mice fed regular diet. These

  9. Deflection routing scheme for GMPLS-based OBS networks

    DEFF Research Database (Denmark)

    Eid, Arafat; Mahmood, Waqar; Alomar, Anwar

    2010-01-01

    Integrating the Generalized Multi-Protocol Label Switching (GMPLS) framework into an Optical Burst Switching (OBS) Control Plane is a promising solution to alleviating most of OBS performance and design issues. However, implementing the already proposed OBS deflection routing schemes is not appli...

  10. Automated identification of OB associations in M31

    Science.gov (United States)

    Magnier, Eugene A.; Battinelli, Paolo; Lewin, Walter H. G.; Haiman, Zoltan; Paradijs, Jan Van; Hasinger, Guenther; Pietsch, Wolfgang; Supper, Rodrigo; Truemper, Joachim

    1993-01-01

    A new identification of OB associations in M31 has been performed using the Path Linkage Criterion (PLC) technique of Battinelli (1991). We found 174 associations with a very small contamination (less than 5%) by random clumps of stars. The expected total number and average size of OB associations in the region of M 31 covered by our data set (Magnier et al. 1992) are approximately 280 and approximately 90 pc, respectively. M31 associations therefore have sizes similar to those of OB associations observed in nearby galaxies, so that we can consider them to be classical OB associations. This list of OB associations will be used for the study of the spatial distribution of OB associations and their correlation with other objects. Taking into account the fact that we do not cover the entire disk of M31, we extrapolate a total number of association in M31 of approximately 420.

  11. Enhanced glucose cycling and suppressed de novo synthesis of glucose-6-phosphate result in a net unchanged hepatic glucose output in ob/ob mice

    NARCIS (Netherlands)

    Bandsma, RHJ; Grefhorst, A; van Dijk, TH; van der Sluijs, FH; Hammer, A; Reijngoud, DJ; Kuipers, F

    2004-01-01

    Aims/hypothesis. Leptin-deficient ob/ob mice are hyperinsulinaemic and hyperglycaemic; however, the cause of hyperglycaemia remains largely unknown. Methods. Glucose metabolism in vivo in 9-h fasted ob/ob mice and lean littermates was studied by infusing [U-C-13]-glucose, [2-C-13]-glycerol,

  12. Switching performance of OBS network model under prefetched real traffic

    Science.gov (United States)

    Huang, Zhenhua; Xu, Du; Lei, Wen

    2005-11-01

    Optical Burst Switching (OBS) [1] is now widely considered as an efficient switching technique in building the next generation optical Internet .So it's very important to precisely evaluate the performance of the OBS network model. The performance of the OBS network model is variable in different condition, but the most important thing is that how it works under real traffic load. In the traditional simulation models, uniform traffics are usually generated by simulation software to imitate the data source of the edge node in the OBS network model, and through which the performance of the OBS network is evaluated. Unfortunately, without being simulated by real traffic, the traditional simulation models have several problems and their results are doubtable. To deal with this problem, we present a new simulation model for analysis and performance evaluation of the OBS network, which uses prefetched IP traffic to be data source of the OBS network model. The prefetched IP traffic can be considered as real IP source of the OBS edge node and the OBS network model has the same clock rate with a real OBS system. So it's easy to conclude that this model is closer to the real OBS system than the traditional ones. The simulation results also indicate that this model is more accurate to evaluate the performance of the OBS network system and the results of this model are closer to the actual situation.

  13. Leptin Reduces the Expression and Increases the Phosphorylation of the Negative Regulators of GLUT4 Traffic TBC1D1 and TBC1D4 in Muscle of ob/ob Mice

    Science.gov (United States)

    Sáinz, Neira; Rodríguez, Amaia; Catalán, Victoria; Becerril, Sara; Ramírez, Beatriz; Lancha, Andoni; Burgos-Ramos, Emma; Gómez-Ambrosi, Javier; Frühbeck, Gema

    2012-01-01

    Leptin improves insulin sensitivity in skeletal muscle. Our goal was to determine whether proteins controlling GLUT4 traffic are altered by leptin deficiency and in vivo leptin administration in skeletal muscle of wild type and ob/ob mice. Leptin-deficient ob/ob mice were divided in three groups: control, leptin-treated (1 mg/kg/d) and leptin pair-fed ob/ob mice. Microarray analysis revealed that 1,546 and 1,127 genes were regulated by leptin deficiency and leptin treatment, respectively. Among these, we identified 24 genes involved in intracellular vesicle-mediated transport in ob/ob mice. TBC1 domain family, member 1 (Tbc1d1), a negative regulator of GLUT4 translocation, was up-regulated (P = 0.001) in ob/ob mice as compared to wild types. Importantly, leptin treatment reduced the transcript levels of Tbc1d1 (P<0.001) and Tbc1d4 (P = 0.004) in the leptin-treated ob/ob as compared to pair-fed ob/ob animals. In addition, phosphorylation levels of TBC1D1 and TBC1D4 were enhanced in leptin-treated ob/ob as compared to control ob/ob (P = 0.015 and P = 0.023, respectively) and pair-fed ob/ob (P = 0.036 and P = 0.034, respectively) mice. Despite similar GLUT4 protein expression in wild type and ob/ob groups a different immunolocalization of this protein was evidenced in muscle sections. Leptin treatment increased GLUT4 immunoreactivity in gastrocnemius and extensor digitorum longus sections of leptin-treated ob/ob mice. Moreover, GLUT4 protein detected in immunoprecipitates from TBC1D4 was reduced by leptin replacement compared to control ob/ob (P = 0.013) and pair-fed ob/ob (P = 0.037) mice. Our findings suggest that leptin enhances the intracellular GLUT4 transport in skeletal muscle of ob/ob animals by reducing the expression and activity of the negative regulators of GLUT4 traffic TBC1D1 and TBC1D4. PMID:22253718

  14. Sequential formation of subgroups in OB associations

    International Nuclear Information System (INIS)

    Elmegreen, B.G.; Lada, C.J.

    1977-01-01

    We reconsider the structure and formation of OB association in view of recent radio and infrared observations of the adjacent molecular clouds. As a result of this reexamination, we propose that OB subgroups are formed in a step-by-step process which involves the propagation of ionization (I) and shock (S) fronts through a molecular cloud complex. OB stars formed at the edge of a molecular cloud drive these I-S fronts into the cloud. A layer of dense neutral material accumulates between the I and S fronts and eventually becomes gravitationally unstable. This process is analyzed in detail. Several arguments concerning the temperature and mass of this layer suggest that a new OB subgroup will form. After approximately one-half million years, these stars will emerge from and disrupt the star-forming layer. A new shock will be driven into the remaining molecular cloud and will initiate another cycle of star formation.Several observed properties of OB associations are shown to follow from a sequential star-forming mechanism. These include the spatial separation and systematic differences in age of OB subgroups in a given association, the regularity of subgroup masses, the alignment of subgroups along the galactic plane, and their physical expansion. Detailed observations of ionization fronts, masers, IR sources, and molecular clouds are also in agreement with this model. Finally, this mechanism provides a means of dissipating a molecular cloud and exposing less massive stars (e.g., T Tauri stars) which may have formed ahead of the shock as part of the original cloud collapsed and fragmented

  15. Searching for self-enrichment in Cygnus OB2

    Science.gov (United States)

    Berlanas, Sara R.; Herrero, Artemio; Comerón, Fernando; Pasquali, Anna; Simón-Díaz, Sergio

    2017-11-01

    Cygnus OB2 is a rich and relatively close (d~1.4 kpc) OB association in our Galaxy. It represents an ideal testbed for our theories about self-enrichment processes produced by pollution of the interstellar medium by successive generations of massive stars. Comerón & Pasquali (2012, A&A, 543, A101) found a correlation between the age of young stellar groups in Cygnus OB2 and their Galactic longitude. If is associated with a chemical composition gradient, it could support these self-enrichment processes.

  16. Oral delivery of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, synthetic peptide leptin mimetics: Immunofluorescent localization in the mouse hypothalamus.

    Science.gov (United States)

    Anderson, Brian M; Jacobson, Lauren; Novakovic, Zachary M; Grasso, Patricia

    2017-06-01

    This study describes the localization of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, synthetic peptide leptin mimetics, in the hypothalamus of Swiss Webster and C57BL/6J wild-type mice, leptin-deficient ob/ob mice, and leptin-resistant diet-induced obese (DIO) mice. The mice were given [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in 0.3% dodecyl maltoside by oral gavage. Once peak serum concentrations were reached, the mice received a lethal dose of pentobarbital and were subjected to intracardiac perfusion fixation. The brains were excised, post-fixed in paraformaldehyde, and cryo-protected in sucrose. Free-floating frozen coronal sections were cut at 25-µm and processed for imaging by immunofluorescence microscopy. In all four strains of mice, dense staining was concentrated in the area of the median eminence, at the base and/or along the inner wall of the third ventricle, and in the brain parenchyma at the level of the arcuate nucleus. These results indicate that [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 cross the blood-brain barrier and concentrate in an area of the hypothalamus known to regulate energy balance and glucose homeostasis. Most noteworthy is the localization of [D-Leu-4]-OB3 immunoreactivity within the hypothalamus of DIO mice via a conduit that is closed to leptin in this rodent model, and in most cases of human obesity. Together with our previous studies describing the effects of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on energy balance, glucose regulation, and signal transduction pathway activation, these findings are consistent with a central mechanism of action for these synthetic peptide leptin mimetics, and suggest their potential usefulness in the management of leptin-resistant obesity and type 2 diabetes in humans. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Expression of the P2X2 receptor in different classes of ileum myenteric neurons in the female obese ob/ob mouse

    Science.gov (United States)

    Mizuno, Márcia Sanae; Crisma, Amanda Rabello; Borelli, Primavera; Castelucci, Patricia

    2012-01-01

    AIM: To examine whether the ob/ob mouse model of obesity is accompanied by enteric nervous system abnormalities such as altered motility. METHODS: The study examined the distribution of the P2X2 receptor (P2X2R) in myenteric neurons of female ob/ob mice. Specifically, we used immunohistochemistry to analyze the co-expression of the P2X2R with neuronal nitric oxide synthase (nNOS), choline acetyltransferase (ChAT), and calretinin (CalR) in neurons of the small intestine myenteric plexus in ob/ob and control female mice. In these sections, we used scanning confocal microscopy to analyze the co-localization of these markers as well as the neuronal density (cm2) and area profile (μm²) of P2X2R-positive neurons. In addition, enteric neurons were labeled using the nicotinamide adenine dinucleotide (NADH) diaphorase method and analyzed with light microscopy as an alternate means by which to analyze neuronal density and area. RESULTS: In the present study, we observed a 29.6% increase in the body weight of the ob/ob animals (OG) compared to the control group (CG). In addition, the average small intestine area was increased by approximately 29.6% in the OG compared to the CG. Immunoreactivity (IR) for the P2X2R, nNOS, ChAT and CalR was detectable in the myenteric plexus, as well as in the smooth muscle, in both groups. This IR appeared to be mainly cytoplasmic and was also associated with the cell membrane of the myenteric plexus neurons, where it outlined the neuronal cell bodies and their processes. P2X2R-IR was observed to co-localize 100% with that for nNOS, ChAT and CalR in neurons of both groups. In the ob/ob group, however, we observed that the neuronal density (neuron/cm2) of P2X2R-IR cells was increased by 62% compared to CG, while that of NOS-IR and ChAT-IR neurons was reduced by 49% and 57%, respectively, compared to control mice. The neuronal density of CalR-IR neurons was not different between the groups. Morphometric studies further demonstrated that the

  18. Reverse time migration of multiples for OBS data

    KAUST Repository

    Zhang, Dongliang

    2014-01-01

    Reverse time migration of multiples (RTMM) is applied to OBS data with sparse receiver spacing. RTMM for OBS data unlike a marine streamer acquisition is implemented in the common receiver gathers (CRG) and provides a wider and denser illumination for each CRG than the conventional RTM of primaries. Hence, while the the conventional RTM image contains strong aliasing artifacts due to a sparser receiver interval, the RTMM image suffers from this artifacts less. This benefit of RTMM is demonstrated with numerical test on the Marmousi model for sparsely sampled OBS data.

  19. Reverse time migration of multiples for OBS data

    KAUST Repository

    Zhang, Dongliang

    2014-08-05

    Reverse time migration of multiples (RTMM) is applied to OBS data with sparse receiver spacing. RTMM for OBS data unlike a marine streamer acquisition is implemented in the common receiver gathers (CRG) and provides a wider and denser illumination for each CRG than the conventional RTM of primaries. Hence, while the the conventional RTM image contains strong aliasing artifacts due to a sparser receiver interval, the RTMM image suffers from this artifacts less. This benefit of RTMM is demonstrated with numerical test on the Marmousi model for sparsely sampled OBS data.

  20. 2MASS Identifications for Galactic OB Stars

    OpenAIRE

    Reed, B. Cameron

    2007-01-01

    Cross-identifications for 14,574 intrinsically luminous galactic stars (mostly OB stars) to objects in the 2MASS survey have been determined using a search box of +/-0.0015 degrees (+/- 5.4 arcsec) in both RA and Dec. Instructions on obtaining the relevant files can be obtained at othello.alma.edu/~reed/OB-2MASS.doc.

  1. Obs4MIPS: Satellite Observations for Model Evaluation

    Science.gov (United States)

    Ferraro, R.; Waliser, D. E.; Gleckler, P. J.

    2017-12-01

    This poster will review the current status of the obs4MIPs project, whose purpose is to provide a limited collection of well-established and documented datasets for comparison with Earth system models (https://www.earthsystemcog.org/projects/obs4mips/). These datasets have been reformatted to correspond with the CMIP5 model output requirements, and include technical documentation specifically targeted for their use in model output evaluation. The project holdings now exceed 120 datasets with observations that directly correspond to CMIP5 model output variables, with new additions in response to the CMIP6 experiments. With the growth in climate model output data volume, it is increasing more difficult to bring the model output and the observations together to do evaluations. The positioning of the obs4MIPs datasets within the Earth System Grid Federation (ESGF) allows for the use of currently available and planned online tools within the ESGF to perform analysis using model output and observational datasets without necessarily downloading everything to a local workstation. This past year, obs4MIPs has updated its submission guidelines to closely align with changes in the CMIP6 experiments, and is implementing additional indicators and ancillary data to allow users to more easily determine the efficacy of an obs4MIPs dataset for specific evaluation purposes. This poster will present the new guidelines and indicators, and update the list of current obs4MIPs holdings and their connection to the ESGF evaluation and analysis tools currently available, and being developed for the CMIP6 experiments.

  2. Mining the Obscured OB Star Population in Carina

    Science.gov (United States)

    Smith, Michael

    2016-04-01

    Massive OB stars are very influential objects in the ecology of galaxies like our own. Current catalogues of Galactic OB stars are heavily biased towards bright (g selected OB stars across the entire Southern Galactic plane, both within clusters and in the field, down to ∼20th magnitude in g. For the first time, a complete accounting of the OB star runaway phenomenon becomes possible. Along with making the primary selection using VPHAS+ colours, I have performed Markov-Chain Monte Carlo fitting of the spectral energy distributions of the selected stars by combining VPHAS+ u, g, r, i with published J, H, K photometry. This gives rough constraints on effective temperature and distance, whilst delivering much more precise reddening parameters A0 and RV - allowing us to build a much richer picture of how extinction and extinction laws vary across the Galactic Plane. My thesis begins with a description of the method of photometric selection of OB star candidates and its validation across a 2 square degree field including the well-known young massive star cluster Westerlund 2 (Mohr-Smith et al., 2015). Following on from this I present spectroscopy with AAOmega of 283 candidates identified by our method, which confirms that ∼94% of the sample are the expected O and early B stars. I then develop this method further and apply it to a Galactic Plane strip of 42 square-degrees that runs from the Carina Arm tangent region to the much studied massive cluster in NGC 3603. A new aspect I attend to in this expansion of method is tightening up the uniform photometric calibration of the data, paying particular attention to the always-challenging u band. This leads to a new and reliable catalogue of 5915 OB stars. As well as increasing the numbers of identified massive stars in this large region of the sky by nearly an order of magnitude, a more complete picture of massive star formation in the Carina Arm has emerged. I have found a broad over-density of O stars around the highly

  3. New Results on the Nearest OB Association: Sco-Cen (Sco OB2)

    Science.gov (United States)

    Mamajek, Eric E.

    2013-01-01

    The Scorpius-Centaurus OB association (Sco OB2) is the nearest site of recent massive star formation to the Sun. The primary stellar groups in the Sco-Cen complex (including OB subgroups Upper Sco, Upper Cen Lup, and Lower Cen Cru, the neighboring molecular cloud complexes Lup, Cha, CrA, Oph, and dispersed young groups Eta Cha, Epsilon Cha, TW Hya, and Beta Pic) have been participants in a complex episode of stellar birth (and some stellar death) over the past ~20 Myr. Here I summarize some recent results on the Sco-Cen complex from the U. Rochester group: (1) isochronal analysis of the HR diagram positions for >1 Msun stars in the Upper Scorpius subgroup shows it to be twice as old as previously thought (11 Myr vs. 5 Myr), (2) analysis of high resolution optical echelle spectra show that the subgroups are approximately solar in composition, (3) surveys for lower mass members are showing that the complex shows more substructure than previously recognized, including at least one new subgroup ("Lower Sco"), and the velocity and age data for the nearest OB subgroup Lower Cen Cru argue for a bifurcation into a younger 10 Myr) southern part ("Crux") and an older 20 Myr) northern part ("Lower Centaurus"), (4) an eclipsing, multi-ring dust disk system was serendipitously discovered in the SuperWASP and ASAS light curve for the newly discovered K5-type Sco-Cen member 1SWASP J140747.93-394542.6. With regard to some recent results by other investigators, we find that (1) attempts by some authors to subsume the Sco-Cen subgroups into a single sample of a single age are unnecessarily mixing samples with a wide range in ages, and (2) I have been unable to replicate the expansion age determinations claimed by some investigators for the TW Hya and Beta Pic groups (both purported to have expansion ages of 8 and 12 Myr, respectively), which have been used by some investigators to independently age-date the Sco-Cen subgroups. We acknowledge support from NSF grant AST-1008908 and the

  4. Influences of obese (ob/ob and diabetes (db/db genotype mutations on lumber vertebral radiological and morphometric indices: Skeletal deformation associated with dysregulated systemic glucometabolism

    Directory of Open Access Journals (Sweden)

    Garris David R

    2006-02-01

    Full Text Available Abstract Background Both diabetes and obesity syndromes are recognized to promote lumbar vertebral instability, premature osteodegeneration, exacerbate progressive osteoporosis and increase the propensity towards vertebral degeneration, instability and deformation in humans. Methods The influences of single-gene missense mutations, expressing either diabetes (db/db or obese (ob/ob metabolic syndromes on vertebral maturation and development in C57BL/KsJ mice were evaluated by radiological and macro-morphometric analysis of the resulting variances in osteodevelopment indices relative to control parameters between 8 and 16 weeks of age (syndrome onset @ 4 weeks, and the influences of low-dose 17-B-estradiol therapy on vertebral growth expression evaluated. Results Associated with the indicative genotypic obesity and hyper-glycemic/-insulinemic states, both db/db and ob/ob mutants demonstrated a significant (P ≤ 0.05 elongation of total lumbar vertebrae column (VC regional length, and individual lumbar vertebrae (LV1-5 lengths, relative to control VC and LV parameters. In contrast, LV1-5 width indices were suppressed in db/db and ob/ob mutants relative to control LV growth rates. Between 8 and 16 weeks of age, the suppressed LV1-5 width indices were sustained in both genotype mutant groups relative to control osteomaturation rates. The severity of LV1-5 width osteosuppression correlated with the severe systemic hyperglycemic and hypertriglyceridemic conditions sustained in ob/ob and db/db mutants. Low-dose 17-B-estradiol therapy (E2-HRx: 1.0 ug/ 0.1 ml oil s.c/3.5 days, initiated at 4 weeks of age (i.e., initial onset phase of db/db and ob/ob expressions re-established control LV 1–5 width indices without influencing VC or LV lengths in db/db groups. Conclusion These data demonstrate that the abnormal systemic endometabolic states associated with the expression of db/db and ob/ob genomutation syndromes suppress LV 1–5 width osteomaturation

  5. [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3, small molecule synthetic peptide leptin mimetics, improve glycemic control in diet-induced obese (DIO) mice.

    Science.gov (United States)

    Wang, Anke; Anderson, Brian M; Novakovic, Zachary M; Grasso, Patricia

    2018-03-01

    We have previously shown that following oral delivery in dodecyl maltoside (DDM), [D-Leu-4]-OB3 and its myristic acid conjugate, MA-[D-Leu-4]-OB3, improved energy balance and glucose homeostasis in genetically obese/diabetic mouse models. More recently, we have provided immunohistochemical evidence indicating that these synthetic peptide leptin mimetics cross the blood-brain barrier and concentrate in the area of the arcuate nucleus of the hypothalamus in normal C57BL/6J and Swiss Webster mice, in genetically obese ob/ob mice, and in diet-induced obese (DIO) mice. In the present study, we describe the effects of oral delivery of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control in diet-induced (DIO) mice, a non-genetic rodent model of obesity and its associated insulin resistance, which more closely recapitulates common obesity and diabetes in humans. Male C57BL/6J and DIO mice, 17, 20, and 28 weeks of age, were maintained on a low-fat or high-fat diet and given vehicle (DDM) alone or [D-Leu-4]-OB3 or MA-[D-Leu-4]-OB3 in DDM by oral gavage for 12 or 14 days. Body weight gain, food and water intake, fasting blood glucose, oral glucose tolerance, and serum insulin levels were measured. Our data indicate that (1) [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 restore glucose tolerance in male DIO mice maintained on a high-fat diet to levels comparable to those of non-obese C57BL/6J wild-type mice of the same age and sex maintained on a low-fat diet; and (2) the influence of [D-Leu-4]-OB3 and MA-[D-Leu-4]-OB3 on glycemic control appears to be independent of their effects on energy balance. These results suggest that [D-Leu-4]-OB3 and/or MA-[D-Leu-4]-OB3 may have application to the management of the majority of cases of common obesity in humans, a state characterized at least in part, by leptin resistance resulting from a defect in leptin transport across the blood-brain barrier. They further suggest that these small molecule synthetic peptide leptin mimetics, through their

  6. Hormone-sensitive lipase deficiency suppresses insulin secretion from pancreatic islets of Lepob/ob mice

    International Nuclear Information System (INIS)

    Sekiya, Motohiro; Yahagi, Naoya; Tamura, Yoshiaki; Okazaki, Hiroaki; Igarashi, Masaki; Ohta, Keisuke; Takanashi, Mikio; Kumagai, Masayoshi; Takase, Satoru; Nishi, Makiko; Takeuchi, Yoshinori; Izumida, Yoshihiko; Kubota, Midori; Ohashi, Ken; Iizuka, Yoko; Yagyu, Hiroaki; Gotoda, Takanari; Nagai, Ryozo; Shimano, Hitoshi; Yamada, Nobuhiro

    2009-01-01

    It has long been a matter of debate whether the hormone-sensitive lipase (HSL)-mediated lipolysis in pancreatic β-cells can affect insulin secretion through the alteration of lipotoxicity. We generated mice lacking both leptin and HSL (Lep ob/ob /HSL -/- ) and explored the role of HSL in pancreatic β-cells in the setting of obesity. Lep ob/ob /HSL -/- developed elevated blood glucose levels and reduced plasma insulin levels compared with Lep ob/ob /HSL +/+ in a fed state, while the deficiency of HSL did not affect glucose homeostasis in Lep +/+ background. The deficiency of HSL exacerbated the accumulation of triglycerides in Lep ob/ob islets, leading to reduced glucose-stimulated insulin secretion. The deficiency of HSL also diminished the islet mass in Lep ob/ob mice due to decreased cell proliferation. In conclusion, HSL affects insulin secretary capacity especially in the setting of obesity.

  7. Recent Seismic Experiments of OBS in the South China Sea

    Science.gov (United States)

    Ruan, A.; Li, J.; Wu, Z.

    2012-12-01

    Since 2006 some research institutions of China have carried out some important seismic experiments by using ocean bottom seismometer(OBS) in the South China Sea (SCS) and obtained many concrete progresses in modeling the crustal structure of SCS and also in understanding of its formation and evolution as well. In 2006 three wide-angle profiles were completed in the northern margin, named OBS2006-1 across the northwestern sub-basin, OBS2006-2 parallel to the sea basin boundary and OBS2006-3 across the Dongsha Rise and Chaoshan Depression respectively. In 2010 two wide- angle profiles were completed, named OBS2010-1 and OBS 2010-2 both perpendicular to the northern off-shore faulting system. During 2009-2011 four wide-angle profiles were completed in the southern margin, named OBS973-1 from southern margin to the southwestern sub-basin, OBS973-2 from Liyue Bank to the southwestern sub-basin and OBS973-3 from Xisha to the southwestern sub-basin, OBS2011-2 from Xisha to Hainan Island respectively. In 2011 two 3D seismic array of OBS were completed in the Zhongnan-Changlong sea mount chain and Huangyan-Zhenbei sea mount chain respectively. Here we present some primary but important results as follows. (1) The velocity model of OBS2006-1 indicates that the crust under the continental slope decreases from 21km to 11km, and to 7.7km in the northwestern sub-basin with Moho depth ascends from 21km to 11km. The tectonic geometry and velocity structure of the northwestern sub-basin and its margins on both sides shows symmetrical and conjugate and indicates pure shear mode of continental margin rifting mechanism. (2) The velocity model of OBS2006-3 reveals remarkable thickness with maximum 8 km of the Mesozoic sediment in Chaoshan Depression in which velocity increases downward from 4.4 km/s at top to 5.3 km/s at the bottom. The buried depth of Moho decreases from 24-25 km under Dongsha Rise to 17 km in the lower slope and an obviously velocity abnormal is detected in the upper

  8. A CATALOG OF NEW SPECTROSCOPICALLY CONFIRMED MASSIVE OB STARS IN CARINA

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, Michael J.; Hanes, Richard J.; McSwain, M. Virginia [Department of Physics, Lehigh University, 16 Memorial Drive East, Bethlehem, PA 18015 (United States); Povich, Matthew S., E-mail: alexamic@lafayette.edu, E-mail: rjh314@lehigh.edu, E-mail: mcswain@lehigh.edu, E-mail: mspovich@cpp.edu [Department of Physics and Astronomy, California State Polytechnic University, Pomona, CA 91768 (United States)

    2016-12-01

    The Carina star-forming region is one of the largest in the Galaxy, and its massive star population is still being unveiled. The large number of stars combined with high, and highly variable, interstellar extinction makes it inherently difficult to find OB stars in this type of young region. We present the results of a spectroscopic campaign to study the massive star population of the Carina Nebula, with the primary goal to confirm or reject previously identified Carina OB star candidates. A total of 141 known O- and B-type stars and 94 candidates were observed, of which 73 candidates had high enough signal-to-noise ratio to classify. We find 23 new OB stars within the Carina Nebula, a 32% confirmation rate. One of the new OB stars has blended spectra and is suspected to be a double-lined spectroscopic binary (SB2). We also reclassify the spectral types of the known OB stars and discover nine new SB2s among this population. Finally, we discuss the spatial distribution of these new OB stars relative to known structures in the Carina Nebula.

  9. Arctigenin, a natural compound, activates AMP-activated protein kinase via inhibition of mitochondria complex I and ameliorates metabolic disorders in ob/ob mice.

    Science.gov (United States)

    Huang, S-L; Yu, R-T; Gong, J; Feng, Y; Dai, Y-L; Hu, F; Hu, Y-H; Tao, Y-D; Leng, Y

    2012-05-01

    Arctigenin is a natural compound that had never been previously demonstrated to have a glucose-lowering effect. Here it was found to activate AMP-activated protein kinase (AMPK), and the mechanism by which this occurred, as well as the effects on glucose and lipid metabolism were investigated. 2-Deoxyglucose uptake and AMPK phosphorylation were examined in L6 myotubes and isolated skeletal muscle. Gluconeogenesis and lipid synthesis were evaluated in rat primary hepatocytes. The acute and chronic effects of arctigenin on metabolic abnormalities were observed in C57BL/6J and ob/ob mice. Changes in mitochondrial membrane potential were measured using the J-aggregate-forming dye, JC-1. Analysis of respiration of L6 myotubes or isolated mitochondria was conducted in a channel oxygen system. Arctigenin increased AMPK phosphorylation and stimulated glucose uptake in L6 myotubes and isolated skeletal muscles. In primary hepatocytes, it decreased gluconeogenesis and lipid synthesis. The enhancement of glucose uptake and suppression of hepatic gluconeogenesis and lipid synthesis by arctigenin were prevented by blockade of AMPK activation. The respiration of L6 myotubes or isolated mitochondria was inhibited by arctigenin with a specific effect on respiratory complex I. A single oral dose of arctigenin reduced gluconeogenesis in C57BL/6J mice. Chronic oral administration of arctigenin lowered blood glucose and improved lipid metabolism in ob/ob mice. This study demonstrates a new role for arctigenin as a potent indirect activator of AMPK via inhibition of respiratory complex I, with beneficial effects on metabolic disorders in ob/ob mice. This highlights the potential value of arctigenin as a possible treatment of type 2 diabetes.

  10. Zinc metabolism in genetically obese (ob/ob) mice

    International Nuclear Information System (INIS)

    Kennedy, M.L.; Failla, M.L.

    1987-01-01

    Recent reports indicate that the concentrations and total amounts of several essential trace metals in various tissues of genetically obese rodents differ markedly from those in lean controls. In the present studies the absorption, retention and tissue distribution of zinc and constitutive levels of zinc-metallothionein (Zn-MT) in selected tissues were compared in obese (ob/ob) and lean (+/?) C57BL/6J mice. When 5-, 10- and 22-wk-old mice were administered 1.2 mumol 65 Zn by stomach tube the apparent absorption of 65 Zn by obese mice was 1.5, 2.2 and 3.9 times higher, respectively, than that in age-matched lean mice. Retention of orally administered 65 Zn after 96 h was also substantially higher in obese mice than in lean mice. To assess the possible influences of hyperphagia and intestinal hypertrophy on the enhanced apparent absorption of 65 Zn by obese mice food intake by an additional group of obese mice was restricted to that of age-matched lean controls. When actual absorption of zinc was determined according to the method of Heth and Hoekstra, groups of ad libitum--fed obese, pair-fed obese and lean mice absorbed 38, 32 and 18% of administered 65 Zn, respectively. In contrast, the rate of 65 Zn excretion 2-6 d after oral or subcutaneous administration of the metal was similar for obese and lean mice. Unrestricted and pair-fed obese mice had significantly lower percentages of carcass 65 Zn present in skin, muscle plus bone, spleen and testes and higher percentages present in liver, small intestine and adipose tissue than lean mice

  11. Modelling of slag emulsification and slag reduction in CAS-OB process

    OpenAIRE

    Sulasalmi, P. (Petri)

    2016-01-01

    Abstract Composition Adjustment by Sealed argon bubbling – Oxygen Blowing (CAS-OB) process is a ladle treatment process that was developed for chemical heating and alloying of steel. The main stages of the process are heating, (possible) alloying and reduction of slag. The CAS-OB process aims for homogenization and control of the composition and temperature of steel. In this dissertation, a mathematical reaction model was developed for the slag reduction stage of the CAS-OB process. Sl...

  12. Variability of X-ray emission from OB stars

    International Nuclear Information System (INIS)

    Collura, A.; Sciortino, S.; Serio, S.; Vaiana, G. S.; Harnden, F.R. JR.; Osservatorio Astronomico, Palermo, Italy; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

    1989-01-01

    The variability in soft X-ray emission of 12 OB stars is studied. Two different methods of analysis, one more suitable for detecting short-term variations, the other aimed at detecting long time-scale variations, are applied to all stars in the sample. The long-term variability analysis shows that Cyg-OB2 8A Zeta Pup and Delta Ori exhibit significant count rate variations between different data sections. Similar variations are marginally detected in 15 Mon; the count rate variations for the other eight stars are consistent with statistical fluctuations. The light curve of Cyg-OB2 8A suggests the existence of two different emission levels. The short-term variability analysis detects marginal variability in Tau Sco with an effective amplitude of about 30 percent and a time scale of about 50 s. The upper limits to the effective short-term variability amplitude for all other sample stars are in the 10-30 percent range. 30 refs

  13. Impaired transport of thyroid hormones into livers of obese (ob/ob) mice

    International Nuclear Information System (INIS)

    Hillgartner, F.B.; Romsos, D.R.

    1988-01-01

    Obese (ob/ob) mice exhibit impaired hepatic thyroid hormone action that is mediated, at least in part, by a reduced nuclear 3,5,3'-triiodothyronine (T 3 ) receptor occupancy. The possibility that lowered occupancy in obese mice may be caused by decreased transport of T 3 across the hepatic plasma membrane was examined by measuring the unidirectional influx of [ 125 I]T 3 into livers of 8- to 10-wk-old obese and lean mice using a tissue-sampling portal vein-injection technique. Influx of [ 125 I]thyroxine (T 4 ), a substrate for T 4 5'-deiodinase, was also measured. Unidirectional clearance of T 3 and T 4 was 64 and 80% lower, respectively, in obese mice than in lean mice. Hepatic T 3 and T 4 uptake was nonsaturable in both lean and obese mice, suggesting that transport occurs by lipid-mediated free diffusion. Clearance of another lipid-soluble hormone, hydrocortisone, was also lower in obese mice than in lean mice. Decreased membrane permeability to the above hormones in obese mice may result from reported changes in membrane lipid composition. In conclusion, decreased hepatic thyroid hormone uptake may contribute to impaired thyroid hormone action and T 3 production in livers of obese mice

  14. Nuclear triiodothyronine receptor binding characteristics and occupancy in obese (ob/ob) mice

    International Nuclear Information System (INIS)

    Hillgartner, F.B.; Romsos, D.R.

    1987-01-01

    Obese (ob/ob) mice exhibit reduced adaptive thermogenesis associated with an impairment of thyroid hormone action. The mechanism underlying the latter defect was investigated by comparing the binding characteristics and occupancy of solubilized nuclear 3,5,3'-triiodothyronine (T 3 ) receptors from livers of lean and obese mice. T 3 concentration was measured by radioimmunoassay. Scatchard analysis showed minimal differences in B/sub max/ and K/sub d/ between phenotypes at both 4 and 8-10 wk of age, indicating that reduced hepatic thyroid hormone expression in obese mice is not caused by alterations in nuclear receptor concentration or affinity. In contrast, nuclear T 3 receptor occupancy (endogenous T 3 associated with the specific receptor divided by B/sub max/) was 14 and 23% lower in 4- and 8- to 10-wk old obese mice, respectively. Together with reported changes in hepatic thyroid hormone-sensitive enzymes, these data are consistent with a diminished nuclear T 3 signal initiating thyroid hormone action in obese mice. Decreased nuclear T 3 receptor occupancy may be secondary to a low transport of plasma T 3 to the nuclear pool. In conclusion, impaired hepatic thyroid hormone action in obese mice is mediated in part at least by a reduction in nuclear T 3 receptor occupancy

  15. Observations of mass loss from OB and Wolf-Rayet stars

    International Nuclear Information System (INIS)

    Barlow, M.J.

    1982-01-01

    In this review, three observationally accessible parameters of the winds of OB and Wolf-Rayet stars are discussed: (1) Terminal velocities, (2) Velocity laws, (3) Mass loss rates. In addition, some discussion of the ionisation structure of the winds is included. In general, only the most recent results for OB stars are mentioned. (Auth.)

  16. COSMIC ORIGINS SPECTROGRAPH OBSERVATIONS OF TRANSLUCENT CLOUDS: Cyg OB2 8A

    International Nuclear Information System (INIS)

    Snow, Theodore P.; Destree, Joshua D.; Burgh, Eric B.; Ferguson, Ryan M.; Danforth, Charles W.; Cordiner, Martin

    2010-01-01

    Data from the Cosmic Origins Spectrograph (COS) are presented for the first highly reddened target (Cyg OB2 8A) under the COS Science Team's guaranteed time allocation. Column densities of ionic, atomic, and molecular species are reported and implications are discussed. Data from Cyg OB2 8A demonstrate the ability to analyze highly reddened interstellar sight lines with the COS that were unavailable to previous UV instruments. Measured column densities indicate that the Cyg OB2 8A line of sight contains multiple diffuse clouds rather than a dominant translucent cloud.

  17. Dietary Capsaicin Improves Glucose Homeostasis and Alters the Gut Microbiota in Obese Diabetic ob/ob Mice

    Directory of Open Access Journals (Sweden)

    Jun-Xian Song

    2017-08-01

    Full Text Available Background: The effects of capsaicin on obesity and glucose homeostasis are still controversial and the mechanisms underlying these effects remain largely unknown. This study aimed to investigate the potential relationship between the regulation of obesity and glucose homeostasis by dietary capsaicin and the alterations of gut microbiota in obese diabetic ob/ob mice.Methods: The ob/ob mice were subjected to a normal, low-capsaicin (0.01%, or high-capsaicin (0.02% diet for 6 weeks, respectively. Obesity phenotypes, glucose homeostasis, the gut microbiota structure and composition, short-chain fatty acids, gastrointestinal hormones, and pro-inflammatory cytokines were measured.Results: Both the low- and high-capsaicin diets failed to prevent the increase in body weight, adiposity index, and Lee's obesity index. However, dietary capsaicin at both the low and high doses significantly inhibited the increase of fasting blood glucose and insulin levels. These inhibitory effects were comparable between the two groups. Similarly, dietary capsaicin resulted in remarkable improvement in glucose and insulin tolerance. In addition, neither the low- nor high-capsaicin diet could alter the α-diversity and β-diversity of the gut microbiota. Taxonomy-based analysis showed that both the low- and high-capsaicin diets, acting in similar ways, significantly increased the Firmicutes/Bacteroidetes ratio at the phylum level as well as increased the Roseburia abundance and decreased the Bacteroides and Parabacteroides abundances at the genus level. Spearman's correlation analysis revealed that the Roseburia abundance was negatively while the Bacteroides and Parabacteroides abundances were positively correlated to the fasting blood glucose level and area under the curve by the oral glucose tolerance test. Finally, the low- and high-capsaicin diets significantly increased the fecal butyrate and plasma total GLP-1 levels, but decreased plasma total ghrelin, TNF-α, IL-1

  18. NEAR INFRARED DIFFUSE INTERSTELLAR BANDS TOWARD THE CYGNUS OB2 ASSOCIATION

    Energy Technology Data Exchange (ETDEWEB)

    Hamano, Satoshi; Kondo, Sohei; Sameshima, Hiroaki; Nakanishi, Kenshi; Kawakita, Hideyo [Laboratory of Infrared High-resolution Spectroscopy, Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Kobayashi, Naoto [Institute of Astronomy, School of Science, University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Ikeda, Yuji [Photocoding, 460-102 Iwakura-Nakamachi, Sakyo-ku, Kyoto, 606-0025 (Japan); Yasui, Chikako; Mizumoto, Misaki; Matsunaga, Noriyuki; Fukue, Kei; Yamamoto, Ryo; Izumi, Natsuko [Department of Astronomy, Graduate School of Science, University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Mito, Hiroyuki [Kiso Observatory, Institute of Astronomy, School of Science, The University of Tokyo, 10762-30 Mitake, Kiso-machi, Kiso-gun, Nagano, 397-0101 (Japan); Nakaoka, Tetsuya; Kawanishi, Takafumi; Kitano, Ayaka; Otsubo, Shogo [Department of Physics, Faculty of Sciences, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Kinoshita, Masaomi, E-mail: hamano@cc.kyoto-su.ac.jp [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi, 464-8601 (Japan)

    2016-04-10

    We obtained the near-infrared (NIR) high-resolution (R ≡ λ/Δλ ∼ 20,000) spectra of the seven brightest early-type stars in the Cygnus OB2 association for investigating the environmental dependence of diffuse interstellar bands (DIBs). The WINERED spectrograph mounted on the Araki 1.3 m telescope in Japan was used to collect data. All 20 of the known DIBs within the wavelength coverage of WINERED (0.91 < λ < 1.36 μm) were clearly detected along all lines of sight because of their high flux density in the NIR wavelength range and the large extinction. The equivalent widths (EWs) of DIBs were not correlated with the column densities of C{sub 2} molecules, which trace the patchy dense component, suggesting that the NIR DIB carriers are distributed mainly in the diffuse component. On the basis of the correlations among the NIR DIBs both for stars in Cyg OB2 and stars observed previously, λλ10780, 10792, 11797, 12623, and 13175 are found to constitute a “family,” in which the DIBs are correlated well over the wide EW range. In contrast, the EW of λ10504 is found to remain almost constant over the stars in Cyg OB2. The extinction estimated from the average EW of λ10504 (A{sub V} ∼ 3.6 mag) roughly corresponds to the lower limit of the extinction distribution of OB stars in Cyg OB2. This suggests that λ10504 is absorbed only by the foreground clouds, implying that the carrier of λ10504 is completely destroyed in Cyg OB2, probably by the strong UV radiation field. The different behaviors of the DIBs may be caused by different properties of the DIB carriers.

  19. ObsPy: A Python Toolbox for Seismology

    Science.gov (United States)

    Krischer, Lion; Megies, Tobias; Sales de Andrade, Elliott; Barsch, Robert; MacCarthy, Jonathan

    2017-04-01

    In recent years the Python ecosystem evolved into one of the most powerful and productive scientific environments across disciplines. ObsPy (https://www.obspy.org) is a fully community-driven, open-source project dedicated to providing a bridge for seismology into that ecosystem. It does so by offering Read and write support for essentially every commonly used data format in seismology with a unified interface and automatic format detection. This includes waveform data (MiniSEED, SAC, SEG-Y, Reftek, …) as well as station (SEED, StationXML, …) and event meta information (QuakeML, ZMAP, …). Integrated access to the largest data centers, web services, and real-time data streams (FDSNWS, ArcLink, SeedLink, ...). A powerful signal processing toolbox tuned to the specific needs of seismologists. Utility functionality like travel time calculations with the TauP method, geodetic functions, and data visualizations. ObsPy has been in constant development for more than seven years and is developed and used by scientists around the world with successful applications in all branches of seismology. Additionally it nowadays serves as the foundation for a large number of more specialized packages. This presentation will give a short overview of the capabilities of ObsPy and point out several representative or new use cases. Additionally we will discuss the road ahead as well as the long-term sustainability of open-source scientific software.

  20. Advective transport observations with MODPATH-OBS--documentation of the MODPATH observation process

    Science.gov (United States)

    Hanson, R.T.; Kauffman, L.K.; Hill, M.C.; Dickinson, J.E.; Mehl, S.W.

    2013-01-01

    The MODPATH-OBS computer program described in this report is designed to calculate simulated equivalents for observations related to advective groundwater transport that can be represented in a quantitative way by using simulated particle-tracking data. The simulated equivalents supported by MODPATH-OBS are (1) distance from a source location at a defined time, or proximity to an observed location; (2) time of travel from an initial location to defined locations, areas, or volumes of the simulated system; (3) concentrations used to simulate groundwater age; and (4) percentages of water derived from contributing source areas. Although particle tracking only simulates the advective component of conservative transport, effects of non-conservative processes such as retardation can be approximated through manipulation of the effective-porosity value used to calculate velocity based on the properties of selected conservative tracers. This program can also account for simple decay or production, but it cannot account for diffusion. Dispersion can be represented through direct simulation of subsurface heterogeneity and the use of many particles. MODPATH-OBS acts as a postprocessor to MODPATH, so that the sequence of model runs generally required is MODFLOW, MODPATH, and MODPATH-OBS. The version of MODFLOW and MODPATH that support the version of MODPATH-OBS presented in this report are MODFLOW-2005 or MODFLOW-LGR, and MODPATH-LGR. MODFLOW-LGR is derived from MODFLOW-2005, MODPATH 5, and MODPATH 6 and supports local grid refinement. MODPATH-LGR is derived from MODPATH 5. It supports the forward and backward tracking of particles through locally refined grids and provides the output needed for MODPATH_OBS. For a single grid and no observations, MODPATH-LGR results are equivalent to MODPATH 5. MODPATH-LGR and MODPATH-OBS simulations can use nearly all of the capabilities of MODFLOW-2005 and MODFLOW-LGR; for example, simulations may be steady-state, transient, or a combination

  1. The OB run-away stars from Sco-Cen and Orion reviewed

    International Nuclear Information System (INIS)

    Blaauw, A.

    1989-01-01

    The author studies the past paths of the run-away star Zeta Oph from the OB association Sco-Cen, and of the run-away stars AE Aur, Mu Col and 53 Ari from the OB association Ori OB1, in connection with the question of the origin of these high velocities. Should the binary-hypothesis be adhered to (supernova explosion of one of the components) or, perhaps, dynamical evolution in young, dense clusters offer a clue to this phenomenon? It is shown that the latter hypothesis is very unlikely to apply to Zeta Oph. For the run-away stars from Orion conclusive evidence may well be obtained in the course of the next decade, from improved accuracy of the proper motions

  2. The Seismic Broad Band Western Mediterranean (wm) Network and the Obs Fomar Pool: Current state and Obs activities.

    Science.gov (United States)

    Pazos, Antonio; Davila, Jose Martin; Buforn, Elisa; Bezzeghoud, Mourad; Harnafi, Mimoun; Mattesini, Mauricio; Caldeira, Bento; Hanka, Winfried; El Moudnib, Lahcen; Strollo, Angelo; Roca, Antoni; Lopez de Mesa, Mireya; Dahm, Torsten; Cabieces, Roberto

    2016-04-01

    The Western Mediterranean (WM) seismic network started in 1996 as an initiative of the Royal Spanish Navy Observatory (ROA) and the Universidad Complutense de Madrid (UCM), with the collaboration of the GeoForschungsZentrum (GFZ) of Potsdam. A first broad band seismic station (SFUC) was installed close to Cádiz (South Spain). Since then, additional stations have been installed in the Ibero-Moghrebian region. In 2005, the "WM" code was assigned by the FDSN and new partners were jointed: Evora University (UEVO, Portugal), the Scientifique Institute of Rabat (ISRABAT, Morocco), and GFZ. Now days, the WM network is composed by 15 BB stations, all of them with Streckaisen STS-2 or STS-2.5 sensors, Quanterra or Earthdata digitizers and SeiscomP. Most them have co-installed a permanent geodetic GPS stations, and some them also have an accelerometer. There are 10 stations deployed in Spanish territory (5 in the Iberian peninsula, 1 in Balearic islands and 4 in North Africa Spanish places) with VSAT or Internet communications, 2 in Portugal (one of them without real time), and 3 in Morocco (2 VSAT and 1 ADSL). Additionally, 2 more stations (one in South Spain and one in Morocco) will be installed along this year. Additionally ROA has deployed a permanent real time VBB (CMG-3T: 360s) station at the Alboran Island. Due to the fact that part of the seismic activity is located at marine areas, and also because of the poor geographic azimuthal coverage at some zones provided by the land stations (specially in the SW of the San Vicente Cape area), ROA and UCM have acquired six broad band "LOBSTERN" OBS, manufactured by KUM (Kiel, Germany), conforming the OBS FOMAR pool. Three of them with CMG-40T sensor and the other with Trillium 120. These OBS were deployed along the Gibraltar strait since January to November 2014 to study the microseismicity in the Gibraltar strait area. In September 2015 FOMAR network has been deployed in SW of the San Vicente Cape for 8 months as a part of

  3. Formation of massive stars in OB associations and giant molecular clouds

    International Nuclear Information System (INIS)

    Lada, C.J.

    1980-01-01

    Certain interesting patterns are being perceived in the morphology of the regions which have recently produced massive OB stars. In particular, current evidence seems to favour the notion that the formation of massive stars takes place at the edges and not the centres of large molecular cloud complexes. It is this aspect of the observations that is discussed in the present paper. The phenomena described here will pertain to massive stars only. Specifically, stars with spectral types earlier than B3 will be considered since it is usually only these stars that produce sufficient havoc (e.g., maser sources, CO bright spots, H II regions) to noticeably affect their early environments. The corresponding phenomena for lower mass stars could be entirely different. A review is first presented of what has been learned about the OB star formation process from studies of the visible OB stars themselves. Then, newly derived information pertaining to the most recent episodes of OB star birth in galactic molecular clouds is discussed. Finally, a short discussion of the significance of the results and their implications for possible star formation mechanisms will be made. (U.K.)

  4. OBS Technologies and permanent seismic Stations at Sea

    Science.gov (United States)

    Makris, J.; Nikolova, S. B.

    2003-04-01

    An off-shore telemetric system was developed during last 2 years. It consists of a buoy unit, OBS with seismic sensor and digitizer at the sea floor and coaxial cable for transferring data from the sea. The buoy unit includes all components for recording and transmitting data to the base station. A solar panel and wind generator are the sources of energy that charge the batteries in the buoy. An Omni directional antenna and a radio modem are used for data transfer. The buoy can be connected also to mobile network or satellite. The Seismic recording unit is SEDIS IV developed in GeoPro GmbH which is a 6 channel data logger equipped with a hard disk of 30 GByte capacity and a flash memory of 0.5 Gbyte which can continuously record at different sampling rate (from 31.25 to 1000sps). The operating system for SEDIS IV is LINUX, with possible data compression, event location and extraction. The data transfer and supply of the power to seismometer and ADC unit in OBS sphere is done through coaxial cable, connecting the buoy unit and OBS. The whole system was tested for a period of one month (October 2002) within frame of Nestor program in Pilos (Greece) and worked successfully.

  5. The Overt Behaviour Scale-Self-Report (OBS-SR) for acquired brain injury: exploratory analysis of reliability and validity.

    Science.gov (United States)

    Kelly, Glenn; Simpson, Grahame K; Brown, Suzanne; Kremer, Peter; Gillett, Lauren

    2017-05-23

    The objectives were to test the properties, via a psychometric study, of the Overt Behaviour Scale-Self-Report (OBS-SR), a version of the OBS-Adult Scale developed to provide a client perspective on challenging behaviours after acquired brain injury. Study sample 1 consisted of 37 patients with primary brain tumour (PBT) and a family-member informant. Sample 2 consisted of 34 clients with other acquired brain injury (mixed brain injury, MBI) and a service-provider informant. Participants completed the OBS-SR (at two time points), and the Awareness Questionnaire (AQ) and Mayo Portland Adaptability Inventory-III (MPAI-III) once; informants completed the OBS-Adult and AQ once only. PBT-informant dyads displayed "good" levels of agreement (ICC 2,k  = .74; OBS-SR global index). Although MBI-informant dyads displayed no agreement (ICC 2,k  = .22; OBS-SR global index), the sub-group (17/29) rated by clinicians as having moderate to good levels of awareness displayed "fair" agreement (ICC 2,k  = .58; OBS-SR global index). Convergent/divergent validity was demonstrated by significant correlations between OBS-SR subscales and MPAI-III subscales with behavioural content (coefficients in the range .36 -.61). Scores had good reliability across one week (ICC 2,k  = .69). The OBS-SR took approximately 15 minutes to complete. It was concluded that the OBS-SR demonstrated acceptable reliability and validity, providing a useful resource in understanding clients' perspectives about their behaviour.

  6. Search for OB stars running away from young star clusters. I. NGC 6611

    Science.gov (United States)

    Gvaramadze, V. V.; Bomans, D. J.

    2008-11-01

    N-body simulations have shown that the dynamical decay of the young (~1 Myr) Orion Nebula cluster could be responsible for the loss of at least half of its initial content of OB stars. This result suggests that other young stellar systems could also lose a significant fraction of their massive stars at the very beginning of their evolution. To confirm this expectation, we used the Mid-Infrared Galactic Plane Survey (completed by the Midcourse Space Experiment satellite) to search for bow shocks around a number of young (⪉several Myr) clusters and OB associations. We discovered dozens of bow shocks generated by OB stars running away from these stellar systems, supporting the idea of significant dynamical loss of OB stars. In this paper, we report the discovery of three bow shocks produced by O-type stars ejected from the open cluster NGC 6611 (M16). One of the bow shocks is associated with the O9.5Iab star HD165319, which was suggested to be one of “the best examples for isolated Galactic high-mass star formation” (de Wit et al. 2005, A&A, 437, 247). Possible implications of our results for the origin of field OB stars are discussed.

  7. ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION

    International Nuclear Information System (INIS)

    Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather; Bagley Kiminki, Megan M.; Henderson, C. B.

    2012-01-01

    We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.

  8. ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION

    Energy Technology Data Exchange (ETDEWEB)

    Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82070 (United States); Bagley Kiminki, Megan M. [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Henderson, C. B. [Department of Astronomy, Ohio State University, Columbus, OH 43210 (United States)

    2012-03-01

    We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.

  9. The performance study of oxide by-passed(OB) lateral double diffused MOSFET

    Science.gov (United States)

    Tang, Pan-pan

    2016-10-01

    An SOI LDMOS device structure with Oxide By-passed(OB) was investigated and its breakdown mechanism and characteristic of structure was analyzed. Its performance was verified by 3D numerical simulation with SILVACO TCAD software. The simulated results show that the electrical field element of the device is modulated by the concept of similar Superjunction(SJ) structure. Compared with the SJ LDMOS device, OB LDMOS obtains the same breakdown voltage, simultaneously the specific on-resistance of the OB LDMOS reduces from 3.81mΩ·cm2 to 1.96mΩ·cm2, except for achieving comparable performance and overcoming the high aspect ratio of fabrication structure and the difficulty of accurate concentration match of SJ LDMOS.

  10. Production of metal and metal-ceramic coatings on D-Gun Ob

    International Nuclear Information System (INIS)

    Gavrilenko, T.P.; Nikolaev, Y.A.; Ulianitsky, V.Y.

    1995-01-01

    Optimization of the detonation spraying process has been made for the production of metal and metal-ceramics coatings with the D-Gun Ob. Owing to the ability of Ob to work with several fuels and an inert diluent simultaneously, variation of detonation regimes in a wide range is possible, and because of localized powder injection in the D-Gun barrel, high uniformity of parameters of powder particles is achieved. The best conditions for particle heating and acceleration were calculated with the help of mathematical simulation, and the corresponding regimes were realized on D-Gun Ob. High-quality aluminum, copper, nickel, and nickel-chromium-silicon-carbon-boron alloy coatings were produced by using only propane fuel. Chromium carbide with nickel and tungsten carbide with cobalt coatings were produced with addition of acetylene. Optimal efficiency and high bonding strength were achieved for all powders. Data on microhardness, bonding strength, and efficiency are presented

  11. ObsPy: A Python Toolbox for Seismology - Recent Developments and Applications

    Science.gov (United States)

    Megies, T.; Krischer, L.; Barsch, R.; Sales de Andrade, E.; Beyreuther, M.

    2014-12-01

    ObsPy (http://www.obspy.org) is a community-driven, open-source project dedicated to building a bridge for seismology into the scientific Python ecosystem. It offersa) read and write support for essentially all commonly used waveform, station, and event metadata file formats with a unified interface,b) a comprehensive signal processing toolbox tuned to the needs of seismologists,c) integrated access to all large data centers, web services and databases, andd) convenient wrappers to legacy codes like libtau and evalresp.Python, currently the most popular language for teaching introductory computer science courses at top-ranked U.S. departments, is a full-blown programming language with the flexibility of an interactive scripting language. Its extensive standard library and large variety of freely available high quality scientific modules cover most needs in developing scientific processing workflows. Together with packages like NumPy, SciPy, Matplotlib, IPython, Pandas, lxml, and PyQt, ObsPy enables the construction of complete workflows in Python. These vary from reading locally stored data or requesting data from one or more different data centers through to signal analysis and data processing and on to visualizations in GUI and web applications, output of modified/derived data and the creation of publication-quality figures.ObsPy enjoys a large world-wide rate of adoption in the community. Applications successfully using it include time-dependent and rotational seismology, big data processing, event relocations, and synthetic studies about attenuation kernels and full-waveform inversions to name a few examples. All functionality is extensively documented and the ObsPy tutorial and gallery give a good impression of the wide range of possible use cases.We will present the basic features of ObsPy, new developments and applications, and a roadmap for the near future and discuss the sustainability of our open-source development model.

  12. High rate of vaginal erosions associated with the mentor ObTape.

    Science.gov (United States)

    Yamada, Brian S; Govier, Fred E; Stefanovic, Ksenija B; Kobashi, Kathleen C

    2006-08-01

    The transobturator tape method is a newer surgical technique for the treatment of stress urinary incontinence. Limited data exist related to complications with this approach or the types of mesh products used. We report our experience with vaginal erosions associated with the Mentor ObTape and American Medical Systems Monarc transobturator slings. Beginning in December 2003 selected female patients with anatomic urinary incontinence were prospectively followed after placement of the Mentor ObTape. Beginning in January 2004 we also began using the American Medical Systems Monarc in similar patients. Patients were admitted overnight after surgery, discharged on oral antibiotics, and seen in the clinic at 6 weeks postoperatively. A total of 67 patients have undergone placement of the Mentor ObTape and 9 of those patients (13.4%) have had vaginal extrusions of the sling. Eight patients reported a history of persistent vaginal discharge. One patient presented initially to an outside facility with a left thigh abscess tracking to the left inguinal incision site. Each patient was taken back to the operating room for mesh removal. A total of 56 patients have undergone placement of the AMS Monarc and none have had any vaginal erosions. Our high rate of vaginal extrusion using the ObTape has led us to discontinue the use of this product in our institution. Continued followup of all of these patients will be of critical importance.

  13. Star formation in the Monoceros OB1 dark cloud

    International Nuclear Information System (INIS)

    Margulis, M.S.

    1987-01-01

    A survey of the Monoceros OB1 dark cloud was made for molecular outflows and young stellar objects. In all, nine molecular outflows and thirty far-infrared sources were identified in a portion of the cloud composed of about 3 x 10 4 M of material. Statistical arguments suggest that 90% of the far-infrared sources actually are young stellar objects embedded in the cloud. If the star formation rate in the Mon OB1 cloud is roughly constant with time, then molecular outflows in the cloud should be able to support it against collapse due to gravity. This suggests that the birthrate of outflows in the solar neighborhood is very high. In fact, regardless of considerations of cloud support, the large number of outflows identified in the Mon OB1 cloud and the propensity of the youngest stellar objects in the cloud to be associated with outflows suggest that outflows have a high birthrate in the solar neighborhood and are part of a common stage in early stellar evolution. The young stellar objects identified in the cloud can be fit into a spectral classification system. Also, the outflow phase in early stellar evolution tends to occur at about the time that young stellar objects lose a large fraction of their circumstellar envelopes

  14. IPV Screening and Readiness to Respond to IPV in Ob-Gyn Settings: A Patient-Physician Study

    Directory of Open Access Journals (Sweden)

    Katherine M. Jones

    2018-01-01

    Full Text Available Purpose. Intimate partner violence (IPV is a serious, preventable public health concern that largely affects women of reproductive age. Obstetrician-gynecologists (ob-gyns have a unique opportunity to identify and support women experiencing IPV to improve women’s health. Considering recent efforts to increase IPV awareness and intervention, the present study aimed to provide a current evaluation of nationally representative samples to assess ob-gyn readiness to respond to IPV as well as patient IPV-related experiences. Methods. 400 ob-gyns were randomly selected from American College of Obstetricians and Gynecologists’ (ACOG Collaborative Ambulatory Research Network. Each physician was mailed one physician survey and 25 patient surveys. Results. IPV training/education and IPV screening practices were associated with most measures of ob-gyn readiness to respond to IPV. Among respondents, 36.8% endorsed screening all patients at annual exams; however, 36.8% felt they did not have sufficient training to assist individuals in addressing IPV. Workplace encouragement of IPV response was associated with training, screening, detection, preparation/knowledge, response practices, and resources. Thirty-one percent of patients indicated their ob-gyn had asked about possible IPV experiences during their medical visit. Conclusion. Findings highlight specific gaps in ob-gyns’ IPV knowledge and response practices to be further addressed by IPV training.

  15. Radionuclides in the Ob/Irtysh river system and their contribution to pollution of the Arctic

    International Nuclear Information System (INIS)

    Trapeznikov, A.; Pozolotina, V.; Trapeznikova, V.; Yushkov, P.; Polikarpov, G.; Aarkrog, A.; Nielsen, S.P.

    1995-01-01

    The aims of this study were: 1) to continue the investigation of distribution of radionuclides in the principal components of the Techa river, and 2) to get the first estimate of the contamination of sediments of the Iset, Tobol, Irtysh and Ob rivers. The samples from the Irtysh river were collected in 1993 nine km in front of confluence of the Irtysh with the Ob river. The mean Cs-137 concentration in the sediments did not show any clear trend. The sediments from the Ob river were collected in 1992 near Labitnangi, situated about 300 km from the outlet of the Ob into the Kara Sea. In 1994 samples were collected five km in front of and five km after confluence with the Irtysh river. All results are summarized in a table. It appears that the Cs-137 levels in the Ob sediments, before and after confluence with Irtysh, do not change significantly. It is difficult to see any systematic changes in Cs-137 concentrations with depth. In some cases the top five cm show higher concentrations than the deeper layers. 7 refs., 1 tab

  16. ObsPy - A Python Toolbox for Seismology - and Applications

    Science.gov (United States)

    Krischer, L.; Megies, T.; Barsch, R.; MacCarthy, J.; Lecocq, T.; Koymans, M. R.; Carothers, L.; Eulenfeld, T.; Reyes, C. G.; Falco, N.; Sales de Andrade, E.

    2017-12-01

    Recent years witnessed the evolution of Python's ecosystem into one of the most powerful and productive scientific environments across disciplines. ObsPy (https://www.obspy.org) is a fully community driven, open-source project dedicated to provide a bridge for seismology into that ecosystem. It is a Python toolbox offering: Read and write support for essentially every commonly used data format in seismology with a unified interface and automatic format detection. This includes waveform data (MiniSEED, SAC, SEG-Y, Reftek, …) as well as station (SEED, StationXML, SC3ML, …) and event meta information (QuakeML, ZMAP, …). Integrated access to the largest data centers, web services, and real-time data streams (FDSNWS, ArcLink, SeedLink, ...). A powerful signal processing toolbox tuned to the specific needs of seismologists. Utility functionality like travel time calculations with the TauP method, geodetic functions, and data visualizations. ObsPy has been in constant development for more than eight years and is developed and used by scientists around the world with successful applications in all branches of seismology. Additionally it nowadays serves as the foundation for a large number of more specialized packages. Newest features include: Full interoperability of SEED and StationXML/Inventory objects Access to the Nominal Response Library (NRL) for easy and quick creation of station metadata from scratch Support for the IRIS Federated Catalog Service Improved performance of the EarthWorm client Several improvements to MiniSEED read/write module Improved plotting capabilities for PPSD (spectrograms, PSD of discrete frequencies over time, ..) Support for.. Reading ArcLink Inventory XML Reading Reftek data format Writing SeisComp3 ML (SC3ML) Writing StationTXT format This presentation will give a short overview of the capabilities of ObsPy and point out several representative or new use cases and show-case some projects that are based on ObsPy, e.g.: seismo

  17. Photoionization of the diffuse interstellar medium and galactic halo by OB associtations

    Science.gov (United States)

    Dove, James B.; Shull, J. Michael

    1994-01-01

    Assuming smoothly varying H I distributions in te Galactic disk, we have calculated the geometry of diffuse II regions due to OB associations in the Galactic plane. Near the solar circle, OB associations with a Lyman continuum (Lyc) photon luminosity Psi(sub Lyc) = 3.3 x 10(exp 7) cm(exp -2) s(exp -1), produce H II regions that are density bounded in the vertical direction (H II chimneys) allowing Lyc to escape the gaseous disk and penetrate into the Galactic halo. We provide analytic formulae for the Lyc escape fraction as functions of S(sub 0) O-star catalog of Garmany and a new Lyc stellar stellar Lyc stellar flux calibration, we find a production rate of Lyc photons by OB associations within 2.5 kpc of Psi(sub Lyc) = 3.3 x 10(exp 7) cm(exp -2) s(exp -1). Integrating the fraction of Lyc photons that escape the disk over our adopted luminosity function of OB associations, we estimate that approximately 7% of the ionizing photons, or Phi(sub Lyc) = 2.3 x 10(exp 6) cm(exp -2) s(exp -1), escape each side of the H I disk layer and penetrate the diffuse ionized medium ('Reynolds layer'). This flux is sufficient to explain the potoionization of this, although we have not constructed a model for the observed H-alpha emission and pulsar dispersion measures that is fully consistent with the absorption rate of Lyc in the H II layer. Since our quiescent model does not account for the effects of dynamic chimneys and superbubbles, which should enhance Lyc escape, we conclude the O stars are the probable source of ionizing radiation for the Reynolds layer. For a random distribution of OB associations throughout the disk, the Lyc flux is nearly uniform for heights Z is greater than approximately 0.8 kpc above the midplane.

  18. ObsPy: A Python toolbox for seismology - Sustainability, New Features, and Applications

    Science.gov (United States)

    Krischer, L.; Megies, T.; Sales de Andrade, E.; Barsch, R.; MacCarthy, J.

    2016-12-01

    ObsPy (https://www.obspy.org) is a community-driven, open-source project dedicated to offer a bridge for seismology into the scientific Python ecosystem. Amongst other things, it provides Read and write support for essentially every commonly used data format in seismology with a unified interface. This includes waveform data as well as station and event meta information. A signal processing toolbox tuned to the specific needs of seismologists. Integrated access to the largest data centers, web services, and databases. Wrappers around third party codes like libmseed and evalresp. Using ObsPy enables users to take advantage of the vast scientific ecosystem that has developed around Python. In contrast to many other programming languages and tools, Python is simple enough to enable an exploratory and interactive coding style desired by many scientists. At the same time it is a full-fledged programming language usable by software engineers to build complex and large programs. This combination makes it very suitable for use in seismology where research code often must be translated to stable and production ready environments, especially in the age of big data. ObsPy has seen constant development for more than six years and enjoys a large rate of adoption in the seismological community with thousands of users. Successful applications include time-dependent and rotational seismology, big data processing, event relocations, and synthetic studies about attenuation kernels and full-waveform inversions to name a few examples. Additionally it sparked the development of several more specialized packages slowly building a modern seismological ecosystem around it. We will present a short overview of the capabilities of ObsPy and point out several representative use cases and more specialized software built around ObsPy. Additionally we will discuss new and upcoming features, as well as the sustainability of open-source scientific software.

  19. Determining OBS Instrument Orientations: A Comparison of Algorithms

    Science.gov (United States)

    Doran, A. K.; Laske, G.

    2015-12-01

    The alignment of the orientation of the horizontal seismometer components with the geographical coordinate system is critical for a wide variety of seismic analyses, but the traditional deployment method of ocean bottom seismometers (OBS) precludes knowledge of this parameter. Current techniques for determining the orientation predominantly rely on body and surface wave data recorded from teleseismic events with sufficiently large magnitudes. Both wave types experience lateral refraction between the source and receiver as a result of heterogeneity and anisotropy, and therefore the arrival angle of any one phase can significantly deviate from the great circle minor arc. We systematically compare the results and uncertainties obtained through current determination methods, as well as describe a new algorithm that uses body wave, surface wave, and differential pressure gauge data (where available) to invert for horizontal orientation. To start with, our method is based on the easily transportable computer code of Stachnik et al. (2012) that is publicly available through IRIS. A major addition is that we utilize updated global dispersion maps to account for lateral refraction, as was done by Laske (1995). We also make measurements in a wide range of frequencies, and analyze surface wave trains of repeat orbits. Our method has the advantage of requiring fewer total events to achieve high precision estimates, which is beneficial for OBS deployments that can be as short as weeks. Although the program is designed for the purpose of use with OBS instruments, it also works with standard land installations. We intend to provide the community with a program that is easy to use, requires minimal user input, and is optimized to work with data cataloged at the IRIS DMC.

  20. OBS Data Denoising Based on Compressed Sensing Using Fast Discrete Curvelet Transform

    Science.gov (United States)

    Nan, F.; Xu, Y.

    2017-12-01

    OBS (Ocean Bottom Seismometer) data denoising is an important step of OBS data processing and inversion. It is necessary to get clearer seismic phases for further velocity structure analysis. Traditional methods for OBS data denoising include band-pass filter, Wiener filter and deconvolution etc. (Liu, 2015). Most of these filtering methods are based on Fourier Transform (FT). Recently, the multi-scale transform methods such as wavelet transform (WT) and Curvelet transform (CvT) are widely used for data denoising in various applications. The FT, WT and CvT could represent signal sparsely and separate noise in transform domain. They could be used in different cases. Compared with Curvelet transform, the FT has Gibbs phenomenon and it cannot handle points discontinuities well. WT is well localized and multi scale, but it has poor orientation selectivity and could not handle curves discontinuities well. CvT is a multiscale directional transform that could represent curves with only a small number of coefficients. It provide an optimal sparse representation of objects with singularities along smooth curves, which is suitable for seismic data processing. As we know, different seismic phases in OBS data are showed as discontinuous curves in time domain. Hence, we promote to analysis the OBS data via CvT and separate the noise in CvT domain. In this paper, our sparsity-promoting inversion approach is restrained by L1 condition and we solve this L1 problem by using modified iteration thresholding. Results show that the proposed method could suppress the noise well and give sparse results in Curvelet domain. Figure 1 compares the Curvelet denoising method with Wavelet method on the same iterations and threshold through synthetic example. a)Original data. b) Add-noise data. c) Denoised data using CvT. d) Denoised data using WT. The CvT can well eliminate the noise and has better result than WT. Further we applied the CvT denoise method for the OBS data processing. Figure 2a

  1. Decreased triiodothyronine receptor binding in skeletal muscle nuclei and erythrocyte membranes of obese (ob/ob) mice

    International Nuclear Information System (INIS)

    Gilvary, E.P.

    1988-01-01

    Hindlimb skeletal muscle weights and binding of L-tri-iodothyronine (T 3 ) to isolated nuclei of this tissue were investigated in obese (ob/ob) mice and their lean littermates. Maximal binding capacities (Bmax) and dissociation constants (Kd) were determined by incubating isolated muscle nuclei with increasing conc. of 125 I-T 3 (0.4 nM to 4nM). At 12 wks. of age, although weighing substantially more, obese mice had only 55% as much muscle mass as their lean littermates. There was no phenotype effect observed for Kd, however, Bmax was significantly less for the obese mice. In a second experiment, a 16-wk. feeding study was conducted with 4 groups of mice according to the following design: lean mice fed rodent chow; obese mice fed rodent chow; obese mice, n-6 fatty acid (FA)-rich diet; and obese mice, n-3FA-rich diet. Erythrocyte T 3 receptor binding capacities were measured by incubating red cell ghosts from mice of these 4 groups with 125 I-T 3 . As with skeletal muscle nuclei there were no phenotype effects observed for Kd between any two groups. In contrasts obese mice fed chow and n-6FA-rich diets both exhibited lower Bmax than their lean counterparts, while no significant difference was observed between the latter group and the obese mice fed an n-3FA-rich diet. Bmax values of the n-6 group were also decreased compared to the n-3 group

  2. Association of plutonium with sediments from the Ob and Yenisey Rivers and Estuaries

    International Nuclear Information System (INIS)

    Skipperud, Lindis; Brown, Justin; Fifield, L. Keith; Oughton, Deborah H.; Salbu, Brit

    2009-01-01

    The present study applied sequential extraction techniques to investigate the binding and mobility of plutonium (Pu) in sediments from the rivers and estuaries of the Ob and Yenisey. As a study site, the Ob and Yenisey are particularly interesting as both rivers have weapons-grade Pu sources in their catchment areas, including the Russian Pu production and reprocessing plants at Mayak, Tomsk-7 and Krashnoyarsk, and the Semipalantinsk nuclear weapons testing site in Kazakhstan. Plutonium activity and 240 Pu/ 239 Pu ratios were determined using accelerator mass spectrometry (AMS). Sequential extractions showed that between 47 and 80% of the Pu in Yenisey River sediments and 35-53% of the Pu in soils around the Techa River are mobilized with weak oxidising agents, which can indicate that Pu is bound to organic material. In contrast, Pu in Ob and Yenisey Estuarine sediments was more strongly bound, with 60-100% being found in the HNO 3 -extractable fraction. This change in speciation could reflect either that Pu bound to organic material in the Techa and Yenisey River sediments becomes more fixed to the sediments with time, or that organic-bound Pu is mobilized and released to the water when the sediments encounter the more saline water of the Ob and Yenisey estuaries. In general, 240 Pu/ 239 Pu ratios were relatively consistent between different extraction fractions, although, in whole sediments, an increase in ratio was observed with distance from the source. This reflects the increased influence of weapon fallout from catchment runoff within the river systems, as compared to the weapons-grade sources close to the production and reprocessing plants. Knowledge of Pu speciation in the Ob and Yenisey Rivers, and the processes controlling its behaviour in estuarine systems, can improve predictions of its transfer and subsequent environmental impact to Arctic Seas

  3. A Novel Congestion Detection Scheme in TCP Over OBS Networks

    KAUST Repository

    Shihada, Basem; Ho, Pin-Han; Zhang, Qiong

    2009-01-01

    This paper introduces a novel congestion detection scheme for high-bandwidth TCP flows over optical burst switching (OBS) networks, called statistical additive increase multiplicative decrease (SAIMD). SAIMD maintains and analyzes a number

  4. ESTIMATION OF BURSTS LENGTH AND DESIGN OF A FIBER DELAY LINE BASED OBS ROUTER

    Directory of Open Access Journals (Sweden)

    RICHA AWASTHI

    2017-03-01

    Full Text Available The demand for higher bandwidth is increasing day by day and this ever growing demand cannot be catered to with current electronic technology. Thus new communication technology like optical communication needs to be used. In the similar context OBS (optical burst switching is considered as next generation data transfer technology. In OBS information is transmitted in forms of optical bursts of variable lengths. However, contention among the bursts is a major problem in OBS system, and for contention resolution defection routing is mostly preferred. However, deflection routing increases delay. In this paper, it is shown that the arrival of very large bursts is rare event, and for moderate burst length the buffering of contending burst can provide very effective solution. However, in case of arrival of large bursts deflection can be used.

  5. ObsPy – What can it do for data centers and observatories?

    Directory of Open Access Journals (Sweden)

    Joachim Wassermann

    2011-04-01

    Full Text Available Data acquisition by seismic centers relies on real-time systems, like SeisComP3, Antelope and Earthworm. However, these are complex systems that are designed for fast and precisely defined standard real-time analyses. Therefore, it is not a simple task to access or modify internal routines, and to integrate them into custom-processing workflows or to perform in-depth data analyses. Often a library is necessary that provides convenient access to data and allows easy control over all of the operations that are to be performed on the data. ObsPy is such a library, which is designed to access and process seismological waveform data and metadata. We use short and simple examples here to demonstrate how effective it is to use Python for seismological data analysis. Then, we illustrate the general capabilities of ObsPy, and highlight some of its specific aspects that are relevant for seismological data centers and observatories, through presentation of real-world examples. Finally, we demonstrate how the ObsPy library can be used to develop custom graphical user interface applications.

  6. Structure-function analysis of the OB and latch domains of chlorella virus DNA ligase.

    Science.gov (United States)

    Samai, Poulami; Shuman, Stewart

    2011-06-24

    Chlorella virus DNA ligase (ChVLig) is a minimized eukaryal ATP-dependent DNA sealing enzyme with an intrinsic nick-sensing function. ChVLig consists of three structural domains, nucleotidyltransferase (NTase), OB-fold, and latch, that envelop the nicked DNA as a C-shaped protein clamp. The OB domain engages the DNA minor groove on the face of the duplex behind the nick, and it makes contacts to amino acids in the NTase domain surrounding the ligase active site. The latch module occupies the DNA major groove flanking the nick. Residues at the tip of the latch contact the NTase domain to close the ligase clamp. Here we performed a structure-guided mutational analysis of the OB and latch domains. Alanine scanning defined seven individual amino acids as essential in vivo (Lys-274, Arg-285, Phe-286, and Val-288 in the OB domain; Asn-214, Phe-215, and Tyr-217 in the latch), after which structure-activity relations were clarified by conservative substitutions. Biochemical tests of the composite nick sealing reaction and of each of the three chemical steps of the ligation pathway highlighted the importance of Arg-285 and Phe-286 in the catalysis of the DNA adenylylation and phosphodiester synthesis reactions. Phe-286 interacts with the nick 5'-phosphate nucleotide and the 3'-OH base pair and distorts the DNA helical conformation at the nick. Arg-285 is a key component of the OB-NTase interface, where it forms a salt bridge to the essential Asp-29 side chain, which is imputed to coordinate divalent metal catalysts during the nick sealing steps.

  7. Structure-Function Analysis of the OB and Latch Domains of Chlorella Virus DNA Ligase*

    Science.gov (United States)

    Samai, Poulami; Shuman, Stewart

    2011-01-01

    Chlorella virus DNA ligase (ChVLig) is a minimized eukaryal ATP-dependent DNA sealing enzyme with an intrinsic nick-sensing function. ChVLig consists of three structural domains, nucleotidyltransferase (NTase), OB-fold, and latch, that envelop the nicked DNA as a C-shaped protein clamp. The OB domain engages the DNA minor groove on the face of the duplex behind the nick, and it makes contacts to amino acids in the NTase domain surrounding the ligase active site. The latch module occupies the DNA major groove flanking the nick. Residues at the tip of the latch contact the NTase domain to close the ligase clamp. Here we performed a structure-guided mutational analysis of the OB and latch domains. Alanine scanning defined seven individual amino acids as essential in vivo (Lys-274, Arg-285, Phe-286, and Val-288 in the OB domain; Asn-214, Phe-215, and Tyr-217 in the latch), after which structure-activity relations were clarified by conservative substitutions. Biochemical tests of the composite nick sealing reaction and of each of the three chemical steps of the ligation pathway highlighted the importance of Arg-285 and Phe-286 in the catalysis of the DNA adenylylation and phosphodiester synthesis reactions. Phe-286 interacts with the nick 5′-phosphate nucleotide and the 3′-OH base pair and distorts the DNA helical conformation at the nick. Arg-285 is a key component of the OB-NTase interface, where it forms a salt bridge to the essential Asp-29 side chain, which is imputed to coordinate divalent metal catalysts during the nick sealing steps. PMID:21527793

  8. Transcriptional activation of the mouse obese (ob) gene by CCAAT/enhancer binding protein alpha

    DEFF Research Database (Denmark)

    Hwang, C S; Mandrup, S; MacDougald, O A

    1996-01-01

    Like other adipocyte genes that are transcriptionally activated by CCAAT/enhancer binding protein alpha (C/EBP alpha) during preadipocyte differentiation, expression of the mouse obese (ob) gene is immediately preceded by the expression of C/EBP alpha. While the 5' flanking region of the mouse ob...... gene contains several consensus C/EBP binding sites, only one of these sites appears to be functional. DNase I cleavage inhibition patterns (footprinting) of the ob gene promoter revealed that recombinant C/EBP alpha, as well as a nuclear factor present in fully differentiated 3T3-L1 adipocytes...... to a consensus C/EBP binding site at nucleotides -55 to -47 generated a specific protein-oligonucleotide complex that was supershifted by antibody against C/EBP alpha. Probes corresponding to two upstream consensus C/EBP binding sites failed to generate protein-oligonucleotide complexes. Cotransfection of a C...

  9. Inter-Division IV/V WG on Active OB Stars

    NARCIS (Netherlands)

    Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.

    2007-01-01

    Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to

  10. Expression of Leptin (Ob Gene Product) in Reproductive System ...

    African Journals Online (AJOL)

    Purpose: To determine serum leptin and its ob mRNA expression both in the PCOS and non-PCOS ovary, endometrium and adipose tissue in normal or polycystic ovary syndrome (PCOS) in South Indian population. PCOS (Polycystic Ovary Syndrome) and non-PCOS subject's endometrium, ovary and adipose tissue were ...

  11. Radio observations of the CMa OB1 H II regions

    International Nuclear Information System (INIS)

    Gaylard, M.J.; Kemball, A.J.

    1984-01-01

    A sensitive 10 0 x 15 0 13-cm map made of the CMa OB1 H II regions' radio emission shows a strong similarity to Hα emission photographs. Sharpless 296 is shown to consist of a prominent central and western arc completed by a weaker southern loop, and with a faint northern bar. The emission is thermal, superimposed over a predominantly non-thermal background. The H142α recombination line has been detected at eight positions in S296, and in S292 and S297. The average electron temperature in S296 is 6900 +- 1300 K. The UV fluxes from the CMa OB1 stars account for the observed emission measures of the H II regions. The H142α 1sr velocities indicate that the ionized material is in contact with the molecular clouds. (author)

  12. Magnetic field of massive chemically peculiar stars in the Orion OB1 association

    Science.gov (United States)

    Romanyuk, I. I.; Semenko, E. A.; Kudryavtsev, D. O.; Yakunin, I. A.

    2018-01-01

    Spectropolarimetric observations of 55 chemically peculiar stars in the Orion OB1 association were obtained at the 6 m telescope of the Russian Academy of Sciences with the aim of searching for the presence of stellar magnetic fields. We found 8 new magnetic stars in addition to 20 previously known objects. The frequency of chemically peculiar A and B-type stars among normal A and B-type stars and the frequency of magnetic stars among all chemically peculiar stars decreases with age in the Orion OB1 association.

  13. A model for the infrared emission from an OB star cluster environment

    International Nuclear Information System (INIS)

    Leisawitz, D.

    1990-01-01

    Researchers developed an interactive radiative transfer code that predicts the infrared emission from an HII region containing diffuse ionized and atomic gas and dense molecular clouds. This model complements the investigation of the redistribution of OB star luminosity in the interstellar medium (Leisawitz and Hauser 1988, Ap. J., 332, 954). The model can be used as a diagnostic tool to probe the radiation field and matter density in an HII region, place constraints on the proximity and orientation of an illuminated molecular cloud with respect to the ionizing stars, test for the presence of small, transiently heated dust grains, and determine whether the dust-to-gas ratio is normal. Predictions of the model agree qualitatively and quantitatively with observations of blister-type HII regions ionized by well-studied OB clusters in which the distribution of dense neutral material is known. This is illustrated by a model for Infrared Astronomy Satellite (IRAS) observations of the region around NGC 7380 (S142). Researchers plan to use the model in a survey of regions of massive star formation in the outer Galaxy to study OB stars embedded to various degrees in their parental molecular clouds

  14. Adipose cell differentiation: evidence for a two-step process in the polyamine-dependent Ob1754 clonal line.

    Science.gov (United States)

    Amri, E Z; Dani, C; Doglio, A; Etienne, J; Grimaldi, P; Ailhaud, G

    1986-01-01

    A subclone of preadipocyte Ob17 cells has been isolated (Ob1754 clonal line). Confluent Ob1754 cells treated with an inhibitor of spermidine and spermine synthesis, methylglyoxal bis(guanylhydrazone), were totally dependent upon putrescine addition for the expression of glycerol-3-phosphate dehydrogenase which behaved as a late marker of adipose conversion. Under these conditions, the early expression of lipoprotein lipase during growth arrest remained unchanged. Studies at the mRNA level showed that the expression of unidentified pOb24 and pGH3 mRNAs, which was parallel to that of lipoprotein lipase, is independent of polyamine addition whereas the late emergence of glycerol-3-phosphate dehydrogenase mRNA was putrescine-dependent and co-ordinated with the expression of pAL422 mRNA encoding for a myelin-P2 homologue [Bernlohr, Angus, Lane, Bolanowski & Kelly (1984) Proc. Natl. Acad. Sci. U.S.A. 81, 5468-5472]. The appearance of lipoprotein lipase preceded DNA synthesis and post-confluent mitoses which were both putrescine-dependent and which took place before the appearance of glycerol-3-phosphate dehydrogenase. Thus the adipose conversion of Ob1754 cells involves the expression of at least two separate sets of markers which are differently regulated. Images Fig. 3. Fig. 6. PMID:3800927

  15. Increasing the number and signal-to-noise ratio of OBS traces with supervirtual refraction interferometry and free-surface multiples

    KAUST Repository

    Bharadwaj, P.; Wang, X.; Schuster, Gerard T.; McIntosh, K.

    2013-01-01

    The theory of supervirtual interferometry is modified so that free-surface related multiple refractions can be used to enhance the signal-to-noise ratio (SNR) of primary refraction events by a factor proportional to√Ns, where Ns is the number of post-critical sources for a specified refraction multiple. We also show that refraction multiples can be transformed into primary refraction events recorded at virtual hydrophones located between the actual hydrophones. Thus, data recorded by a coarse sampling of ocean bottom seismic (OBS) stations can be transformed, in principle, into a virtual survey with P times more OBS stations, where P is the order of the visible free-surface related multiple refractions. The key assumption is that the refraction arrivals are those of head waves, not pure diving waves. The effectiveness of this method is validated with both synthetic OBS data and an OBS data set recorded offshore from Taiwan. Results show the successful reconstruction of far-offset traces out to a source-receiver offset of 120 km. The primary supervirtual traces increase the number of pickable first arrivals from approximately 1600 to more than 3100 for a subset of the OBS data set where the source is only on one side of the recording stations. In addition, the head waves associated with the first-order free-surface refraction multiples allow for the creation of six new common receiver gathers recorded at virtual OBS station located about half way between the actual OBS stations. This doubles the number of OBS stations compared to the original survey and increases the total number of pickable traces from approximately 1600 to more than 6200. In summary, our results with the OBS data demonstrate that refraction interferometry can sometimes more than quadruple the number of usable traces, increase the source-receiver offsets, fill in the receiver line with a denser distribution of OBS stations, and provide more reliable picking of first arrivals. Apotential liability

  16. Increasing the number and signal-to-noise ratio of OBS traces with supervirtual refraction interferometry and free-surface multiples

    KAUST Repository

    Bharadwaj, P.

    2013-01-10

    The theory of supervirtual interferometry is modified so that free-surface related multiple refractions can be used to enhance the signal-to-noise ratio (SNR) of primary refraction events by a factor proportional to√Ns, where Ns is the number of post-critical sources for a specified refraction multiple. We also show that refraction multiples can be transformed into primary refraction events recorded at virtual hydrophones located between the actual hydrophones. Thus, data recorded by a coarse sampling of ocean bottom seismic (OBS) stations can be transformed, in principle, into a virtual survey with P times more OBS stations, where P is the order of the visible free-surface related multiple refractions. The key assumption is that the refraction arrivals are those of head waves, not pure diving waves. The effectiveness of this method is validated with both synthetic OBS data and an OBS data set recorded offshore from Taiwan. Results show the successful reconstruction of far-offset traces out to a source-receiver offset of 120 km. The primary supervirtual traces increase the number of pickable first arrivals from approximately 1600 to more than 3100 for a subset of the OBS data set where the source is only on one side of the recording stations. In addition, the head waves associated with the first-order free-surface refraction multiples allow for the creation of six new common receiver gathers recorded at virtual OBS station located about half way between the actual OBS stations. This doubles the number of OBS stations compared to the original survey and increases the total number of pickable traces from approximately 1600 to more than 6200. In summary, our results with the OBS data demonstrate that refraction interferometry can sometimes more than quadruple the number of usable traces, increase the source-receiver offsets, fill in the receiver line with a denser distribution of OBS stations, and provide more reliable picking of first arrivals. Apotential liability

  17. Attenuation of S-waves in the lithosphere of the Sea of Crete according to OBS observations

    Science.gov (United States)

    Kovachev, S. A.; Kuzin, I. P.; Shoda, O. Yu.; Soloviev, S. L.

    1991-11-01

    Five OBS were installed in the Sea of Crete in 1987. During a period of nine days 430 local earthquakes were recorded. Hypocentres were determined for 85 microearthquakes. A correlation between magnitude ML and duration of seismic events on the records of the ocean bottom seismographs (OBS) was found from data of 14 shocks recorded simultaneously by OBS and some land-based Greek stations. A magnitude-frequency relationship for earthquakes recorded by OBS was obtained in the magnitude range ML = 2-4. Amplitude curves describing the attenuation of body waves in the lithosphere of the Sea of Crete were compiled. Assessment of quality factor Qs was made by comparison of empirical and theoretical amplitude curves. The values of Qs for the lithosphere of the Sea of Crete were calculated and found equal to 200-300. Low values of Qs and consequently strong attenuation of S-waves in the lithosphere of the Sea of Crete could be explained by extension of the lithosphere accompanied by its partial contamination with melted magma.

  18. Diacylglycerol production induced by growth hormone in Ob1771 preadipocytes arises from phosphatidylcholine breakdown

    International Nuclear Information System (INIS)

    Catalioto, R.M.; Ailhaud, G.; Negrel, R.

    1990-01-01

    Growth Hormone has recently been shown to stimulate the formation of diacylglycerol in Ob1771 mouse preadipocyte cells without increasing inositol lipid turnover. Addition of growth hormone to Ob1771 cells prelabelled with [ 3 H]glycerol or [ 3 H]choline led to a rapid, transient and stoechiometric formation of labelled diacylglycerol and phosphocholine, respectively. In contrast, no change was observed in the level of choline and phosphatidic acid whereas the release of water-soluble metabolites in [ 3 H]ethanolamine prelabelled cells exposed to growth hormone was hardly detectable. Stimulation by growth hormone of cells prelabelled with (2-palmitoyl 9, 10 [ 3 H])phosphatidylcholine also induced the production of labelled diacyglycerol. Pertussis toxin abolished both diacylglycerol and phosphocholine formation induced by growth hormone. It is concluded that growth hormone mediates diacylglycerol production in Ob1771 cells by means of phosphatidylcholine breakdown involving a phospholipase C which is likely coupled to the growth hormone receptor via a pertussis toxin-sensitive G-protein

  19. Diacylglycerol production induced by growth hormone in Ob1771 preadipocytes arises from phosphatidylcholine breakdown

    Energy Technology Data Exchange (ETDEWEB)

    Catalioto, R.M.; Ailhaud, G.; Negrel, R. (Universite de Nice-Sophia Antipolis (France))

    1990-12-31

    Growth Hormone has recently been shown to stimulate the formation of diacylglycerol in Ob1771 mouse preadipocyte cells without increasing inositol lipid turnover. Addition of growth hormone to Ob1771 cells prelabelled with ({sup 3}H)glycerol or ({sup 3}H)choline led to a rapid, transient and stoechiometric formation of labelled diacylglycerol and phosphocholine, respectively. In contrast, no change was observed in the level of choline and phosphatidic acid whereas the release of water-soluble metabolites in ({sup 3}H)ethanolamine prelabelled cells exposed to growth hormone was hardly detectable. Stimulation by growth hormone of cells prelabelled with (2-palmitoyl 9, 10 ({sup 3}H))phosphatidylcholine also induced the production of labelled diacyglycerol. Pertussis toxin abolished both diacylglycerol and phosphocholine formation induced by growth hormone. It is concluded that growth hormone mediates diacylglycerol production in Ob1771 cells by means of phosphatidylcholine breakdown involving a phospholipase C which is likely coupled to the growth hormone receptor via a pertussis toxin-sensitive G-protein.

  20. Bioinformatics analysis identify novel OB fold protein coding genes in C. elegans.

    Directory of Open Access Journals (Sweden)

    Daryanaz Dargahi

    Full Text Available BACKGROUND: The C. elegans genome has been extensively annotated by the WormBase consortium that uses state of the art bioinformatics pipelines, functional genomics and manual curation approaches. As a result, the identification of novel genes in silico in this model organism is becoming more challenging requiring new approaches. The Oligonucleotide-oligosaccharide binding (OB fold is a highly divergent protein family, in which protein sequences, in spite of having the same fold, share very little sequence identity (5-25%. Therefore, evidence from sequence-based annotation may not be sufficient to identify all the members of this family. In C. elegans, the number of OB-fold proteins reported is remarkably low (n=46 compared to other evolutionary-related eukaryotes, such as yeast S. cerevisiae (n=344 or fruit fly D. melanogaster (n=84. Gene loss during evolution or differences in the level of annotation for this protein family, may explain these discrepancies. METHODOLOGY/PRINCIPAL FINDINGS: This study examines the possibility that novel OB-fold coding genes exist in the worm. We developed a bioinformatics approach that uses the most sensitive sequence-sequence, sequence-profile and profile-profile similarity search methods followed by 3D-structure prediction as a filtering step to eliminate false positive candidate sequences. We have predicted 18 coding genes containing the OB-fold that have remarkably partially been characterized in C. elegans. CONCLUSIONS/SIGNIFICANCE: This study raises the possibility that the annotation of highly divergent protein fold families can be improved in C. elegans. Similar strategies could be implemented for large scale analysis by the WormBase consortium when novel versions of the genome sequence of C. elegans, or other evolutionary related species are being released. This approach is of general interest to the scientific community since it can be used to annotate any genome.

  1. Further RIOTS4 Characterization of Field OB Stars in the SMC

    Science.gov (United States)

    Oey, M. S.; Barnes, Jesse R.; Paggeot, Kevin J.; Dorigo Jones, John; Castro, Norberto; Simon-Diaz, Sergio; Kratter, Kaitlin M.; Moe, Maxwell; Szymanski, Michal

    2018-06-01

    We present recent results from the Runaways and O-Type Star Spectroscopic Survey of the SMC (RIOTS4), a survey quantifying properties of the field OB stars in the Small Magellanic Cloud (SMC). Based on PSF-fitting photometry and astrometry of OGLE-III I-band images, we quantify the degree of isolation for the target OB stars, classifying them as "tip-of-the-iceberg" stars accompanied by small, sparse, clusters; or as true, isolated field stars. Many of these field stars must be runaways, which we evaluate using GAIA DR2 proper motions. We measure v sin i using the IACOB code Fourier analysis, finding that the bimodal distribution of projected rotation velocities is less pronounced for O stars than early B stars. We examine rotation in relation to relative isolation and runaway status.

  2. VizieR Online Data Catalog: Properties of OB associations in IC 1613 (Garcia+, 2010)

    Science.gov (United States)

    Garcia, M.; Herrero, A.; Castro, N.; Corral, L.; Rosenberg, A.

    2014-06-01

    To understand the structure and evolution of massive stars, systematic surveys of the Local Group galaxies have been undertaken, to find these objects in environments of different chemical abundances. We focus on the metal-poor irregular galaxy IC 1613 to analyze the stellar and wind structure of its low-metallicity massive stars. We ultimately aim to study the metallicity-dependent driving mechanism of the winds of blue massive stars and use metal-poor massive stars of the Local Volume as a proxy for the stars in the early Universe. In a previous paper we produced a list of OB associations in IC 1613. Their properties are not only a powerful aid towards finding the most interesting candidate massive stars, but also reveal the structure and recent star formation history of the galaxy. We characterize these OB associations and study their connection with the galactic global properties. The reddening-free Q parameter is a powerful tool in the photometric analysis of young populations of massive stars, since it exhibits a smaller degree of degeneracy with OB spectral types than the B-V color. The color-magnitude diagram (Q vs. V) of the OB associations in IC 1613 is studied to determine their age and mass, and confirm the population of young massive stars. We identified more than 10 stars with M>=50M⊙. Spectral classification available for some of them confirm their massive nature, yet we find the common discrepancy with the spectroscopically derived masses. There is a general increasing trend of the mass of the most massive member with the number of members of each association, but not with the stellar density. The average diameter of the associations of this catalog is 40pc, half the historically considered typical size of OB associations. Size increases with the association population. The distribution of the groups strongly correlates with that of neutral and ionized hydrogen. We find the largest dispersion of association ages in the bubble region of the galaxy

  3. Multifunctional Bi2ZnOB2O6 single crystals for second and third order nonlinear optical applications

    International Nuclear Information System (INIS)

    Iliopoulos, K.; Kasprowicz, D.; Majchrowski, A.; Michalski, E.; Gindre, D.; Sahraoui, B.

    2013-01-01

    Bi 2 ZnOB 2 O 6 nonlinear optical single crystals were grown by means of the Kyropoulos method from stoichiometric melt. The second and third harmonic generation (SHG/THG) of Bi 2 ZnOB 2 O 6 crystals were investigated by the SHG/THG Maker fringes technique. Moreover, SHG microscopy studies were carried out providing two-dimensional SHG images as a function of the incident laser polarization. The high nonlinear optical efficiency combined with the possibility to grow high quality crystals make Bi 2 ZnOB 2 O 6 an excellent candidate for photonic applications

  4. VizieR Online Data Catalog: Velocity and proper motion of OB associations (Melnik+, 2009)

    Science.gov (United States)

    Melnik, A. M.; Dambis, A. K.

    2009-11-01

    For every OB-association from the list by Blaha and Humphreys (1989AJ.....98.1598B) we give the mean galactic coordinates l and b, the mean heliocentric distance r, median line-of-sight velocity Vr, the dispersion of line-of-sight velocities dvr, and number of stars with known line-of-sight velocity nvr. The line-of-sight velocities were taken from the catalog by Barbier-Brossat and Figon (1999, Cat. ). We used only the velocities measured with errors of less than 10km/s which corresponds to the quality estimations A, B, and C. We also present median proper motions of OB-associations along l- and b- coordinates, mul and mub. The data obtained for the old reduction (1997, Cat. ) are denoted by the subscript 1, whereas those based on the reduction by van Leewen (2008, Cat. ) are marked by the subscript 2. For each OB association we represent the dispersions of proper motions, dml and dmb, as well as a number of stars nmu with known proper motion. The last column shows the total number of stars with known photometric measurements, Nt, used for determination of the distances for OB-associations. The distances r correspond to the short distance scale for classical Cepheids. They are equal to the distances from the catalog by Blaha and Humphreys (1989AJ.....98.1598B), rBH, multiplied by a factor of 0.8, r=0.8*rBH. (1 data file).

  5. The CIDA-QUEST large-scale survey of Orion OB1: evidence for rapid disk dissipation in a dispersed stellar population.

    Science.gov (United States)

    Briceño, C; Vivas, A K; Calvet, N; Hartmann, L; Pacheco, R; Herrera, D; Romero, L; Berlind, P; Sánchez, G; Snyder, J A; Andrews, P

    2001-01-05

    We are conducting a large-scale, multiepoch, optical photometric survey [Centro de Investigaciones de Astronomia-Quasar Equatorial Survey Team (CIDA-QUEST)] covering about 120 square degrees to identify the young low-mass stars in the Orion OB1 association. We present results for an area of 34 square degrees. Using photometric variability as our main selection criterion, as well as follow-up spectroscopy, we confirmed 168 previously unidentified pre-main sequence stars that are about 0.6 to 0.9 times the mass of the sun (Mo), with ages of about 1 million to 3 million years (Ori OB1b) and about 3 million to 10 million years (Ori OB1a). The low-mass stars are spatially coincident with the high-mass (at least 3 Mo) members of the associations. Indicators of disk accretion such as Halpha emission and near-infrared emission from dusty disks fall sharply from Ori OB1b to Ori OB1a, indicating that the time scale for disk dissipation and possibly the onset of planet formation is a few million years.

  6. Structure-guided mutational analysis of the OB, HhH, and BRCT domains of Escherichia coli DNA ligase.

    Science.gov (United States)

    Wang, Li Kai; Nair, Pravin A; Shuman, Stewart

    2008-08-22

    NAD(+)-dependent DNA ligases (LigAs) are ubiquitous in bacteria and essential for growth. LigA enzymes have a modular structure in which a central catalytic core composed of nucleotidyltransferase and oligonucleotide-binding (OB) domains is linked via a tetracysteine zinc finger to distal helix-hairpin-helix (HhH) and BRCT (BRCA1-like C-terminal) domains. The OB and HhH domains contribute prominently to the protein clamp formed by LigA around nicked duplex DNA. Here we conducted a structure-function analysis of the OB and HhH domains of Escherichia coli LigA by alanine scanning and conservative substitutions, entailing 43 mutations at 22 amino acids. We thereby identified essential functional groups in the OB domain that engage the DNA phosphodiester backbone flanking the nick (Arg(333)); penetrate the minor grove and distort the nick (Val(383) and Ile(384)); or stabilize the OB fold (Arg(379)). The essential constituents of the HhH domain include: four glycines (Gly(455), Gly(489), Gly(521), Gly(553)), which bind the phosphate backbone across the minor groove at the outer margins of the LigA-DNA interface; Arg(487), which penetrates the minor groove at the outer margin on the 3 (R)-OH side of the nick; and Arg(446), which promotes protein clamp formation via contacts to the nucleotidyltransferase domain. We find that the BRCT domain is required in its entirety for effective nick sealing and AMP-dependent supercoil relaxation.

  7. Far-infrared and CO observations of Cep F: Implications for star formation in Cepheus OB3

    International Nuclear Information System (INIS)

    Sargent, A.I.; van Duinen, R.J.; Nordh, H.L.; Fridlund, C.V.M.; Aalders, J.W.G.; Beintema, D.

    1983-01-01

    Observations at 80-μm and 130-μm have revealed a source of far-infrared emission in the Cep F portion of the Cepheus OB3 molecular cloud. Molecular line measurements of this region, at the CO J = 1-0 line frequency, have led to the discovery of two CO maxima. One of these coincides with the new far-infrared source. The other is at least as intense as Cep B, until now considered to be the hottest part of the cloud. There is some evidence to suggest that a second far-infrared source is associated with this hotspot. If the far-infrared emission results from the presence of embedded protostars, their location, relative to the OB association stars and to the other active region, Cep A, requires a reexamination of how stars form in the Cepheus OB3 association

  8. An unidentified TeV source in the vicinity of Cygnus OB2

    Science.gov (United States)

    Aharonian, F.; Akhperjanian, A.; Beilicke, M.; Bernlöhr, K.; Börst, H.; Bojahr, H.; Bolz, O.; Coarasa, T.; Contreras, J.; Cortina, J.; Denninghoff, S.; Fonseca, V.; Girma, M.; Götting, N.; Heinzelmann, G.; Hermann, G.; Heusler, A.; Hofmann, W.; Horns, D.; Jung, I.; Kankanyan, R.; Kestel, M.; Kettler, J.; Kohnle, A.; Konopelko, A.; Kornmeyer, H.; Kranich, D.; Krawczynski, H.; Lampeitl, H.; Lopez, M.; Lorenz, E.; Lucarelli, F.; Magnussen, N.; Mang, O.; Meyer, H.; Milite, M.; Mirzoyan, R.; Moralejo, A.; Ona, E.; Panter, M.; Plyasheshnikov, A.; Prahl, J.; Pühlhofer, G.; Rauterberg, G.; Reyes, R.; Rhode, W.; Ripken, J.; Röhring, A.; Rowell, G. P.; Sahakian, V.; Samorski, M.; Schilling, M.; Schröder, F.; Siems, M.; Sobzynska, D.; Stamm, W.; Tluczykont, M.; Völk, H. J.; Wiedner, C. A.; Wittek, W.; Uchiyama, Y.; Takahashi, T.; HEGRA Collaboration

    2002-10-01

    Deep observation ( ~ 113 hrs) of the Cygnus region at TeV energies using the HEGRA stereoscopic system of air Čerenkov telescopes has serendipitously revealed a signal positionally inside the core of the OB association Cygnus OB2, at the edge of the 95% error circle of the EGRET source 3EG J2033+4118, and ~ 0.5o north of Cyg X-3. The source centre of gravity is RA alphaJ2000: 20h 32m 07s+/- 9.2sstat +/-2.2ssys, Dec deltaJ2000: +41o 30' 30''+/- 2.0'stat +/- 0.4'sys. The source is steady, has a post-trial significance of +4.6sigma , indication for extension with radius 5.6' at the ~ 3sigma level, and has a differential power-law flux with hard photon index of -1.9 +/-0.3stat +/-0.3sys. The integral flux above 1 TeV amounts ~ 3% that of the Crab. No counterpart for the TeV source at other wavelengths is presently identified, and its extension would disfavour an exclusive pulsar or AGN origin. If associated with Cygnus OB2, this dense concentration of young, massive stars provides an environment conducive to multi-TeV particle acceleration and likely subsequent interaction with a nearby gas cloud. Alternatively, one could envisage gamma -ray production via a jet-driven termination shock.

  9. BOREAS TF-3 Automated Chamber CO2 Flux Data from the NSA-OBS

    Science.gov (United States)

    Goulden, Michael L.; Crill, Patrick M.; Hall, Forrest G. (Editor); Conrad, Sara (Editor)

    2000-01-01

    The BOReal Ecosystem Atmosphere Study Tower Flux (BOREAS TF-3) and Trace Gas Biogeochemistry (TGB-1) teams collected automated CO2 chamber flux data in their efforts to fully describe the CO2 flux at the Northern Study Area-Old Black Spruce (NSA-OBS) site. This data set contains fluxes of CO2 at the NSA-OBS site measured using automated chambers. In addition to reporting the CO2 flux, it reports chamber air temperature, moss temperature, and light levels during each measurement. The data set covers the period from 23-Sep-1995 through 26-Oct-1995 and from 28-May-1996 through 21-Oct-1996. The data are stored in tabular ASCII files.

  10. Mass loss from OB supergiants in x-ray binary systems

    International Nuclear Information System (INIS)

    Alme, M.L.; Wilson, J.R.

    1975-01-01

    A study of the atmospheres of OB supergiants in x-ray binary systems indicates that when the stellar surface is close enough to the saddle in the gravitational potential to provide a mass transfer rate adequate to power a compact x-ray source, large-amplitude variations in the rate of mass flow occur. 9 references

  11. Relative Stabilities of Conserved and Non-Conserved Structures in the OB-Fold Superfamily

    Directory of Open Access Journals (Sweden)

    Andrei T. Alexandrescu

    2009-05-01

    Full Text Available The OB-fold is a diverse structure superfamily based on a β-barrel motif that is often supplemented with additional non-conserved secondary structures. Previous deletion mutagenesis and NMR hydrogen exchange studies of three OB-fold proteins showed that the structural stabilities of sites within the conserved β-barrels were larger than sites in non-conserved segments. In this work we examined a database of 80 representative domain structures currently classified as OB-folds, to establish the basis of this effect. Residue-specific values were obtained for the number of Cα-Cα distance contacts, sequence hydrophobicities, crystallographic B-factors, and theoretical B-factors calculated from a Gaussian Network Model. All four parameters point to a larger average flexibility for the non-conserved structures compared to the conserved β-barrels. The theoretical B-factors and contact densities show the highest sensitivity.Our results suggest a model of protein structure evolution in which novel structural features develop at the periphery of conserved motifs. Core residues are more resistant to structural changes during evolution since their substitution would disrupt a larger number of interactions. Similar factors are likely to account for the differences in stability to unfolding between conserved and non-conserved structures.

  12. Marked augmentation of PLGA nanoparticle-induced metabolically beneficial impact of γ-oryzanol on fuel dyshomeostasis in genetically obese-diabetic ob/ob mice.

    Science.gov (United States)

    Kozuka, Chisayo; Shimizu-Okabe, Chigusa; Takayama, Chitoshi; Nakano, Kaku; Morinaga, Hidetaka; Kinjo, Ayano; Fukuda, Kotaro; Kamei, Asuka; Yasuoka, Akihito; Kondo, Takashi; Abe, Keiko; Egashira, Kensuke; Masuzaki, Hiroaki

    2017-11-01

    Our previous works demonstrated that brown rice-specific bioactive substance, γ-oryzanol acts as a chaperone, attenuates exaggerated endoplasmic reticulum (ER) stress in brain hypothalamus and pancreatic islets, thereby ameliorating metabolic derangement in high fat diet (HFD)-induced obese diabetic mice. However, extremely low absorption efficiency from intestine of γ-oryzanol is a tough obstacle for the clinical application. Therefore, in this study, to overcome extremely low bioavailability of γ-oryzanol with super-high lipophilicity, we encapsulated γ-oryzanol in polymer poly (DL-lactide-co-glycolide) (PLGA) nanoparticles (Nano-Orz), and evaluated its metabolically beneficial impact in genetically obese-diabetic ob/ob mice, the best-known severest diabetic model in mice. To our surprise, Nano-Orz markedly ameliorated fuel metabolism with an unexpected magnitude (∼1000-fold lower dose) compared with regular γ-oryzanol. Furthermore, such a conspicuous impact was achievable by its administration once every 2 weeks. Besides the excellent impact on dysfunction of hypothalamus and pancreatic islets, Nano-Orz markedly decreased ER stress and inflammation in liver and adipose tissue. Collectively, nanotechnology-based developments of functional foods oriented toward γ-oryzanol shed light on the novel approach for the treatment of a variety of metabolic diseases in humans.

  13. Obésité abdominale et autres biomarqueurs de risque ...

    African Journals Online (AJOL)

    Obésité abdominale et autres biomarqueurs de risque cardiométabolique: influence du niveau socioéconomique et du mode de vie dans deux populations noires apparentées, Cotonou (Bénin) et Port-au-Prince (Haïti). Asma EL Mabchour, Hélène Delisle, Colette Vilgrain, Phillipe Larco, Roger Sodjinou ...

  14. Improvements to the gridding of precipitation data across Europe under the E-OBS scheme

    Science.gov (United States)

    Cornes, Richard; van den Besselaar, Else; Jones, Phil; van der Schrier, Gerard; Verver, Ge

    2016-04-01

    Gridded precipitation data are a valuable resource for analyzing past variations and trends in the hydroclimate. Such data also provide a reference against which model simulations may be driven, compared and/or adjusted. The E-OBS precipitation dataset is widely used for such analyses across Europe, and is particularly valuable since it provides a spatially complete, daily field across the European domain. In this analysis, improvements to the E-OBS precipitation dataset will be presented that aim to provide a more reliable estimate of grid-box precipitation values, particularly in mountainous areas and in regions with a relative sparsity of input station data. The established three-stage E-OBS gridding scheme is retained, whereby monthly precipitation totals are gridded using a thin-plate spline; daily anomalies are gridded using indicator kriging; and the final dataset is produced by multiplying the two grids. The current analysis focuses on improving the monthly thin-plate spline, which has overall control on the final daily dataset. The results from different techniques are compared and the influence on the final daily data is assessed by comparing the data against gridded country-wide datasets produced by various National Meteorological Services

  15. Neutral hydrogen in the stellar accociation Scorpius OB-2

    Energy Technology Data Exchange (ETDEWEB)

    Bystrova, N.V.

    1979-01-01

    The distribution of neutral hydrogen connected with the stellar association Scorpius OB-2 is more complex than the expanding semienvelope suggested earlier. The neutral gas is in connection with the nebulae S1, S7, S9 and with H/sub ..cap alpha../-filaments found in the association and giving it the appearence of a spiral galaxy. The HI-distribution is in disagreement with the model of a supernova remnant.

  16. ObStruct: a method to objectively analyse factors driving population structure using Bayesian ancestry profiles.

    Directory of Open Access Journals (Sweden)

    Velimir Gayevskiy

    Full Text Available Bayesian inference methods are extensively used to detect the presence of population structure given genetic data. The primary output of software implementing these methods are ancestry profiles of sampled individuals. While these profiles robustly partition the data into subgroups, currently there is no objective method to determine whether the fixed factor of interest (e.g. geographic origin correlates with inferred subgroups or not, and if so, which populations are driving this correlation. We present ObStruct, a novel tool to objectively analyse the nature of structure revealed in Bayesian ancestry profiles using established statistical methods. ObStruct evaluates the extent of structural similarity between sampled and inferred populations, tests the significance of population differentiation, provides information on the contribution of sampled and inferred populations to the observed structure and crucially determines whether the predetermined factor of interest correlates with inferred population structure. Analyses of simulated and experimental data highlight ObStruct's ability to objectively assess the nature of structure in populations. We show the method is capable of capturing an increase in the level of structure with increasing time since divergence between simulated populations. Further, we applied the method to a highly structured dataset of 1,484 humans from seven continents and a less structured dataset of 179 Saccharomyces cerevisiae from three regions in New Zealand. Our results show that ObStruct provides an objective metric to classify the degree, drivers and significance of inferred structure, as well as providing novel insights into the relationships between sampled populations, and adds a final step to the pipeline for population structure analyses.

  17. Examination of the site amplification factor of OBS and their application to magnitude estimation and ground-motion prediction for EEW

    Science.gov (United States)

    Hayashimoto, N.; Hoshiba, M.

    2013-12-01

    1. Introduction Ocean bottom seismograph (OBS) is useful for making Earthquake Early Warning (EEW) earlier. However, careful handling of these data is required because the installation environment of OBSs may be different from that of land stations. Site amplification factor is an important factor to estimate the magnitudes, and to predict ground motions (e.g. seismic intensity) in EEW. In this presentation, we discuss the site amplification factor of OBS in the Tonankai area of Japan from these two points of view. 2. Examination of magnitude correction of OBS In the EEW of JMA, the magnitude is estimated from the maximum amplitude of the displacement in real time. To provide the fast magnitude estimation, the magnitude-estimation algorithm switches from the P to S formula (Meew(P) to Meew(S)) depending on the expected S-phase arrival (Kamigaichi,2004). To estimate the magnitude correction for OBS, we determine Meew(P) and Meew(S) at OBSs and compare them with JMA magnitude (Mjma). We find Meew(S) at OBS is generally larger than Mjma by approximately 0.6. The slight differences of spatial distribution of Meew(S) amplification are also found among other OBSs. From the numerical simulations, Nakamura et al. (MGR,submitted) pointed out that the oceanic layer and the low-velocity sediment layers causes the large amplifications in low frequency range (0.1-0.2Hz) at OBSs. We conclude that the site effect of OBS characterized by such a low velocity sediment layers causes those amplification of Magnitude. 3. The frequency-dependent site factor of OBS estimated from Fourier spectrum ratio and their application for prediction of seismic intensity of land station We compare Fourier spectra of S-wave portion on OBSs with those on adjacent land stations. Station pair whose distance is smaller than 50 km is analyzed, and we obtain that spectral ratio of land station (MIEH05 of the KiK-net/NIED) to OBS (KMA01 of the DONET/JAMSTEC) is 5-20 for frequencies 10-20Hz for both

  18. OB/GYN boot cAMP using high-fidelity human simulators: enhancing residents' perceived competency, confidence in taking a leadership role, and stress hardiness.

    Science.gov (United States)

    Pliego, Jose F; Wehbe-Janek, Hania; Rajab, M Hasan; Browning, Jeff L; Fothergill, Russell E

    2008-01-01

    To evaluate the effectiveness of an obstetrical and gynecologic (Ob/Gyn) Boot Camp simulation training on perceived technical competency, confidence in a leadership role, and stress hardiness of resident training. We conducted a prospective pilot study on the effectiveness of an Ob/Gyn Boot Camp on resident training. Residents participated in an intensive immersion in clinical simulation of common obstetrical emergencies including shoulder dystocia, neonatal resuscitation, postpartum hemorrhage, and ruptured ectopic pregnancy. After the training, residents completed a Web-based survey on their perceptions of how the Ob/Gyn Boot Camp affected their 1) technical competency in the assessment and management of their patients, 2) confidence in taking a leadership role, and 3) stress hardiness. Residents rated their perceptions on a Likert scale of 1 to 5, 1 = poor to 5 = excellent. Twenty-three (14 Ob/Gyn and 9 family medicine) residents participated in this pilot study. Eighteen (78%) residents completed the online survey; 4 Ob/Gyn and 1 family medicine resident did not complete the survey. The residents reported that the simulation training stimulated an interest in learning key skills for obstetrical and gynecologic emergencies. Ob/Gyn residents reported significant improvement in their perceived technical competence and stress hardiness after the Boot Camp. However both Ob/Gyn and family medicine residents reported no significant improvement of confidence in their leadership abilities during obstetrical emergencies after the Boot Camp. Boot Camp simulation training early in the curriculum has the potential for enhancing residents' self-assessments of confidence, competency, and stress hardiness in managing obstetrical emergencies.

  19. A M2FS Spectroscopic Study of Low-mass Young Stars in Orion OB1

    Science.gov (United States)

    Kaleida, Catherine C.; Briceno, Cesar; Calvet, Nuria; Mateo, Mario L.; Hernandez, Jesus

    2015-01-01

    Surveys of pre-main sequence stars in the ~4-10 Myr range provide a window into the decline of the accretion phase of stars and the formation of planets. Nearby star clusters and stellar associations allow for the study of these young stellar populations all the way down to the lowest mass members. One of the best examples of nearby 4-10 Myr old stellar populations is the Orion OB1 association. The CIDA Variability Survey of Orion OB1 (CVSO - Briceño et al. 2001) has used the variability properties of low-mass pre-main-sequence (PMS) stars to identify hundreds of K and M-type stellar members of the Orion OB1 association, a number of them displaying IR-excess emission and thought to be representative of more evolved disk-bearing young stars. Characterizing these young, low-mass objects using spectroscopy is integral to understanding the accretion phase in young stars. We present preliminary results of a spectroscopic survey of candidate and confirmed Orion OB1 low-mass members taken during November 2014 and February 2014 using the Michigan/Magellan Fiber Spectrograph (M2FS), a PI instrument on the Magellan Clay Telescope (PI: M. Matteo). Target fields located in the off-cloud regions of Orion were identified in the CVSO, and observed using the low and high-resolution modes of M2FS. Both low and high-resolution spectra are needed in order to confirm membership and derive masses, ages, kinematics and accretion properties. Initial analysis of these spectra reveal many new K and M-type members of the Orion OB1 association in these low extinction, off-cloud areas. These are the more evolved siblings of the youngest stars still embedded in the molecular clouds, like those in the Orion Nebula Cluster. With membership and spectroscopic indicators of accretion we are building the most comprehensive stellar census of this association, enabling us to derive a robust estimate of the fraction of young stars still accreting at a various ages, a key constraint for the end of

  20. Cesium-137 global fallout into the Ob river basin and its influence on the Kara sea contamination - Weapons fallout cesium-137 in the Ob' catchment landscapes and its influence on radioactive contamination of the Kara sea: Western Siberia, Russia

    Energy Technology Data Exchange (ETDEWEB)

    Semenkov, Ivan N.; Miroshnikov, Alexey Yu. [The Organization of Russian Academy of Sciences Institute of geology of ore deposits, petrography, mineralogy and geochemistry Russian Academy of Sciences (Russian Federation)

    2014-07-01

    There are several high level {sup 137}Cs anomaly zones detected in the deposits of the SW part of the Kara Sea. These anomaly zones were formed in the Ob' and the Enisey river estuaries due to the geochemical 'river-sea' boarder barrier. Level of radiocaesium specific activity reaches 120 Bq*kg{sup -1} in the deposits from these zones. Radiochemical enterprises occur in the both river basins. Their activity results in caesium-137 transfer into the river net. Vast area is contaminated by {sup 137}Cs after nuclear weapons in Semipalatinsk test-site and Kyshtym disaster in the Ob' river basin. Moreover, caesium comes to the Ob' and the Enisey river basins with global atmospheric fallout. The inflow of global fallout caesium-137 to the catchments is 660 kCi (320 kCi including radioactive decay) that is 4 times higher than {sup 137}Cs emission due to Fukushima disaster. Therefore, these river basins as any other huge catchment are an important sources of radioactive contamination of the Arctic Ocean. The aim of our research is to study behavior of global fallout caesium-137 in the landscapes of the Ob and the Enisey river basins. We studied caesium-137 behavior on the example of first order catchments in taiga, wetland, forest-steppe, steppe, and semi-arid landscapes. Geographic information system (GIS) was made. The tenth-order catchments (n=154, Horton coding system) shape 20-groups due to topsoil properties controlling cesium mobility. Eleven first-order basins, characterized 7 groups of tenth order catchments, were studied. And 700 bulk-core soil samples were collected in 2011-2013. Cesium runoff is calculated for 3 first-order river basins in taiga and forest-steppe landscapes. Storage of global fallout caesium-137 declines from undisturbing taiga first-order river basin (90% of cumulative fallout including radioactive decay)> arable steppe and fores-steppe (70 - 75%)> undisturbing wetland (60%). Caesium-137 transfer is high in arable lands

  1. Case Study of Data Mining in Observational Astronomy: The Search for New OB Stars in the Small Magellanic Cloud

    Science.gov (United States)

    Larkin, Cormac; Vink, Jorick; Kalari, Venu; Groh, Jose

    2018-01-01

    OB stars are the most luminous and massive stars, living short lives and exerting a disproportionate influence on their environments. They are key to understanding progenitors of gravitational wave sources and reionization of the early Universe. To detect new OB stars, we combine photometric catalog data with TLUSTY and ATLAS9 stellar atmospheres. This method is also believed to be sensitive to elusive “stripped” stars, thought to lose their hydrogen envelope through binary interaction.OB stars are intrinsically luminous, so complete populations are assumed for local group galaxies such as the Small Magellanic Cloud. Our findings challenge this, as we find 26 new OB candidates. Spectroscopy of 7 candidates shows a 100% detection rate. Most interestingly, 5 of our candidates are consistent with “stripped” stars.To date only 5 “stripped” candidates have been found serendipitously (e.g. HD 45166) as current methods are not sensitive to them. Our work doubles the sample of detected candidates, highlighting that our approach is the first to identify them in a targeted, systematic way. The finding of “stripped” stars could rewrite our understanding of the early Universe, offering an alternative hypothesis to Wolf-Rayet driven cosmic reionization.

  2. Deposition of plutonium isotopes and Cs-137 in sediments of the Ob delta from the beginning of the nuclear age

    International Nuclear Information System (INIS)

    Panteleyev, G.P.; Livingston, H.D.; Sayles, F.L.; Medkova, O.N.

    1995-01-01

    As an approach to an assessment of the transport of artificial radionuclides through the Ob river system towards the arctic Ocean, results are presented from the analyses of a series of sediment cores collected in the Ob delta and estuary in 1994. These cores, collected in areas of sediment accumulation, contain the depositional history at the Ob mouth of substances associated with sediment particles from the whole river system watershed. Several approaches to dating these sediments permitted the development of a chronology for the deposition of plutonium isotopes and Cs-137, following their first introduction to the environment a half century ago. Some preliminary results for I-129 are also presented. 6 figs

  3. Performance analysis of signaling protocols on OBS switches

    Science.gov (United States)

    Kirci, Pinar; Zaim, A. Halim

    2005-10-01

    In this paper, Just-In-Time (JIT), Just-Enough-Time (JET) and Horizon signalling schemes for Optical Burst Switched Networks (OBS) are presented. These signaling schemes run over a core dWDM network and a network architecture based on Optical Burst Switches (OBS) is proposed to support IP, ATM and Burst traffic. In IP and ATM traffic several packets are assembled in a single packet called burst and the burst contention is handled by burst dropping. The burst length distribution in IP traffic is arbitrary between 0 and 1, and is fixed in ATM traffic at 0,5. Burst traffic on the other hand is arbitrary between 1 and 5. The Setup and Setup ack length distributions are arbitrary. We apply the Poisson model with rate λ and Self-Similar model with pareto distribution rate α to identify inter-arrival times in these protocols. We consider a communication between a source client node and a destination client node over an ingress and one or more multiple intermediate switches.We use buffering only in the ingress node. The communication is based on single burst connections in which, the connection is set up just before sending a burst and then closed as soon as the burst is sent. Our analysis accounts for several important parameters, including the burst setup, burst setup ack, keepalive messages and the optical switching protocol. We compare the performance of the three signalling schemes on the network under as burst dropping probability under a range of network scenarios.

  4. Toward Complete Statistics of Massive Binary Stars: Penultimate Results from the Cygnus OB2 Radial Velocity Survey

    OpenAIRE

    Kobulnicky, Henry A.; Kiminki, Daniel C.; Lundquist, Michael J.; Burke, Jamison; Chapman, James; Keller, Erica; Lester, Kathryn; Rolen, Emily K.; Topel, Eric; Bhattacharjee, Anirban; Smullen, Rachel A.; Alvarez, Carlos A. Vargas; Runnoe, Jessie C.; Dale, Daniel A.; Brotherton, Michael M.

    2014-01-01

    We analyze orbital solutions for 48 massive multiple-star systems in the Cygnus OB2 Association, 23 of which are newly presented here, to find that the observed distribution of orbital periods is approximately uniform in log P for P 45 d, even after correction for completeness, indicating either a lower binary fraction or a shift toward low-mass companions. A high degree of similarity (91% likelihood) between the Cyg OB2 period distribution and that of other surveys suggests that the binary p...

  5. BOREAS TF-3 NSA-OBS Tower Flux, Meteorological, and Soil Temperature Data

    Science.gov (United States)

    Wofsy, Steven; Sutton, Doug; Goulden, Mike; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor)

    2000-01-01

    The BOReal Ecosystem-Atmosphere Study Tower Flux (BOREAS TF-3) team collected tower flux, surface meteorological, and soil temperature data at the BOREAS Northern Study Area-Old Black Spruce (NSA-OBS) site continuously from the March 1994 through October 1996. The data are available in tabular ASCII files.

  6. The structure of KPN03535 (gi|152972051), a novel putative lipoprotein from Klebsiella pneumoniae, reveals an OB-fold

    International Nuclear Information System (INIS)

    Das, Debanu; Kozbial, Piotr; Han, Gye Won; Carlton, Dennis; Jaroszewski, Lukasz; Abdubek, Polat; Astakhova, Tamara; Axelrod, Herbert L.; Bakolitsa, Constantina; Chen, Connie; Chiu, Hsiu-Ju; Chiu, Michelle; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Ellrott, Kyle; Elsliger, Marc-André; Ernst, Dustin; Farr, Carol L.; Feuerhelm, Julie; Grzechnik, Anna; Grant, Joanna C.; Jin, Kevin K.; Johnson, Hope A.; Klock, Heath E.; Knuth, Mark W.; Krishna, S. Sri; Kumar, Abhinav; Marciano, David; McMullan, Daniel; Miller, Mitchell D.; Morse, Andrew T.; Nigoghossian, Edward; Nopakun, Amanda; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Puckett, Christina; Reyes, Ron; Rife, Christopher L.; Sefcovic, Natasha; Tien, Henry J.; Trame, Christine B.; Bedem, Henry van den; Weekes, Dana; Wooten, Tiffany; Xu, Qingping; Hodgson, Keith O.; Wooley, John; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.

    2009-01-01

    KPN03535 is a protein unique to K. pneumoniae. The crystal structure reveals that KPN03535 represents a novel variant of the OB-fold and is likely to be a DNA-binding lipoprotein. KPN03535 (gi|152972051) is a putative lipoprotein of unknown function that is secreted by Klebsiella pneumoniae MGH 78578. The crystal structure reveals that despite a lack of any detectable sequence similarity to known structures, it is a novel variant of the OB-fold and structurally similar to the bacterial Cpx-pathway protein NlpE, single-stranded DNA-binding (SSB) proteins and toxins. K. pneumoniae MGH 78578 forms part of the normal human skin, mouth and gut flora and is an opportunistic pathogen that is linked to about 8% of all hospital-acquired infections in the USA. This structure provides the foundation for further investigations into this divergent member of the OB-fold family

  7. Analyzing the Effects of Nitrogen Deficiency on the PHB Production of Methylosinus trichosporium OB3b

    Science.gov (United States)

    Kyauk, E.

    2011-12-01

    Polyhydroxybutyrate (PHB) is a biodegradable thermoplastic that is produced by various microorganisms. Because of its potential to replace conventional plastics, it has been closely researched in the past few years. Methanotrophic bacteria, bacteria that consume methane, produce this bioplastic when it lacks certain nutrients. The utilization of methane to produce PHB shows much promise as methane is a cheap, plentiful gas. In this study, we observed the methanotroph, Methylosinus trichosporium OB3b , and its yield of PHB in the absence of nitrogen. The optical density of Methylosinus trichosporium OB3b was measured in order to observe cell growth and PHB production patterns over a 48 hour period.

  8. A Search for Pulsar Companions to OB Runaway Stars

    Science.gov (United States)

    Kaspi, V. M.

    1995-01-01

    We have searched for radio pulsar companions to 40 nearby OB runaway stars. Observations were made at 474 and 770 MHz with the NRAO 140 ft telescope. The survey was sensitive to long- period pulsars with flux densities of 1 mJy or more. One previously unknown pulsar was discovered, PSRJ2044+4614, while observing towards target O star BD+45,3260. Follow-up timing observations of the pulsar measured its position to high precision, revealing a 9' separation between the pulsar and the target star, unequivocally indicating they are not associated.

  9. ObsPy: Establishing and maintaining an open-source community package

    Science.gov (United States)

    Krischer, L.; Megies, T.; Barsch, R.

    2017-12-01

    Python's ecosystem evolved into one of the most powerful and productive research environment across disciplines. ObsPy (https://obspy.org) is a fully community driven, open-source project dedicated to provide a bridge for seismology into that ecosystem. It does so by offering Read and write support for essentially every commonly used data format in seismology, Integrated access to the largest data centers, web services, and real-time data streams, A powerful signal processing toolbox tuned to the specific needs of seismologists, and Utility functionality like travel time calculations, geodetic functions, and data visualizations. ObsPy has been in constant unfunded development for more than eight years and is developed and used by scientists around the world with successful applications in all branches of seismology. By now around 70 people directly contributed code to ObsPy and we aim to make it a self-sustaining community project.This contributions focusses on several meta aspects of open-source software in science, in particular how we experienced them. During the panel we would like to discuss obvious questions like long-term sustainability with very limited to no funding, insufficient computer science training in many sciences, and gaining hard scientific credits for software development, but also the following questions: How to best deal with the fact that a lot of scientific software is very specialized thus usually solves a complex problem but at the same time can only ever reach a limited pool of developers and users by virtue of it being so specialized? Therefore the "many eyes on the code" approach to develop and improve open-source software only applies in a limited fashion. An initial publication for a significant new scientific software package is fairly straightforward. How to on-board and motivate potential new contributors when they can no longer be lured by a potential co-authorship? When is spending significant time and effort on reusable

  10. Development of the TeamOBS-PPH - targeting clinical performance in postpartum hemorrhage.

    Science.gov (United States)

    Brogaard, Lise; Hvidman, Lone; Hinshaw, Kim; Kierkegaard, Ole; Manser, Tanja; Musaeus, Peter; Arafeh, Julie; Daniels, Kay I; Judy, Amy E; Uldbjerg, Niels

    2018-06-01

    This study aimed to develop a valid and reliable TeamOBS-PPH tool for assessing clinical performance in the management of postpartum hemorrhage (PPH). The tool was evaluated using video-recordings of teams managing PPH in both real-life and simulated settings. A Delphi panel consisting of 12 obstetricians from the UK, Norway, Sweden, Iceland, and Denmark achieved consensus on (i) the elements to include in the assessment tool, (ii) the weighting of each element, and (iii) the final tool. The validity and reliability were evaluated according to Cook and Beckman. (Level 1) Four raters scored four video-recordings of in situ simulations of PPH. (Level 2) Two raters scored 85 video-recordings of real-life teams managing patients with PPH ≥1000 mL in two Danish hospitals. (Level 3) Two raters scored 15 video-recordings of in situ simulations of PPH from a US hospital. The tool was designed with scores from 0 to 100. (Level 1) Teams of novices had a median score of 54 (95% CI 48-60), whereas experienced teams had a median score of 75 (95% CI 71-79; p < 0.001). (Level 2) The intra-rater [intra-class correlation (ICC) = 0.96] and inter-rater (ICC = 0.83) agreements for real-life PPH were strong. The tool was applicable in all cases: atony, retained placenta, and lacerations. (Level 3) The tool was easily adapted to in situ simulation settings in the USA (ICC = 0.86). The TeamOBS-PPH tool appears to be valid and reliable for assessing clinical performance in real-life and simulated settings. The tool will be shared as the free TeamOBS App. © 2018 Nordic Federation of Societies of Obstetrics and Gynecology.

  11. OB ASSOCIATIONS AT THE UPPER END OF THE MILKY WAY LUMINOSITY FUNCTION

    Energy Technology Data Exchange (ETDEWEB)

    Rahman, Mubdi; Matzner, Christopher D.; Moon, Dae-Sik, E-mail: mubdi@pha.jhu.edu [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H8 (Canada)

    2013-04-01

    The Milky Way's most luminous, young, and massive (M {approx}> 10{sup 4} M{sub Sun }) star clusters and OB associations have largely evaded detection despite knowledge of their surrounding H II regions. We search for these clusters and associations within the 40 star-forming complexes from Rahman and Murray in the 13 most luminous Wilkinson Microwave Anisotropy Probe (WMAP) free-free emission sources of the Galaxy. Selecting for objects with the dust-reddened colors of OB stars, we identify new candidate associations using the Two Micron All Sky Survey point-source catalog. In 40 star-forming complexes searched, 22 contain cluster/association candidates with sizes and masses in the range of 3'-26' and 10{sup 2.3}-10{sup 5} M{sub Sun }. Of the 22 candidates, at least seven have estimated masses {approx}> 10{sup 4} M{sub Sun }, doubling the number of such massive clusters known in the Galaxy. Only one of the searched WMAP sources remains without a candidate. Applying our method to a statistically similar set of test locations, we estimate that 3.0 {+-} 0.6 of our 22 candidate associations are unrelated to the star-forming complexes. In addition, the apparent extinctions of our candidate associations correlate well with the predictions from a Galactic model. These facts, along with the clear detection of a known OB association and the previous spectral verification of one cluster found by this method, validate our method. In eight of the most luminous WMAP sources, the candidate associations can account for the observed free-free flux. With our new compilation, the Galactic census of young, massive stellar associations may now be about half complete.

  12. Asteroseismology of OB stars with hundreds of single snapshot spectra (and a few time-series of selected targets)

    Science.gov (United States)

    Simón-Díaz, S.

    2015-01-01

    Imagine we could do asteroseismology of large samples of OB-type stars by using just one spectrum per target. That would be great! But this is probably a crazy and stupid idea. Or maybe not. Maybe we have the possibility to open a new window to investigate stellar oscillations in massive stars that has been in front of us for many years, but has not attracted very much our attention: the characterization and understanding of the so-called macroturbulent broadening in OB-type stars.

  13. Into the Darkness: Interstellar Extinction Near the Cepheus OB3 Molecular Cloud

    Science.gov (United States)

    Fitzpatrick, Edward L.; Jacklin, S.; Massa, D.

    2014-01-01

    We present the results of a followup investigation to a study performed by Massa and Savage (1984, ApJ, 279, 310) of the properties of UV interstellar extinction in the region of the Cepheus OB3 molecular cloud. That study was performed using UV photometry and spectro-photometry from the ANS and IUE satellites. We have extended this study into the IR, utilizing the uniform database of IR photometry available from the 2MASS project. This is a part of a larger program whose goal is to study the properties of extinction in localized regions, where we hope to find clues to dust grain growth and destruction processes through spatial correlations of extinction with distinct environmental properties. Similarly to Massa and Savage’s UV results, we find that the IR extinction properties on the Cepheus OB3 region vary systematically with the apparent proximity of the target stars to the molecular cloud. We also find that the UV extinction and the IR extinction are crudely correlated. The methodology leading to these results and their implications are discussed.

  14. Optimal Inversion Parameters for Full Waveform Inversion using OBS Data Set

    Science.gov (United States)

    Kim, S.; Chung, W.; Shin, S.; Kim, D.; Lee, D.

    2017-12-01

    In recent years, full Waveform Inversion (FWI) has been the most researched technique in seismic data processing. It uses the residuals between observed and modeled data as an objective function; thereafter, the final subsurface velocity model is generated through a series of iterations meant to minimize the residuals.Research on FWI has expanded from acoustic media to elastic media. In acoustic media, the subsurface property is defined by P-velocity; however, in elastic media, properties are defined by multiple parameters, such as P-velocity, S-velocity, and density. Further, the elastic media can also be defined by Lamé constants, density or impedance PI, SI; consequently, research is being carried out to ascertain the optimal parameters.From results of advanced exploration equipment and Ocean Bottom Seismic (OBS) survey, it is now possible to obtain multi-component seismic data. However, to perform FWI on these data and generate an accurate subsurface model, it is important to determine optimal inversion parameters among (Vp, Vs, ρ), (λ, μ, ρ), and (PI, SI) in elastic media. In this study, staggered grid finite difference method was applied to simulate OBS survey. As in inversion, l2-norm was set as objective function. Further, the accurate computation of gradient direction was performed using the back-propagation technique and its scaling was done using the Pseudo-hessian matrix.In acoustic media, only Vp is used as the inversion parameter. In contrast, various sets of parameters, such as (Vp, Vs, ρ) and (λ, μ, ρ) can be used to define inversion in elastic media. Therefore, it is important to ascertain the parameter that gives the most accurate result for inversion with OBS data set.In this study, we generated Vp and Vs subsurface models by using (λ, μ, ρ) and (Vp, Vs, ρ) as inversion parameters in every iteration, and compared the final two FWI results.This research was supported by the Basic Research Project(17-3312) of the Korea Institute of

  15. EVIDENCE FOR DELAYED MASSIVE STAR FORMATION IN THE M17 PROTO-OB ASSOCIATION

    International Nuclear Information System (INIS)

    Povich, Matthew S.; Whitney, Barbara A.

    2010-01-01

    Through analysis of archival images and photometry from the Spitzer GLIMPSE and MIPSGAL surveys combined with Two Micron All Sky Survey and MSX data, we have identified 488 candidate young stellar objects (YSOs) in the giant molecular cloud M17 SWex, which extends ∼50 pc southwest from the prominent Galactic H II region M17. Our sample includes >200 YSOs with masses >3 M sun that will become B-type stars on the main sequence. Extrapolating over the stellar initial mass function (IMF), we find that M17 SWex contains >1.3 x 10 4 young stars, representing a proto-OB association. The YSO mass function is significantly steeper than the Salpeter IMF, and early O stars are conspicuously absent from M17 SWex. Assuming M17 SWex will form an OB association with a Salpeter IMF, these results reveal the combined effects of (1) more rapid circumstellar disk evolution in more massive YSOs and (2) delayed onset of massive star formation.

  16. Adipokines : rôle dans l’obésité et l’insulino‐résistance

    Directory of Open Access Journals (Sweden)

    Aubert Roberte

    2003-03-01

    Full Text Available Le tissu adipeux longtemps considéré comme un organe de stockage est maintenant reconnu comme un organe endocrine. Cette revue étudie l’action de 3 adipokines sécrétées par le tissu adipeux et impliquées dans le contrôle de l’homéostasie énergétique et l’insulino‐résistance, la leptine, l’adiponectine et la résistine. La découverte de la leptine a permis la compréhension des mécanismes centraux de la prise alimentaire et de la dépense énergétique. L’espoir que la leptine puisse intervenir dans le traitement de l’obésité a été déçu, mais elle joue un rôle important dans l’insulino‐sensibilité. L’adiponectine circulante est diminuée dans l’obésité et la perte pondérale augmente son taux. Elle améliore la sensibilité à l’insuline en agissant sur le métabolisme glucidique et lipidique. Bien que pour le moment le rôle de la résistine soit encore mal défini, les études chez l’animal suggèrent qu’elle soit impliqués dans l’insulino‐résistance. Chez l’homme il n’y a pas de relation entre l’expression de la résistine et l’obésité. On peut donc se demander si la résistine, dans l’espèce humaine, est bien le lien entre obésité et diabète de type 2.

  17. Comparison of the biometric measurements calculated with Zeiss IOL-Master and WaveLight OB-820

    Directory of Open Access Journals (Sweden)

    Labiris G

    2017-04-01

    Full Text Available Georgios Labiris,1,2 Panagiota Ntonti,2 Konstantinos Ntitsos,2 Andreas Katsanos,2 Haris Sideroudi,2 Vasilios Kozobolis1,2 1Department of Ophthalmology, University Hospital of Alexandroupolis, 2Eye Institute of Thrace, Alexandroupolis, Greece Background: The primary objective of this study was to investigate the level of agreement between IOL-Master and OB-820 ocular biometers.Materials and methods: In this prospective randomized case series, we measured the anterior chamber depth (ACD, the axial length (AL, the corneal radii (R1, R2, the ratio of mean corneal radius and spherical equivalent and the corneal astigmatism (cylinder [Cyl] before and after cataract extraction surgery.Results: Significant differences between pre- and postoperative data were observed for ACD for both biometric devices (P<0.01 and Cyl parameter in IOL-Master. Range and 95% limits of agreement (LoA were clinically significantly different for AL parameter pre- and postoperatively and for R2 and radius and spherical equivalent postoperatively (P<0.001. The rest of the parameters presented sufficient 95% LoA, which imply good agreement.Conclusion: In clinical practice, the IOL-master and OB-820 should not be used interchangeably due to discrepancy in the important AL parameter. Both biometers may provide consistent results regarding Cyl, ACD and R1. Keywords: cataract, IOL-Master, OB-820, biometry, level of agreement

  18. Génétique épidémiologique et moléculaire de l’obésité humaine

    Directory of Open Access Journals (Sweden)

    Iron Albert

    2000-01-01

    Full Text Available L’obésité est une pathologie majeure pour plusieurs raisons qu’il est difficile de hiérarchiser. D’abord parce qu’elle est commune, concernant aujourd’hui près d’un individu sur trois dans les pays industrialisés. Ensuite, parce qu’elle est grave en raison des complications nombreuses et sévères, parmi lesquelles on peut citer des cardiopathies, le diabète, l’HTA, des cancers, etc. Enfin, parce que répondant à la définition de maladie multifactorielle résultant de l’interaction entre des facteurs héréditaires et des facteurs environnementaux, sa connaissance a beaucoup progressé ces dernières années, notamment grâce à l’apport de la génétique moléculaire. À l’échelon individuel et d’une manière simple, on peut définir l’obésité comme résultant d’un excès de tissu adipeux qui va se traduire par un poids élevé par rapport à ce qu’on peut considérer comme étant un poids idéal donné par la formule de Lorentz : Poids idéal (kg = Taille (cm – 100 – [Taille (cm – 150]/4 (homme ou 2,5 (femme Sous l’angle épidémiologique, c’est-à-dire à l’échelle des populations, l’obésité sera définie à partir de critères de nature anthropologique utilisés aussi en clinique pour typer le patient obèse. On peut prendre en compte le rapport du tour de hanche sur le tour de taille (qui permet de définir une obésité de type androïde ou gynoïde selon que ce rapport est supérieur ou inférieur à 0,85 ou la mesure de l’adiposité évaluée par l’appréciation des plis cutanés (en particulier le pli tricipital ou surtout l’indice de corpulence qui est le critère majeur des épidémiologistes pour l’étude de l’obésité chez l’adulte. Cet indice est la référence pour la définition de l’obésité chez l’adulte ; il est aussi appelé indice de masse corporelle (IMC ou indice de Quetelet ; il exprime le rapport du poids (en kg au carré de la taille (en m

  19. Conversion of chlorinated propanes by Methylosinus trichosporium OB3b expressing soluble methane monooxygenase

    NARCIS (Netherlands)

    Bosma, T.; Janssen, D.B.

    Chlorinated propanes are important pollutants that may show persistent behaviour in the environment. The biotransformation of 1-chloropropane, 1,2-dichloropropane, 1,3-dichloropropane and 1,2,3-trichloropropane was studied using resting cell suspensions of Methylosinus trichosporium OB3b expressing

  20. A CANDIDATE FOR THE MOST LUMINOUS OB ASSOCIATION IN THE GALAXY

    International Nuclear Information System (INIS)

    Rahman, Mubdi; Matzner, Christopher; Moon, Dae-Sik

    2011-01-01

    The Milky Way harbors giant H II regions, which may be powered by star complexes more luminous than any known Galactic OB association. Being across the disk of the Galaxy, however, these brightest associations are severely extinguished and confused. We present a search for one such association toward the most luminous H II region in the recent catalog by Murray and Rahman, which, at ∼9.7 kpc, has a recombination rate of ∼7 x 10 51 s -1 . Prior searches have identified only small-scale clustering around the rim of this shell-like region, but the primary association has not previously been identified. We apply a near-infrared color selection and find an overdensity of point sources toward its southern central part. The colors and magnitudes of these excess sources are consistent with O- and early B-type stars at extinctions 0.96 K < 1.2, and they are sufficiently numerous (406 ± 102 after subtraction of field sources) to ionize the surrounding H II region, making this a candidate for the most luminous OB association in the Galaxy. We reject an alternate theory, in which the apparent excess is caused by localized extinction, as inconsistent with source demographics.

  1. Distribution of the P2X2 receptor and chemical coding in ileal enteric neurons of obese male mice (ob/ob)

    Science.gov (United States)

    Mizuno, Márcia Sanae; Crisma, Amanda Rabello; Borelli, Primavera; Schäfer, Bárbara Tavares; Silveira, Mariana Póvoa; Castelucci, Patricia

    2014-01-01

    AIM: To investigate the colocalization, density and profile of neuronal areas of enteric neurons in the ileum of male obese mice. METHODS: The small intestinal samples of male mice in an obese group (OG) (C57BL/6J ob/ob) and a control group (CG) (+/+) were used. The tissues were analyzed using a double immunostaining technique for immunoreactivity (ir) of the P2X2 receptor, nitric oxide synthase (NOS), choline acetyl transferase (ChAT) and calretinin (Calr). Also, we investigated the density and profile of neuronal areas of the NOS-, ChAT- and Calr-ir neurons in the myenteric plexus. Myenteric neurons were labeled using an NADH-diaphorase histochemical staining method. RESULTS: The analysis demonstrated that the P2X2 receptor was expressed in the cytoplasm and in the nuclear and cytoplasmic membranes only in the CG. Neuronal density values (neuron/cm2) decreased 31% (CG: 6579 ± 837; OG: 4556 ± 407) and 16.5% (CG: 7796 ± 528; OG: 6513 ± 610) in the NOS-ir and calretinin-ir neurons in the OG, respectively (P < 0.05). Density of ChAT-ir (CG: 6200 ± 310; OG: 8125 ± 749) neurons significantly increased 31% in the OG (P < 0.05). Neuron size studies demonstrated that NOS, ChAT, and Calr-ir neurons did not differ significantly between the CG and OG groups. The examination of NADH-diaphorase-positive myenteric neurons revealed an overall similarity between the OG and CG. CONCLUSION: Obesity may exert its effects by promoting a decrease in P2X2 receptor expression and modifications in the density of the NOS-ir, ChAT-ir and CalR-ir myenteric neurons. PMID:25320527

  2. Not all stars form in clusters - measuring the kinematics of OB associations with Gaia

    Science.gov (United States)

    Ward, Jacob L.; Kruijssen, J. M. Diederik

    2018-04-01

    It is often stated that star clusters are the fundamental units of star formation and that most (if not all) stars form in dense stellar clusters. In this monolithic formation scenario, low-density OB associations are formed from the expansion of gravitationally bound clusters following gas expulsion due to stellar feedback. N-body simulations of this process show that OB associations formed this way retain signs of expansion and elevated radial anisotropy over tens of Myr. However, recent theoretical and observational studies suggest that star formation is a hierarchical process, following the fractal nature of natal molecular clouds and allowing the formation of large-scale associations in situ. We distinguish between these two scenarios by characterizing the kinematics of OB associations using the Tycho-Gaia Astrometric Solution catalogue. To this end, we quantify four key kinematic diagnostics: the number ratio of stars with positive radial velocities to those with negative radial velocities, the median radial velocity, the median radial velocity normalized by the tangential velocity, and the radial anisotropy parameter. Each quantity presents a useful diagnostic of whether the association was more compact in the past. We compare these diagnostics to models representing random motion and the expanding products of monolithic cluster formation. None of these diagnostics show evidence of expansion, either from a single cluster or multiple clusters, and the observed kinematics are better represented by a random velocity distribution. This result favours the hierarchical star formation model in which a minority of stars forms in bound clusters and large-scale, hierarchically structured associations are formed in situ.

  3. Methanobactin from Methylocystis sp. strain SB2 affects gene expression and methane monooxygenase activity in Methylosinus trichosporium OB3b.

    Science.gov (United States)

    Farhan Ul-Haque, Muhammad; Kalidass, Bhagyalakshmi; Vorobev, Alexey; Baral, Bipin S; DiSpirito, Alan A; Semrau, Jeremy D

    2015-04-01

    Methanotrophs can express a cytoplasmic (soluble) methane monooxygenase (sMMO) or membrane-bound (particulate) methane monooxygenase (pMMO). Expression of these MMOs is strongly regulated by the availability of copper. Many methanotrophs have been found to synthesize a novel compound, methanobactin (Mb), that is responsible for the uptake of copper, and methanobactin produced by Methylosinus trichosporium OB3b plays a key role in controlling expression of MMO genes in this strain. As all known forms of methanobactin are structurally similar, it was hypothesized that methanobactin from one methanotroph may alter gene expression in another. When Methylosinus trichosporium OB3b was grown in the presence of 1 μM CuCl2, expression of mmoX, encoding a subunit of the hydroxylase component of sMMO, was very low. mmoX expression increased, however, when methanobactin from Methylocystis sp. strain SB2 (SB2-Mb) was added, as did whole-cell sMMO activity, but there was no significant change in the amount of copper associated with M. trichosporium OB3b. If M. trichosporium OB3b was grown in the absence of CuCl2, the mmoX expression level was high but decreased by several orders of magnitude if copper prebound to SB2-Mb (Cu-SB2-Mb) was added, and biomass-associated copper was increased. Exposure of Methylosinus trichosporium OB3b to SB2-Mb had no effect on expression of mbnA, encoding the polypeptide precursor of methanobactin in either the presence or absence of CuCl2. mbnA expression, however, was reduced when Cu-SB2-Mb was added in both the absence and presence of CuCl2. These data suggest that methanobactin acts as a general signaling molecule in methanotrophs and that methanobactin "piracy" may be commonplace. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  4. Evaluating the probiotic and therapeutic potentials of Saccharomyces cerevisiae strain (OBS2) isolated from fermented nectar of toddy palm.

    Science.gov (United States)

    Srinivas, Banoth; Rani, Ganapathiwar Swarupa; Kumar, Bhukya Kiran; Chandrasekhar, Banoth; Krishna, Kommalapati Vamsi; Devi, Tangutur Anjana; Bhima, Bhukya

    2017-12-01

    The purpose of this study is to evaluate the probiotic characteristics of 15 yeast strains isolated from nectar of toddy palm. Initially, the collected samples were inoculated on yeast extract peptone dextrose agar plates and the colonies so obtained were culturally and morphologically characterized. Commercial probiotic yeast, Saccharomyces boulardii served as the control in these experiments. Of the 15 yeast strains, the isolates that were resistant to antibiotics and worked synergistically with other cultures were considered for further evaluation. Selected isolates were evaluated in vitro for tolerance to simulated gastrointestinal conditions such as temperature, pH, bile and gastric juice. Further the yeast isolates were evaluated for their pathogenicity and adherence to intestinal epithelial cells. The 2 yeast isolates with efficient probiotic properties were finally characterized by sequencing their 5.8 S rRNA and partial sequences of internal transcribed spacer 1 and 2. The sequences were BLAST searched in the National Center for Biotechnology Information, nucleic acid database for sequence similarity of organisms and phylogenetic evolutionary analysis was carried out. Based on maximum similarity of basic local alignment search tool results, organisms were characterized as Pichia kudriavzevii OBS1 (100%) and Saccharomyces cerevisiae OBS2 (96%) and sequences were finally deposited in the GenBank data library. Among these two isolates, S. cerevisiae OBS2 displayed slight/moderate antioxidant and anticancer property. Hence, strain OBS2 can be utilized and explored as a potential probiotic for therapeutic applications.

  5. Leptin receptor (Ob-R) mRNA expression and serum leptin concentration in patients with colorectal and metastatic colorectal cancer

    Energy Technology Data Exchange (ETDEWEB)

    Erkasap, N.; Ozkurt, M. [Department of Physiology, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Erkasap, S.; Yasar, F. [Department of General Surgery, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Uzuner, K. [Department of Physiology, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Ihtiyar, E. [Department of General Surgery, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Uslu, S.; Kara, M. [Department of Biochemistry, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey); Bolluk, O. [Department of Biostatistics, Osmangazi University Medical Faculty, Meselik, Eskisehir (Turkey)

    2013-03-19

    The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases) and metastatic colon (13 cases) cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA) and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR) for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis.

  6. Leptin receptor (Ob-R) mRNA expression and serum leptin concentration in patients with colorectal and metastatic colorectal cancer

    International Nuclear Information System (INIS)

    Erkasap, N.; Ozkurt, M.; Erkasap, S.; Yasar, F.; Uzuner, K.; Ihtiyar, E.; Uslu, S.; Kara, M.; Bolluk, O.

    2013-01-01

    The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases) and metastatic colon (13 cases) cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA) and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR) for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis

  7. Leptin receptor (Ob-R mRNA expression and serum leptin concentration in patients with colorectal and metastatic colorectal cancer

    Directory of Open Access Journals (Sweden)

    N. Erkasap

    Full Text Available The objective of the present study was to investigate the effect of leptin on the progression of colorectal carcinoma to metastatic disease by analyzing the serum leptin concentration and Ob-R gene expression in colon cancer tissues. Tissue samples were obtained from 31 patients who underwent surgical resection for colon (18 cases and metastatic colon (13 cases cancer. Serum leptin concentration was determined by an enzyme-linked immunosorbent assay (ELISA and Ob-R mRNA expression by real-time polymerase chain reaction (RT-PCR for both groups. ELISA data were analyzed by the Student t-test and RT-PCR data were analyzed by the Mann-Whitney U-test. RT-PCR results demonstrated that mRNA expression of Ob-R in human metastatic colorectal cancer was higher than in local colorectal cancer tissues. On the other hand, mean serum leptin concentration was significantly higher in local colorectal cancer patients compared to patients with metastatic colorectal cancer. The results of the present study suggest a role for leptin in the progression of colon cancer to metastatic disease without weight loss. In other words, significantly increased Ob-R mRNA expression and decreased serum leptin concentration in patients with metastatic colon cancer indicate that sensitization to leptin activity may be a major indicator of metastasis to the colon tissue and the determination of leptin concentration and leptin gene expression may be used to aid the diagnosis.

  8. Hard X-ray Flux from Low-Mass Stars in the Cygnus OB2 Association

    Science.gov (United States)

    Caramazza, M.; Drake, J. J.; Micela, G.; Flaccomio, E.

    2009-05-01

    We investigate the X-ray emission in the 20-40 keV band expected from the flaring low-mass stellar population in Cygnus OB2 assuming that the observed soft X-ray emission is due to a superposition of flares and that the ratio of hard X-ray to soft X-ray emission is described by a scaling found for solar flares by Isola and co-workers. We estimate a low-mass stellar hard X-ray flux in the 20-40 keV band in the range ~7×1031-7×1033 erg/s and speculate the limit of this values. Hard X-ray emission could lie at a level not much below the current observed flux upper limits for Cygnus OB2. Simbol-X, with its broad energy band (10-100 keV) and its sensitivity should be able to detect this emission and would provide insights into the hard X-ray production of flares on pre-main sequence stars.

  9. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data

    Science.gov (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.

    2000-01-01

    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  10. Kinetics of Chlorinated Hydrocarbon Degradation by Methylosinus trichosporium OB3b and Toxicity of Trichloroethylene

    NARCIS (Netherlands)

    Oldenhuis, Roelof; Oedzes, Johannes Y.; Waarde, Jacob J. van der; Janssen, Dick B.

    The kinetics of the degradation of trichloroethylene (TCE) and seven other chlorinated aliphatic hydrocarbons by Methylosinus trichosporium OB3b were studied. All experiments were performed with cells grown under copper stress and thus expressing soluble methane monooxygenase. Compounds that were

  11. Degradation of Chlorinated Aliphatic Hydrocarbons by Methylosinus trichosporium OB3b Expressing Soluble Methane Monooxygenase

    NARCIS (Netherlands)

    Oldenhuis, R.; Vink, Ruud L.J.M.; Janssen, D. B.; Witholt, B.

    1989-01-01

    Degradation of trichloroethylene (TCE) by the methanotrophic bacterium Methylosinus trichosporium OB3b was studied by using cells grown in continuous culture. TCE degradation was a strictly cometabolic process, requiring the presence of a cosubstrate, preferably formate, and oxygen. M. trichosporium

  12. Expressão do gene da leptina e seu receptor Ob-Rb no parênquima mamário de novilhas leiteiras Leptin and leptin receptor Ob-Rb gene expression in mammary parenchyma of dairy heifers

    Directory of Open Access Journals (Sweden)

    Betina Joyce Lew

    2012-05-01

    Full Text Available Objetivou-se com este trabalho avaliar os efeitos de uma dieta de alto nível de energia e proteína combinada com a aplicação de bST no perfil de expressão dos genes da leptina e de seu receptor Ob-Rb no parênquima mamário de novilhas leiteiras. Foram utilizadas amostras de parênquima mamário de 32 novilhas holandesas distribuídas aleatoriamente em quatro tratamentos (n=8: dieta com alto ou baixo teor de energia e proteína combinada ou não com a aplicação de bST. O delineamento utilizado foi em blocos casualizados com arranjo de tratamentos em esquema fatorial 2 × 2. A extração do RNA total das amostras de tecido foi feita e o nível de expressão gênica foi analisado por qRT-PCR utilizando-se o gene da glicuronidase β como controle, pelo método 2-ΔΔCt. Animais que receberam a dieta com alto conteúdo de energia e proteína apresentaram maior expressão de mRNA de leptina, com aumento de 56%, e menor expressão de mRNA do receptor Ob-Rb, com redução de 18%. Por outro lado, a aplicação de bST resultou em diminuição da expressão do mRNA de leptina e do receptor Ob-Rb em 74% e 23%, respectivamente. Não houve interação entre dieta e aplicação de bST. O aumento na expressão de leptina pode explicar, ao menos em parte, os efeitos negativos da dieta de alta energia e proteína, oferecida no período pré-púbere, sobre a produção de leite de novilhas leiteiras.The objective of this study was to examine the effects of a diet with high level of energy and protein, combined with bST injections, on leptin and leptin-receptor (Ob-Rb gene expression profile in the mammary parenchyma of dairy heifers. Mammary parenchyma samples from 32 Holstein heifers, randomly assigned to one of four treatments (n=8, were utilized: high or low energy and protein diet, with or without bST injection. The experiment was designed in randomized blocks and arranged in a 2 × 2 factorial arrangement. Total RNA was extracted from tissue samples

  13. ObsPack: a framework for the preparation, delivery, and attribution of atmospheric greenhouse gas data

    NARCIS (Netherlands)

    Masarie, K. A.; Peters, W.; Jacobson, A. R.; Tans, P. P.

    2014-01-01

    Observation Package (ObsPack) is a framework designed to bring together atmospheric greenhouse gas observations from a variety of sampling platforms, prepare them with specific applications in mind, and package and distribute them in a self-consistent and well-documented product. Data products

  14. ObsPack: a framework for the preparation, delivery, and attribution of atmospheric greenhouse gas measurements

    NARCIS (Netherlands)

    Masarie, K. A.; Peters, W.; Jacobson, A. R.; Tans, P. P.

    2014-01-01

    Observation Package (ObsPack) is a framework designed to bring together atmospheric greenhouse gas observations from a variety of sampling platforms, prepare them with specific applications in mind, and package and distribute them in a self-consistent and well-documented product. Data products

  15. Release and transport of artificial radionuclides from nuclear weapons related activities in the Ob River, Siberia over the course of the nuclear age

    International Nuclear Information System (INIS)

    Sayles, F.L.; Kenna, T.C.; Livingston, H.D.

    1999-01-01

    Studies of sediment cores from lakes on the flood plain of the Ob River, Siberia have been used to develop a history of the release, transport, and deposition of artificial radionuclides related to the development and testing of nuclear weapons over the duration of the nuclear age (∼1950 to the present) in this major Arctic river system. The Ob is of particular importance in this regard as two of the former Soviet Union's major weapons production plants, Mayak and Tomsk-7, and the Semipalatinsk test site are located within the Ob drainage basin. Accidents and intentional releases of radionuclides at both plants have been substantial, raising the issue of transport throughout this extensive river system as well as delivery to the Arctic Ocean. Our studies have included determining sediment profiles of 239,240 Pu, 137 Cs, and the natural nuclide 210 Pb and its parent 226 Ra in a number of cores from the Ob delta, as well as analysis of 239 Pu, 240 Pu, and 237 Np. The latter provide sensitive measures of the presence of non-fallout materials derived from weapons production activities

  16. New Partner Recruitment to Rural Versus Urban Ob-Gyn Practices

    Directory of Open Access Journals (Sweden)

    Michael F. Fialkow

    2017-09-01

    Full Text Available Purpose: The purpose of this pilot study was to investigate the recruitment efforts of practicing obstetrics and gynecology (ob-gyns from rural and urban practices. Method: The authors surveyed practicing ob-gyns from 5 states in the Pacific Northwest in 2016 about their background, practice setting, practice profile, partner recruitment, and retention. Results: Seventy-three patients completed the study (53.2% response rate. Thirty-seven percent of respondents work in an urban practice and 43% have a rural practice, with the remainder in a suburban setting. A majority of the respondents attempted to recruit a new partner in the past 5 years. Respondents were most interested in experience and diversity in new recruits. Urban respondents, however, were more interested in hiring those with specialized skills (χ 2 = 7.842, P = .02 than rural providers who were more interested in partners familiar with their community (χ 2 = 7.153, P = .03. Reasons most often cited to leave their practice were reimbursement, limited social/marital options, and workload, other than rural providers who more often also cited lack of access to specialty care (χ 2 = 13.256, P = .001. Rural providers were more likely to cite marital and family status as an advantage to recruitment, whereas urban and suburban providers were more often neutral. Conclusions: Reduced access to care has led to significant health disparities for women living in rural communities. Understanding which providers are most likely to be successful in these settings might help preserve access as our health-care systems evolves.

  17. Analysis of interstellar extinction towards the hypergiant Cyg OB2 No. 12

    Science.gov (United States)

    Maryeva, O. V.; Chentsov, E. L.; Goranskij, V. P.; Karpov, S. V.

    The Cyg OB2 stellar association hosts an entire zoo of unique objects, and among them -- an enigmatic star Cyg OB2 No. 12 (Schulte 12, MT 304). MT 304 is enigmatic not only due to its highest luminosity (according to various estimates, it is one of the brightest stars in the Galaxy), but also because its reddening is anomalously large, greater than the mean reddening in the association. To explain the nature of anomalous reddening (AV≃ 10 mag) of MT 304, we carried out spectrophotometric observations of 25 stars located in its vicinity. We mapped interstellar extinction within the 2.5 arcmin radius and found it to increase towards MT 304. According to our results, the two most reddened stars in the association after MT 304 are J203240.35+411420.1 and J203239.90+411436.2, both located about 15 arcsec from it. Interstellar extinction AV towards these stars is about 9 mag. Our results favor the hypothesis of the circumstellar nature of reddening excess. In the second part of the paper we present the results of our modeling of MT 282 (B1 IV) and MT 343 (B1 V), which belong to the older population of the association and have ages greater than 10 Myr.

  18. Effect of chlorinated ethene conversion on viability and activity of Methylosinus trichosporium OB3b

    NARCIS (Netherlands)

    van Hylckama Vlieg, Johan E.T.; Koning, Wim de; Janssen, Dick B.

    1997-01-01

    The effect of transformation of chlorinated ethenes on the cell viability of Methylosinus trichosporium OB3b was investigated. A comparison of the loss of viability with the decrease in transformation rates shelved that for the monooxygenase-mediated transformation of all chlorinated ethenes except

  19. Dropping Probability Reduction in OBS Networks: A Simple Approach

    KAUST Repository

    Elrasad, Amr

    2016-08-01

    In this paper, we propose and derive a slotted-time model for analyzing the burst blocking probability in Optical Burst Switched (OBS) networks. We evaluated the immediate and delayed signaling reservation schemes. The proposed model compares the performance of both just-in-time (JIT) and just-enough-time (JET) signaling protocols associated with of void/non-void filling link scheduling schemes. It also considers none and limited range wavelength conversions scenarios. Our model is distinguished by being adaptable to different offset-time and burst length distributions. We observed that applying a limited range of wavelength conversion, burst blocking probability is reduced by several orders of magnitudes and yields a better burst delivery ratio compared with full wavelength conversion.

  20. A Multi-Fiber Spectroscopic Search for Low-mass Young Stars in Orion OB1

    Science.gov (United States)

    Loerincs, Jacqueline; Briceno, Cesar; Calvet, Nuria; Mateo, Mario L.; Hernandez, Jesus

    2017-01-01

    We present here results of a low resolution spectroscopic followup of candidate low-mass pre-main sequence stars in the Orion OB1 association. Our targets were selected from the CIDA Variability Survey of Orion (CVSO), and we used the Michigan/Magellan Fiber Spectrograph (M2FS) on the Magellan Clay 6.5m telescope to obtain spectra of 500 candidate T Tauri stars distributed in seven 0.5 deg diameter fields, adding to a total area of ~5.5 deg2. We identify young stars by looking at the distinctive Hα 6563 Å emission and Lithium Li I 6707 Å absorption features characteristic of young low mass pre-main sequence stars. Furthermore, by measuring the strength of their Hα emission lines, confirmed T Tauri stars can be classified as either Classical T Tauris (CTTS) or Weak-line T Tauris (WTTS), which give indication of whether the star is actively accreting material from a gas and dust disk surrounding the star, which may be the precursor of a planetary system. We confirm a total of 90 T Tauri stars, of which 50% are newly identified young members of Orion; out of the 49 new detections,15 are accreting CTTS, and of these all but one are found in the OB1b sub-region. This result is in line with our previous findings that this region is much younger than the more extended Orion OB1a sub-association. The M2FS results add to our growing census of young stars in Orion, that is allowing us to characterize in a systematic and consistent way the distribution of stellar ages across the entire complex, in order to building a complete picture of star formation in this, one of nearest most active sites of star birth.

  1. An anomalous extinction law in the Cep OB3b young cluster: Evidence for dust processing during gas dispersal

    International Nuclear Information System (INIS)

    Allen, Thomas S.; Prchlik, Jakub J.; Megeath, S. Thomas; Gutermuth, Robert A.; Pipher, Judith L.; Naylor, Tim; Jeffries, R. D.

    2014-01-01

    We determine the extinction law through Cep OB3b, a young cluster of 3000 stars undergoing gas dispersal. The extinction is measured toward 76 background K giants identified with MMT/Hectospec spectra. Color excess ratios were determined toward each of the giants using V and R photometry from the literature, g, r, i, and z photometry from the Sloan Digital Sky Survey and J, H, and K s photometry from the Two Micron All Sky Survey. These color excess ratios were then used to construct the extinction law through the dusty material associated with Cep OB3b. The extinction law through Cep OB3b is intermediate between the R V = 3.1 and R V = 5 laws commonly used for the diffuse atomic interstellar medium and dense molecular clouds, respectively. The dependence of the extinction law on line-of-sight A V is investigated and we find the extinction law becomes shallower for regions with A V > 2.5 mag. We speculate that the intermediate dust law results from dust processing during the dispersal of the molecular cloud by the cluster.

  2. An anomalous extinction law in the Cep OB3b young cluster: Evidence for dust processing during gas dispersal

    Energy Technology Data Exchange (ETDEWEB)

    Allen, Thomas S.; Prchlik, Jakub J.; Megeath, S. Thomas [University of Toledo, Ritter Astrophysical Observatory, Department of Physics and Astronomy, Toledo, OH 43606 (United States); Gutermuth, Robert A. [Five College Astronomy Department, Smith College, Northampton, MA 01063 (United States); Pipher, Judith L. [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627 (United States); Naylor, Tim [School of Physics, University of Exeter, Exeter, UK EX4 4QL (United Kingdom); Jeffries, R. D. [Astrophysics Group, School of Physical and Geographical Sciences, Keele University, Keele, Staffordshire, UK ST5 5BG (United Kingdom)

    2014-05-10

    We determine the extinction law through Cep OB3b, a young cluster of 3000 stars undergoing gas dispersal. The extinction is measured toward 76 background K giants identified with MMT/Hectospec spectra. Color excess ratios were determined toward each of the giants using V and R photometry from the literature, g, r, i, and z photometry from the Sloan Digital Sky Survey and J, H, and K{sub s} photometry from the Two Micron All Sky Survey. These color excess ratios were then used to construct the extinction law through the dusty material associated with Cep OB3b. The extinction law through Cep OB3b is intermediate between the R{sub V} = 3.1 and R{sub V} = 5 laws commonly used for the diffuse atomic interstellar medium and dense molecular clouds, respectively. The dependence of the extinction law on line-of-sight A{sub V} is investigated and we find the extinction law becomes shallower for regions with A{sub V} > 2.5 mag. We speculate that the intermediate dust law results from dust processing during the dispersal of the molecular cloud by the cluster.

  3. THE MASSIVE STAR-FORMING REGION CYGNUS OB2. II. INTEGRATED STELLAR PROPERTIES AND THE STAR FORMATION HISTORY

    International Nuclear Information System (INIS)

    Wright, N. J.; Drake, J. J.; Drew, J. E.; Vink, J. S.

    2010-01-01

    Cygnus OB2 is the nearest example of a massive star-forming region (SFR), containing over 50 O-type stars and hundreds of B-type stars. We have analyzed the properties of young stars in two fields in Cyg OB2 using the recently published deep catalog of Chandra X-ray point sources with complementary optical and near-IR photometry. Our sample is complete to ∼1 M sun (excluding A- and B-type stars that do not emit X-rays), making this the deepest study of the stellar properties and star formation history in Cyg OB2 to date. From Siess et al. isochrone fits to the near-IR color-magnitude diagram, we derive ages of 3.5 +0.75 -1.0 and 5.25 +1.5 -1.0 Myr for sources in the two fields, both with considerable spreads around the pre-main-sequence isochrones. The presence of a stellar population somewhat older than the present-day O-type stars, also fits in with the low fraction of sources with inner circumstellar disks (as traced by the K-band excess) that we find to be very low, but appropriate for a population of age ∼5 Myr. We also find that the region lacks a population of highly embedded sources that is often observed in young SFRs, suggesting star formation in the vicinity has declined. We measure the stellar mass functions (MFs) in this limit and find a power-law slope of Γ = -1.09 ± 0.13, in good agreement with the global mean value estimated by Kroupa. A steepening of the slope at higher masses is observed and suggested as due to the presence of the previous generation of stars that have lost their most massive members. Finally, combining our MF and an estimate of the radial density profile of the association suggests a total mass of Cyg OB2 of ∼3 x 10 4 M sun , similar to that of many of our Galaxy's most massive SFRs.

  4. WNIN/GR-Ob - an insulin-resistant obese rat model from inbred WNIN strain.

    Science.gov (United States)

    Harishankar, N; Vajreswari, A; Giridharan, N V

    2011-09-01

    WNIN/GR-Ob is a mutant obese rat strain with impaired glucose tolerance (IGT) developed at the National Institute of Nutrition (NIN), Hyderabad, India, from the existing 80 year old Wistar rat (WNIN) stock colony. The data presented here pertain to its obese nature along with IGT trait as evidenced by physical, physiological and biochemical parameters. The study also explains its existence, in three phenotypes: homozygous lean (+/+), heterozygous carrier (+/-) and homozygous obese (-/-). Thirty animals (15 males and 15 females) from each phenotype (+/+, +/-, -/-) and 24 lean and obese (6 males and 6 females) rats were taken for growth and food intake studies respectively. Twelve adult rats from each phenotype were taken for body composition measurement by total body electrical conductivity (TOBEC); 12 rats of both genders from each phenotype at different ages were taken for clinical chemistry parameters. Physiological indices of insulin resistance were calculated according to the homeostasis model assessment for insulin resistance (HOMA-IR) and also by studying U¹⁴C 2-deoxy glucose uptake (2DG). WNINGR-Ob mutants had high growth, hyperphagia, polydipsia, polyurea, glycosuria, and significantly lower lean body mass, higher fat mass as compared with carrier and lean rats. These mutants, at 50 days of age displayed abnormal response to glucose load (IGT), hyperinsulinaemia, hypertriglyceridaemia, hypercholesterolaemia and hyperleptinaemia. Basal and insulin-stimulated glucose uptakes by diaphragm were significantly decreased in obese rats as compared with lean rats. Obese rats of the designated WNIN/GR-Ob strain showed obesity with IGT, as adjudged by physical, physiological and biochemical indices. These indices varied among the three phenotypes, being lowest in lean, highest in obese and intermediate in carrier phenotypes thereby suggesting that obesity is inherited as autosomal incomplete dominant trait in this strain. This mutant obese rat model is easy to

  5. [Modeling of Processes of Migration and Accumulation of Radionuclides in Freshwater Ecosystems by the Example of the Samson, Lev, Vandras Rivers Related to the Ob-Irtysh River Basin].

    Science.gov (United States)

    Trapeznikov, A V; Korzhavin, A V; Trapeznikova, V N; Nikolkin, V N

    2016-01-01

    Mathematical models of horizontal distribution and migration of radionuclides are presented in water and floodplain soils of the Samson-Lev-Vandras river system related to the Ob-Irtysh river basin. Integral inventory of radionuclides in the main components of the river ecosystems is calculated. The estimated annual discharge of radionuclides from the Vandras river to the Great Salym river is given. The effect of the removal of man-made radionuclides in the Samson, Lev, Vandras rivers on radioactive contamination of the Ob-Irtysh river system is shown in comparison with the Techa river, that also belongs to the Ob-Irtysh river basin. Despite the presence of an additional radioactive contamination of the Samson floodplain, the transfer of radioactive substances in the Samson, Lev, Vandras rivers has a much smaller impact on the contamination of the Ob-Irtysh river system, compared to the Techa river, prone to a large-scale radioactive contamination.

  6. Analytical model of a burst assembly algorithm for the VBR in the OBS networks

    International Nuclear Information System (INIS)

    Shargabi, M.A.A.; Mellah, H.; Abid, A.

    2008-01-01

    This paper presents a proposed analytical model for the number of bursts aggregated in a period of time in OBS networks. The model considers the case of VBR traffic with two different sending rates, which are SCR and PCR. The model is validated using extensive simulations. Where results from simulations are in total agreement with the results obtained by the proposed model. (author)

  7. La binaria LSS 3074 y su entorno: ?`una nueva asociación OB?

    Science.gov (United States)

    Niemela, V.; Morrell, N.; Corti, M.

    En este trabajo presentamos un nuevo análisis orbital de LSS~3074, junto con tipos espectrales y velocidades radiales de estrellas que podrían constituir con ella una nueva asociación OB. La estrella O4f LSS3074 fue descubierta como binaria espectroscópica de corto período y líneas dobles por Morrell & Niemela (1990, ASP Conf. Ser. 7, 57). Posteriormente, Haefner et~al.(1994, IBVS 3969) encontraron variaciones fotométricas, estimando una inclinación orbital entre 50o y 55o. Teniendo en cuenta la importancia de obtener valores empíricos para las masas de estrellas O tempranas, y considerando la gran dispersión existente entre los valores observados y su discrepancia con los predichos por los modelos teóricos, hemos obtenido nuevas observaciones espectroscópicas de este sistema, con el propósito de mejorar los elementos orbitales derivados en la solución preliminar. Además, como las estrellas O tempranas suelen formar parte de cúmulos y asociaciones OB, hemos llevado a cabo una investigación espectroscópica de varias estrellas tempranas que podrían estar físicamente relacionadas con LSS~3074.

  8. Triggering risk factors of the burnout syndrome in OB/GYN physicians from a reference public university of Brazil.

    Science.gov (United States)

    Ferreira Bortoletti, Fátima; Teresa Benevides-Pereira, Ana Maria; Vasconcellos, Esdras Guerreiro; Siqueira, José Oliveira; Araujo Júnior, Edward; Nardozza, Luciano Marcondes Machado; Sebastiani, Ricardo Werner; Moron, Antonio Fernandes

    2012-01-01

    Objective. To identify the risk factors to the development of Burnout Syndrome in Ob/Gyn Brazilian physicians in four dimensions: emotional exhaustion (EE), professional repression (PR), dehumanization (De), and emotional distancing (EmD). Methods. A prospective cross-sectional study was realized with 48 Ob/Gyn physicians (12 lecturers, 12 attending physicians, 12 medical residents, and 12 graduate students) from Department of Obstetrics, São Paulo Federal University (UNIFESP). We used a sociodemographic questionnaire focusing on the activities (administrative, educational, healthcare, and research). We applied a Burnout Syndrome Inventory (BSI) composed of two parts: triggering factors (ISB1) and the Burnout Syndrome (ISB2). The ISB1 is composed of two scales: positive organizational conditions (POC) and negative organizational conditions (NOC). The ISB2 is composed of four scales: EE, PR, De, and EmD. Results. We observed a rate below and above average to POC and NOC, respectively. The dimensions recorded a level above average to EE, an index at the upper limit of the average to De, a median index to EmD, and a median index to PR. Conclusions. The Ob/Gyn physicians are in an area of vulnerability for the development of Burnout Syndrome due to the high level of EE and De, associated with a median index of PR. The high rate of NOC contributes to the triggering of this scenery.

  9. On the Binary Nature of Massive Blue Hypergiants: High-resolution X-Ray Spectroscopy Suggests That Cyg OB2 12 is a Colliding Wind Binary

    Energy Technology Data Exchange (ETDEWEB)

    Oskinova, L. M.; Hamann, W.-R.; Shenar, T.; Sander, A. A. C.; Todt, H.; Hainich, R. [Institute for Physics and Astronomy, University Potsdam, D-14476 Potsdam (Germany); Huenemoerder, D. P. [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar St., Cambridge, MA 02139 (United States); Ignace, R., E-mail: lida@astro.physik.uni-potsdam.de [Department of Physics and Astronomy, East Tennessee State University, Johnson City, TN 37663 (United States)

    2017-08-10

    The blue hypergiant Cyg OB2 12 (B3Ia{sup +}) is a representative member of the class of very massive stars in a poorly understood evolutionary stage. We obtained its high-resolution X-ray spectrum using the Chandra observatory. PoWR model atmospheres were calculated to provide realistic wind opacities and to establish the wind density structure. We find that collisional de-excitation is the dominant mechanism depopulating the metastable upper levels of the forbidden lines of the He-like ions Si xiv and Mg xii. Comparison between the model and observations reveals that X-ray emission is produced in a dense plasma, which could reside only at the photosphere or in a colliding wind zone between binary components. The observed X-ray spectra are well-fitted by thermal plasma models, with average temperatures in excess of 10 MK. The wind speed in Cyg OB2 12 is not high enough to power such high temperatures, but the collision of two winds in a binary system can be sufficient. We used archival data to investigate the X-ray properties of other blue hypergiants. In general, stars of this class are not detected as X-ray sources. We suggest that our new Chandra observations of Cyg OB2 12 can be best explained if Cyg OB2 12 is a colliding wind binary possessing a late O-type companion. This makes Cyg OB2 12 only the second binary system among the 16 known Galactic hypergiants. This low binary fraction indicates that the blue hypergiants are likely products of massive binary evolution during which they either accreted a significant amount of mass or already merged with their companions.

  10. MUG-OBS - Multiparameter Geophysical Ocean Bottom System : a new instrumental approach to monitor earthquakes.

    Science.gov (United States)

    hello, yann; Charvis, Philippe; Yegikyan, Manuk; verfaillie, Romain; Rivet, Diane

    2016-04-01

    Real time monitoring of seismic activity is a major issue for early warning of earthquakes and tsunamis. It can be done using regional scale wired nodes, such as Neptune in Canada and in the U.S, or DONET in Japan. Another approach to monitor seismic activity at sea is to deploying repeatedly OBS array like during the amphibious Cascadia Initiative (four time 1-year deployments), the Japanese Pacific Array (broadband OBSs "ocean-bottom broadband dispersion survey" with 2-years autonomy), the Obsismer program in the French Lesser Antilles (eight time 6-months deployments) and the Osisec program in Ecuador (four time 6-months deployments). These autonomous OBSs are self-recovered or recovered using an ROV. These systems are costly including ship time, and require to recover the OBS before to start working on data. Among the most recent alternative we developed a 3/4 years autonomy ocean bottom system with 9 channels (?) allowing the acquisition of different seismic or environmental parameters. MUG-OBS is a free falling instrument rated down to 6000 m. The installation of the sensor is monitored by acoustic commands from the surface and a health bulletin with data checking is recovered by acoustic during the installation. The major innovation is that it is possible to recover the data any time on demand (regularly every 6-months or after a crisis) using one of the 6 data-shuttles released from the surface by acoustic command using a one day fast cruise boat of opportunity. Since sensors stayed at the same location for 3 years, it is a perfect tool to monitor large seismic events, background seismic activity and aftershock distribution. Clock, drift measurement and GPS localization is automatic when the shuttle reaches the surface. For remote areas, shuttles released automatically and a seismic events bulletin is transmitted. Selected data can be recovered by two-way Iridium satellite communication. After a period of 3 years the main station is self-recovered by

  11. Search for OB stars running away from young star clusters. II. The NGC 6357 star-forming region

    Science.gov (United States)

    Gvaramadze, V. V.; Kniazev, A. Y.; Kroupa, P.; Oh, S.

    2011-11-01

    Dynamical few-body encounters in the dense cores of young massive star clusters are responsible for the loss of a significant fraction of their massive stellar content. Some of the escaping (runaway) stars move through the ambient medium supersonically and can be revealed via detection of their bow shocks (visible in the infrared, optical or radio). In this paper, which is the second of a series of papers devoted to the search for OB stars running away from young ( ≲ several Myr) Galactic clusters and OB associations, we present the results of the search for bow shocks around the star-forming region NGC 6357. Using the archival data of the Midcourse Space Experiment (MSX) satellite and the Spitzer Space Telescope, and the preliminary data release of the Wide-Field Infrared Survey Explorer (WISE), we discovered seven bow shocks, whose geometry is consistent with the possibility that they are generated by stars expelled from the young (~1-2 Myr) star clusters, Pismis 24 and AH03 J1725-34.4, associated with NGC 6357. Two of the seven bow shocks are driven by the already known OB stars, HD 319881 and [N78] 34. Follow-up spectroscopy of three other bow-shock-producing stars showed that they are massive (O-type) stars as well, while the 2MASS photometry of the remaining two stars suggests that they could be B0 V stars, provided that both are located at the same distance as NGC 6357. Detection of numerous massive stars ejected from the very young clusters is consistent with the theoretical expectation that star clusters can effectively lose massive stars at the very beginning of their dynamical evolution (long before the second mechanism for production of runaway stars, based on a supernova explosion in a massive tight binary system, begins to operate) and lends strong support to the idea that probably all field OB stars have been dynamically ejected from their birth clusters. A by-product of our search for bow shocks around NGC 6357 is the detection of three circular

  12. Conversion of chlorinated propanes by Methylosinus trichosporium OB3b expressing soluble methane monooxygenase

    OpenAIRE

    Bosma, T.; Janssen, D.B.

    1998-01-01

    Chlorinated propanes are important pollutants that may show persistent behaviour in the environment. The biotransformation of 1-chloropropane, 1,2-dichloropropane, 1,3-dichloropropane and 1,2,3-trichloropropane was studied using resting cell suspensions of Methylosinus trichosporium OB3b expressing soluble methane monooxygenase. The transformation followed first-order kinetics. The rate constants were in the order 1-chloropropane > 1,3-dichloropropane > 1,2-dichloropropane > 1,2,3-trichloropr...

  13. Trening za razvijanje občutka za števila in količine pri predšolskih otrocih s posebnimi potrebami

    OpenAIRE

    Kuplenk, Petra

    2017-01-01

    Tako otroci kot tudi odrasli se z matematiko srečujemo na vsakem koraku, pa naj bo to na poti v vrtec, službo ali pa pri delu doma. Matematika vsakodnevno vpliva na naše življenje in delo. Na delovnem mestu, v vrtcu, opažam vse večje težave otrok s posebnimi potrebami na področju razvoja občutka za števila in količine. V predšolskem obdobju je namreč nujno, da otroci razvijejo občutek za števila in količine, saj vsa nadaljnja matematična znanja temeljijo na usvojenih spretnostih. V empirič...

  14. OB Stars and Cepheids From the Gaia TGAS Catalogue: Test of their Distances and Proper Motions

    Directory of Open Access Journals (Sweden)

    Bobylev Vadim V.

    2017-12-01

    Full Text Available We consider young distant stars from the Gaia TGAS catalog. These are 250 classical Cepheids and 244 OB stars located at distances up to 4 kpc from the Sun. These stars are used to determine the Galactic rotation parameters using both trigonometric parallaxes and proper motions of the TGAS stars. In this case the considered stars have relative parallax errors less than 200%. Following the well-known statistical approach, we assume that the kinematic parameters found from the line-of-sight velocities Vr are less dependent on errors of distances than the found from the velocity components Vl. From values of the first derivative of the Galactic rotation angular velocity ′0, found from the analysis of velocities Vr and Vl separately, the scale factor of distances is determined.We found that from the sample of Cepheids the scale of distances of the TGAS should be reduced by 3%, and from the sample of OB stars, on the contrary, the scale should be increased by 9%.

  15. MODELING THE RADIO EMISSION FROM Cyg OB2 NO. 5: A QUADRUPLE SYSTEM?

    International Nuclear Information System (INIS)

    Kennedy, M.; Dougherty, S. M.; Fink, A.; Williams, P. M.

    2010-01-01

    Fifty observations at frequencies between 1.4 GHz and 43 GHz of the 6.6 day O6.5-7+O5.5-6 binary Cyg OB2 No. 5 using the Very Large Array over 20 years are re-examined. The aim is to determine the location and character of the previously detected variable radio emission. The radio emission from the system consists of a primary component that is associated with the binary, and a non-thermal source (NE), 0.''8 to the NE of the binary that has been ascribed to a wind-collision region (WCR) between the stellar winds of the binary and that of a B-type star (Star D) to the NE. Previous studies have not accounted for the potential contribution of NE to the total radio emission, most especially in observations where the primary and NE sources are not resolved as separate sources. NE shows no evidence of variation in 23 epochs where it is resolved separately from the primary radio component, demonstrating that the variable emission arises in the primary component. Since NE is non-variable, the radio flux from the primary can now be well determined for the first time, most especially in observations that do not resolve both the primary and NE components. The variable radio emission from the primary component has a period of 6.7 ± 0.3 years which is described by a simple model of a non-thermal source orbiting within the stellar wind envelope of the binary. Such a model implies the presence of a third, unresolved stellar companion (Star C) orbiting the 6.6 day binary with a period of 6.7 years and independent of Star D to the NE. The variable non-thermal emission arises from either a WCR between Star C and the binary system, or possibly from Star C directly. The model gives a mass-loss rate of 3.4 x 10 -5 M sun yr -1 for Cyg OB2 No. 5, unusually high for an Of supergiant and comparable to that of WR stars, and consistent with an unusually strong He I 1.083 μm emission line, also redolent of WR stars. An examination of radial velocity observations available from the

  16. Carbenoxolone treatment ameliorated metabolic syndrome in WNIN/Ob obese rats, but induced severe fat loss and glucose intolerance in lean rats.

    Directory of Open Access Journals (Sweden)

    Siva Sankara Vara Prasad Sakamuri

    Full Text Available BACKGROUND: 11beta-hydroxysteroid dehydrogenase type 1 (11β-HSD1 regulates local glucocorticoid action in tissues by catalysing conversion of inactive glucocorticoids to active glucocorticoids. 11β-HSD1 inhibition ameliorates obesity and associated co-morbidities. Here, we tested the effect of 11β-HSD inhibitor, carbenoxolone (CBX on obesity and associated comorbidities in obese rats of WNIN/Ob strain, a new animal model for genetic obesity. METHODOLOGY/PRINCIPAL FINDINGS: Subcutaneous injection of CBX (50 mg/kg body weight or volume-matched vehicle was given once daily for four weeks to three month-old WNIN/Ob lean and obese rats (n = 6 for each phenotype and for each treatment. Body composition, plasma lipids and hormones were assayed. Hepatic steatosis, adipose tissue morphology, inflammation and fibrosis were also studied. Insulin resistance and glucose intolerance were determined along with tissue glycogen content. Gene expressions were determined in liver and adipose tissue. CBX significantly inhibited 11β-HSD1 activity in liver and adipose tissue of WNIN/Ob lean and obese rats. CBX significantly decreased body fat percentage, hypertriglyceridemia, hypercholesterolemia, insulin resistance in obese rats. CBX ameliorated hepatic steatosis, adipocyte hypertrophy, adipose tissue inflammation and fibrosis in obese rats. Tissue glycogen content was significantly decreased by CBX in liver and adipose tissue of obese rats. Severe fat loss and glucose- intolerance were observed in lean rats after CBX treatment. CONCLUSIONS/SIGNIFICANCE: We conclude that 11β-HSD1 inhibition by CBX decreases obesity and associated co-morbidities in WNIN/Ob obese rats. Our study supports the hypothesis that inhibition of 11β-HSD1 is a key strategy to treat metabolic syndrome. Severe fat loss and glucose -intolerance by CBX treatment in lean rats suggest that chronic 11β-HSD1 inhibition may lead to insulin resistance in normal conditions.

  17. Réduire l'obésité chez les enfants au Mexique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    27 avr. 2016 ... ... le Mexique connaît une « transition nutritionnelle » sous l'effet des changements qui se sont produits en ce qui concerne le régime alimentaire, la nutrition et l'activité physique. Le surpoids et l'obésité sont des facteurs de risque pour les maladies chroniques comme le diabète et le cancer, sans compter ...

  18. Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario

    Directory of Open Access Journals (Sweden)

    Anne Grundy

    2017-01-01

    Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l

  19. Molecular Gas toward the Gemini OB1 Molecular Cloud Complex. II. CO Outflow Candidates with Possible WISE Associations

    Science.gov (United States)

    Li, Yingjie; Li, Fa-Cheng; Xu, Ye; Wang, Chen; Du, Xin-Yu; Yang, Wenjin; Yang, Ji

    2018-03-01

    We present a large-scale survey of CO outflows in the Gem OB1 molecular cloud complex and its surroundings, using the Purple Mountain Observatory Delingha 13.7 m telescope. A total of 198 outflow candidates were identified over a large area (∼58.5 square degrees), of which 193 are newly detected. Approximately 68% (134/198) are associated with the Gem OB1 molecular cloud complex, including clouds GGMC 1, GGMC 2, BFS 52, GGMC 3, and GGMC 4. Other regions studied are: the Local arm (Local Lynds, West Front), Swallow, Horn, and Remote cloud. Outflow candidates in GGMC 1, BFS 52, and Swallow are mainly located at ring-like or filamentary structures. To avoid excessive uncertainty in distant regions (≳3.8 kpc), we only estimated the physical parameters for clouds in the Gem OB1 molecular cloud complex and in the Local arm. In those clouds, the total kinetic energy and the energy injection rate of the identified outflow candidates are ≲1% and ≲3% of the turbulent energy and the turbulent dissipation rate of each cloud, indicating that the identified outflow candidates cannot provide enough energy to balance turbulence of their host cloud at the scale of the entire cloud (several to dozens of parsecs). The gravitational binding energy of each cloud is ≳135 times the total kinetic energy of the identified outflow candidates within the corresponding cloud, indicating that the identified outflow candidates cannot cause major disruptions to the integrity of their host cloud at the scale of the entire cloud.

  20. Nanoparticle Delivered Human Biliverdin Reductase-Based Peptide Increases Glucose Uptake by Activating IRK/Akt/GSK3 Axis: The Peptide Is Effective in the Cell and Wild-Type and Diabetic Ob/Ob Mice

    Directory of Open Access Journals (Sweden)

    Peter E. M. Gibbs

    2016-01-01

    Full Text Available Insulin’s stimulation of glucose uptake by binding to the IRK extracellular domain is compromised in diabetes. We have recently described an unprecedented approach to stimulating glucose uptake. KYCCSRK (P2 peptide, corresponding to the C-terminal segment of hBVR, was effective in binding to and inducing conformational change in the IRK intracellular kinase domain. Although myristoylated P2, made of L-amino acids, was effective in cell culture, its use for animal studies was unsuitable. We developed a peptidase-resistant formulation of the peptide that was efficient in both mice and cell culture systems. The peptide was constructed of D-amino acids, in reverse order, and blocked at both termini. Delivery of the encapsulated peptide to HepG2 and HSKM cells was confirmed by its prolonged effect on stimulation of glucose uptake (>6 h. The peptide improved glucose clearance in both wild-type and Ob/Ob mice; it lowered blood glucose levels and suppressed glucose-stimulated insulin secretion. IRK activity was stimulated in the liver of treated mice and in cultured cells. The peptide potentiated function of IRK’s downstream effector, Akt-GSK3-(α,β axis. Thus, P2-based approach can be used for improving glucose uptake by cells. Also, it allows for screening peptides in vitro and in animal models for treatment of diabetes.

  1. Quantitative variation in obesity-related traits and insulin precursors linked to the OB gene region on human chromosome 7

    Energy Technology Data Exchange (ETDEWEB)

    Duggirala, R.; Stern, M.P.; Reinhart, L.J. [Univ. of Texas Health Science Center, San Antonio, TX (United States)] [and others

    1996-09-01

    Despite the evidence that human obesity has strong genetic determinants, efforts at identifying specific genes that influence human obesity have largely been unsuccessful. Using the sibship data obtained from 32 low-income Mexican American pedigrees ascertained on a type II diabetic proband and a multipoint variance-components method, we tested for linkage between various obesity-related traits plus associated metabolic traits and 15 markers on human chromosome 7. We found evidence for linkage between markers in the OB gene region and various traits, as follows: D7S514 and extremity skinfolds (LOD = 3.1), human carboxypeptidase A1 (HCPA1) and 32,33-split proinsulin level (LOD = 4.2), and HCPA1 and proinsulin level (LOD = 3.2). A putative susceptibility locus linked to the marker D7S514 explained 56% of the total phenotypic variation in extremity skinfolds. Variation at the HCPA1 locus explained 64% of phenotypic variation in proinsulin level and {approximately}73% of phenotypic variation in split proinsulin concentration, respectively. Weaker evidence for linkage to several other obesity-related traits (e.g., waist circumference, body-mass index, fat mass by bioimpedance, etc.) was observed for a genetic location, which is {approximately}15 cM telomeric to OB. In conclusion, our study reveals that the OB region plays a significant role in determining the phenotypic variation of both insulin precursors and obesity-related traits, at least in Mexican Americans. 66 refs., 3 figs., 4 tabs.

  2. Variable millimetre radiation from the colliding-wind binary Cygnus OB2 #8A

    Science.gov (United States)

    Blomme, R.; Fenech, D. M.; Prinja, R. K.; Pittard, J. M.; Morford, J. C.

    2017-12-01

    Context. Massive binaries have stellar winds that collide. In the colliding-wind region, various physically interesting processes occur, leading to enhanced X-ray emission, non-thermal radio emission, as well as non-thermal X-rays and gamma-rays. Non-thermal radio emission (due to synchrotron radiation) has so far been observed at centimetre wavelengths. At millimetre wavelengths, the stellar winds and the colliding-wind region emit more thermal free-free radiation, and it is expected that any non-thermal contribution will be difficult or impossible to detect. Aims: We aim to determine if the material in the colliding-wind region contributes substantially to the observed millimetre fluxes of a colliding-wind binary. We also try to distinguish the synchrotron emission from the free-free emission. Methods: We monitored the massive binary Cyg OB2 #8A at 3 mm with the NOrthern Extended Millimeter Array (NOEMA) interferometer of the Institut de Radioastronomie Millimétrique (IRAM). The data were collected in 14 separate observing runs (in 2014 and 2016), and provide good coverage of the orbital period. Results: The observed millimetre fluxes range between 1.1 and 2.3 mJy, and show phase-locked variability, clearly indicating that a large part of the emission is due to the colliding-wind region. A simple synchrotron model gives fluxes with the correct order of magnitude, but with a maximum that is phase-shifted with respect to the observations. Qualitatively this phase shift can be explained by our neglect of orbital motion on the shape of the colliding-wind region. A model using only free-free emission results in only a slightly worse explanation of the observations. Additionally, on the map of our observations we also detect the O6.5 III star Cyg OB2 #8B, for which we determine a 3 mm flux of 0.21 ± 0.033 mJy. Conclusions: The question of whether synchrotron radiation or free-free emission dominates the millimetre fluxes of Cyg OB2 #8A remains open. More detailed

  3. As assessment of the flux of radionuclide contamination through the Ob and Yenisei rivers and estuaries to the Kara Sea

    International Nuclear Information System (INIS)

    Pauluszkiewicz, T.; Hibler, L.F.; Richmond, M.C.; Bradley, D.J.

    1995-01-01

    Recent data indicate that there are potentially large sources of radionuclide contamination on the Ob River system. To quantify the existing radionuclide contamination from a possible catastrophic event data and models have been used to quantify scenarios. Using a compilation of Russian data on the radionuclide contamination, hydrologic data and studies on the sediment transport process a conceptual model has been developed of the Ob system, and a numerical model has been applied to estimate the radionuclide flux to the Kara Sea. The initial results of the river modeling in the Mayak region show how important watershed flow from the marshes are to the hydrologic budget of the area. The preliminary analysis of the sediment flux indicates the need to consider the depositional (storage) regions such as the Asanow Marsh. 31 refs., 5 figs

  4. New Low-mass Stars in the 25 Orionis Stellar Group and Orion OB1a Sub-association from SDSS-III/BOSS Spectroscopy

    Science.gov (United States)

    Suárez, Genaro; Downes, Juan José; Román-Zúñiga, Carlos; Covey, Kevin R.; Tapia, Mauricio; Hernández, Jesús; Petr-Gotzens, Monika G.; Stassun, Keivan G.; Briceño, César

    2017-07-01

    The Orion OB1a sub-association is a rich low-mass star (LMS) region. Previous spectroscopic studies have confirmed 160 LMSs in the 25 Orionis stellar group (25 Ori), which is the most prominent overdensity of Orion OB1a. Nonetheless, the current census of the 25 Ori members is estimated to be lower than 50% complete, leaving a large number of members to be still confirmed. We retrieved 172 low-resolution stellar spectra in Orion OB1a observed as ancillary science in the SDSS-III/BOSS survey, for which we classified their spectral types and determined physical parameters. To determine memberships, we analyzed the {{{H}}}α emission, Li I λ6708 absorption, and Na I λλ8183, 8195 absorption as youth indicators in stars classified as M type. We report 50 new LMSs spread across the 25 Orionis, ASCC 18, and ASCC 20 stellar groups with spectral types from M0 to M6, corresponding to a mass range of 0.10≤slant m/{M}⊙ ≤slant 0.58. This represents an increase of 50% in the number of known LMSs in the area and a net increase of 20% in the number of 25 Ori members in this mass range. Using parallax values from the Gaia DR1 catalog, we estimated the distances to these three stellar groups and found that they are all co-distant, at 338 ± 66 pc. We analyzed the spectral energy distributions of these LMSs and classified their disks into evolutionary classes. Using H-R diagrams, we found a suggestion that 25 Ori could be slightly older than the other two observed groups in Orion OB1a.

  5. THE NON-THERMAL, TIME-VARIABLE RADIO EMISSION FROM Cyg OB2 no. 5: A WIND-COLLISION REGION

    International Nuclear Information System (INIS)

    Ortiz-Leon, Gisela N.; Loinard, Laurent; RodrIguez, Luis F.; Dzib, Sergio A.; Mioduszewski, Amy J.

    2011-01-01

    The radio emission from the well-studied massive stellar system Cyg OB2 no. 5 is known to fluctuate with a period of 6.7 years between a low-flux state, when the emission is entirely of free-free origin, and a high-flux state, when an additional non-thermal component (of hitherto unknown nature) appears. In this paper, we demonstrate that the radio flux of that non-thermal component is steady on timescales of hours and that its morphology is arc-like. This shows that the non-thermal emission results from the collision between the strong wind driven by the known contact binary in the system and that of an unseen companion on a somewhat eccentric orbit with a 6.7 year period and a 5-10 mas semimajor axis. Together with the previously reported wind-collision region located about 0.''8 to the northeast of the contact binary, so far Cyg OB2 no. 5 appears to be the only multiple system known to harbor two radio-imaged wind-collision regions.

  6. Growth of yttrium iron garnet single crystals in Na2O-B2O3 flux system in air

    International Nuclear Information System (INIS)

    Bandyopadhyay, Tarun; Saha, Prasenjit

    1977-01-01

    Detailed studies of growth of yttrium iron garnet (YIG) in the flux system Na 2 O-B 2 O 3 were made to delineate the phase stability regions of YIG and the neighbouring crystalline phases, and a tentative working diagram of Na 2 O-B 2 O 3 -YIG in air was drawn from the results of small batch crystal growth runs and solubility studies. The occurrence of a rather narrow field of YIG crystallization in this system was explained on the basis of relative solubilities of different oxides constituting YIG. Several long-time growth runs with some typical compositions were carried out in this system to evaluate its suitability for bulk growth of YIG crystals. The system, although possessing some inherent advantages, was found to suffer from limitations because the maximum size of the self-nucleated crystals grown hardly exceeded 2.00 mm. (author)

  7. Lutter contre l'obésité en Afrique du Sud à l'aide des politiques fiscales

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 nov. 2016 ... En 2008, le fardeau total des maladies non transmissibles en Afrique du Sud était estimé à 40 %, et ne cessait de croître. L'obésité est un facteur de risque de plusieurs maladies non transmissibles, dont les cardiopathies, l'hypertension, le diabète et le cancer.

  8. Globules and pillars in Cygnus X. I. Herschel far-infrared imaging of the Cygnus OB2 environment

    Science.gov (United States)

    Schneider, N.; Bontemps, S.; Motte, F.; Blazere, A.; André, Ph.; Anderson, L. D.; Arzoumanian, D.; Comerón, F.; Didelon, P.; Di Francesco, J.; Duarte-Cabral, A.; Guarcello, M. G.; Hennemann, M.; Hill, T.; Könyves, V.; Marston, A.; Minier, V.; Rygl, K. L. J.; Röllig, M.; Roy, A.; Spinoglio, L.; Tremblin, P.; White, G. J.; Wright, N. J.

    2016-06-01

    The radiative feedback of massive stars on molecular clouds creates pillars, globules and other features at the interface between the H II region and molecular cloud. Optical and near-infrared observations from the ground as well as with the Hubble or Spitzer satellites have revealed numerous examples of such cloud structures. We present here Herschel far-infrared observations between 70 μm and 500 μm of the immediate environment of the rich Cygnus OB2 association, performed within the Herschel imaging survey of OB Young Stellar objects (HOBYS) program. All of the observed irradiated structures were detected based on their appearance at 70 μm, and have been classified as pillars, globules, evaporating gasous globules (EGGs), proplyd-like objects, and condensations. From the 70 μm and 160 μm flux maps, we derive the local far-ultraviolet (FUV) field on the photon dominated surfaces. In parallel, we use a census of the O-stars to estimate the overall FUV-field, that is 103-104 G0 (Habing field) close to the central OB cluster (within 10 pc) and decreases down to a few tens G0, in a distance of 50 pc. From a spectral energy distribution (SED) fit to the four longest Herschel wavelengths, we determine column density and temperature maps and derive masses, volume densities and surface densities for these structures. We find that the morphological classification corresponds to distinct physical properties. Pillars and globules are massive (~500 M⊙) and large (equivalent radius r ~ 0.6 pc) structures, corresponding to what is defined as "clumps" for molecular clouds. EGGs and proplyd-likeobjects are smaller (r ~ 0.1 and 0.2 pc) and less massive (~10 and ~30 M⊙). Cloud condensations are small (~0.1 pc), have an average mass of 35 M⊙, are dense (~6 × 104 cm-3), and can thus be described as molecular cloud "cores". All pillars and globules are oriented toward the Cyg OB2 association center and have the longest estimated photoevaporation lifetimes, a few million

  9. B fields in OB stars (BOB): Low-resolution FORS2 spectropolarimetry of the first sample of 50 massive stars

    NARCIS (Netherlands)

    Fossati, L.; Castro, N.; Schöller, M.; Hubrig, S.; Langer, N.; Morel, T.; Briquet, M.; Herrero, A.; Przybilla, N.; Sana, H.; Schneider, F.R.N.; de Koter, A.

    2015-01-01

    Within the context of the collaboration "B fields in OB stars" (BOB), we used the FORS2 low-resolution spectropolarimeter to search for a magnetic field in 50 massive stars, including two reference magnetic massive stars. Because of the many controversies of magnetic field detections obtained with

  10. New Parallaxes for the Upper Scorpius OB Association

    Science.gov (United States)

    Donaldson, J. K.; Weinberger, A. J.; Gagné, J.; Boss, A. P.; Keiser, S. A.

    2017-11-01

    Upper Scorpius is a subgroup of the nearest OB association, Scorpius-Centaurus. Its young age makes it an important association to study star and planet formation. We present parallaxes to 52 low-mass stars in Upper Scorpius, 28 of which have full kinematics. We measure ages of the individual stars by combining our measured parallaxes with pre-main-sequence evolutionary tracks. We find a significant difference in the ages of stars with and without circumstellar disks. The stars without disks have a mean age of 4.9 ± 0.8 Myr and those with disks have an older mean age of 8.2 ± 0.9 Myr. This somewhat counterintuitive result suggests that evolutionary effects in young stars can dominate their apparent ages. We also attempt to use the 28 stars with full kinematics (I.e., proper motion, radial velocity (RV), and parallax) to trace the stars back in time to their original birthplace to obtain a trackback age. As expected, given the large measurement uncertainties on available RV measurements, we find that measurement uncertainties alone cause the group to diverge after a few Myr.

  11. Nature vs. Nurture: The influence of OB star environments on proto-planetary disk evolution

    Science.gov (United States)

    Bouwman, Jeroen

    2006-09-01

    We propose a combined IRAC/IRS study of a large, well-defined and unbiased X-ray selected sample of pre-main-sequence stars in three OB associations: Pismis 24 in NGC 6357, NGC 2244 in the Rosette Nebula, and IC 1795 in the W3 complex. The samples are based on recent Chandra X-ray Observatory studies which reliably identify hundreds of cluster members and were carefully chosen to avoid high infrared nebular background. A new Chandra exposure of IC 1795 is requested, and an optical followup to characterise the host stars is planned.

  12. Enhancing the Quality of Service for Real Time Traffic over Optical Burst Switching (OBS Networks with Ensuring the Fairness for Other Traffics.

    Directory of Open Access Journals (Sweden)

    Mohammed A Al-Shargabi

    Full Text Available Optical burst switching (OBS networks have been attracting much consideration as a promising approach to build the next generation optical Internet. A solution for enhancing the Quality of Service (QoS for high priority real time traffic over OBS with the fairness among the traffic types is absent in current OBS' QoS schemes. In this paper we present a novel Real Time Quality of Service with Fairness Ratio (RT-QoSFR scheme that can adapt the burst assembly parameters according to the traffic QoS needs in order to enhance the real time traffic QoS requirements and to ensure the fairness for other traffic. The results show that RT-QoSFR scheme is able to fulfill the real time traffic requirements (end to end delay, and loss rate ensuring the fairness for other traffics under various conditions such as the type of real time traffic and traffic load. RT-QoSFR can guarantee that the delay of the real time traffic packets does not exceed the maximum packets transfer delay value. Furthermore, it can reduce the real time traffic packets loss, at the same time guarantee the fairness for non real time traffic packets by determining the ratio of real time traffic inside the burst to be 50-60%, 30-40%, and 10-20% for high, normal, and low traffic loads respectively.

  13. Mass loss rates of OB stars derived from infrared observations

    International Nuclear Information System (INIS)

    Tanzi, E.G.; Tarenghi, M.; Panagia, N.

    1981-01-01

    In this paper the authors report briefly on a study of the mass loss of early type stars in the infrared. Up to now near infrared (1.25 - 4.8 μ) broad band photometry of 70 southern OB stars of various luminosity class has been secured. Program stars have been selected, among those bright enough in the infrared to give a suitable photometric accuracy, in order to cover a wide range of spectral types. 37 stars are found to exhibit emission in excess over a blackbody photospheric continuum, which is interpreted in terms of gas ejected in the form of an accelerated wind. By means of model calculations the corresponding mass loss rates are derived. The obtained values compare well with those determined independently by various authors for stars in common. Their data show that mass loss rates increase with luminosity and are a decreasing function of surface gravity. (Auth.)

  14. A survey of formaldehyde in the Cepheus OB3 molecular cloud

    International Nuclear Information System (INIS)

    Few, R.W.; Cohen, R.J.

    1983-01-01

    The 1 11 - 1 10 absorption line of formaldehyde at 6-cm wavelength has been surveyed over the region of the Cepheus OB3 molecular cloud, using the Jodrell Bank Mk II radio telescope (beamwidth 9 x 10 arcmin 2 ). The measurements have a velocity resolution of 0.27 km s - 1 and an rms noise level of approx. 0.01 K. The formaldehyde has a very clumpy distribution which is broadly similar to the CO distribution found by Sargent. A total molecular mass of 1.9 x 10 4 solar masses is implied by the formaldehyde measurements. Cepheus A is not the dominant concentration in the formaldehyde map. The most massive formaldehyde concentration is Cepheus C, which has a mass of 3600 solar masses. It appears to be stabilized by rotation. (author)

  15. De la ferme à la fourchette – lutte contre l'obésité chez les enfants ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 avr. 2016 ... ... but de combattre l'obésité chez les enfants. La démarche repose sur trois piliers, à savoir augmenter la proportion de fruits et de légumes frais dans les repas servis à l'école, faciliter l'approvisionnement en produits auprès des agriculteurs locaux et favoriser l'augmentation de la production maraîchère.

  16. A Novel Congestion Detection Scheme in TCP Over OBS Networks

    KAUST Repository

    Shihada, Basem

    2009-02-01

    This paper introduces a novel congestion detection scheme for high-bandwidth TCP flows over optical burst switching (OBS) networks, called statistical additive increase multiplicative decrease (SAIMD). SAIMD maintains and analyzes a number of previous round-trip time (RTTs) at the TCP senders in order to identify the confidence with which a packet loss event is due to network congestion. The confidence is derived by positioning short-term RTT in the spectrum of long-term historical RTTs. The derived confidence corresponding to the packet loss is then taken in the developed policy for TCP congestion window adjustment. We will show through extensive simulation that the proposed scheme can effectively solve the false congestion detection problem and significantly outperform the conventional TCP counterparts without losing fairness. The advantages gained in our scheme are at the expense of introducing more overhead in the SAIMD TCP senders. Based on the proposed congestion control algorithm, a throughput model is formulated, and is further verified by simulation results.

  17. The history and source of particulate 137Cs and 239,240Pu deposition in sediments of the Ob River Delta, Siberia

    International Nuclear Information System (INIS)

    Sayles, F.L.; Livingston, H.D.; Panteleyev, G.P.

    1997-01-01

    This paper presents the first results of a project designed to examine the transfer of particle-associated artificial radionuclides down the Ob River in Siberia to its delta over the past 5 decades. The main sources include fallout from atmospheric nuclear weapons tests and weapons complexes and test sites of the Former Soviet Union in or near the Ob watershed. The approach is to measure the accumulation of the radionuclides in undisturbed delta sediments - obtaining a record of their deposition over time. These records were found in sediments of shallow lakes apart from, and connected to, the main channel. Sediment cores were collected in the summer of 1994 using a shallow draft catamaran to reach these lakes from a support ship in the main channel. Measurements are presented on the depth distributions of 137 Cs and Pu isotopes and their inventories in a series of dated sediment cores - including one from a location in the Taz Estuary (which does not receive Ob River sediments). Sediment dating was carried out using the excess 210 Pb technique. The results obtained are compared with known information on the temporal history of releases from the various sources and characteristics of the isotopic composition of the sources. The results show that good records of radionuclide deposition indicate that the major fraction of 137 Cs and Pu isotopes deposited in these delta sediments comes from atmospheric nuclear weapons test fallout - both delivered directly from the atmosphere and from downstream transport of watershed sediments. No more than 25% of the observed inventories could be derived from other sources

  18. The current content of artificial radionuclides in the water of the Tobol-Irtysh river system (from the mouth of the Iset River to the confluence with the Ob River)

    International Nuclear Information System (INIS)

    Nikitin, Alexander I.; Chumichev, Vladimir B.; Valetova, Nailia K.; Katrich, Ivan Yu.; Kabanov, Alexander I.; Dunaev, Gennady E.; Shkuro, Valentina N.; Rodin, Victor M.; Mironenko, Alexander N.; Kireeva, Elena V.

    2007-01-01

    Data on content of 90 Sr, 137 Cs, 239,240 Pu and 3 H in water of the Tobol-Irtysh part of the Techa-Iset-Tobol-Irtysh-Ob river system (through which the 'Mayak' PA radioactive wastes are transported) are presented and discussed. The data were received in 2004-2005 under the ISTC project on radioecological monitoring of the Tobol and Irtysh rivers. Monthly observations of 137 Cs, 90 Sr and 3 H content in water in the area of the Tobol and Irtysh confluence have been conducted starting from May 2004. To obtain information on the investigated river system as a whole, the radioecological survey of the Tobol and Irtysh rivers at the section from the mouth of the Iset River to the confluence with the Ob River was carried out in 2004. It is shown that the impact of 'Mayak' PA waste transport by 90 Sr is distinctly traced as far as the area of the Irtysh and Ob confluence

  19. Sensitivity analysis of P-waves and S-waves to gas hydrate in the Shenhu area using OBS

    Science.gov (United States)

    Xing, Lei; Liu, Xueqin; Zhang, Jin; Liu, Huaishan; Zhang, Jing; Li, Zizheng; Wang, Jianhua

    2018-02-01

    Compared to towed streamers, ocean-bottom seismometers (OBS) obtain both S-wave data and richer wavefield information. In this paper, the induced polarization method is used to conduct wavefield separation on OBS data obtained from the Shenhu area in the South China Sea. A comparison of the changes in P- and S-waves, and a comprehensive analysis of geological factors within the area, enable analysis and description of the occurrence of natural gas hydrate in the study area. Results show an increase in P-wave velocity when natural gas hydrate exists in the formation, whereas the S-wave velocity remains almost constant, as S-waves can only propagate through the rock skeleton. Therefore, the bottom-simulating reflection (BSR) response of the P-wave is better than that of the S-wave in the frequency analysis profile. In a wide-angle section, the refractive wave of the hydrate layer is evident when using P-wave components but identification is difficult with S-wave components. This velocity model illustrates the sensitivity of P- and S-wave components to gas hydrate. The use of this polarization method and results of analysis provide technical and theoretical support for research on hydrate deposits and other geological features in the Shenhu area.

  20. Polimorfismos del gen ob en bovinos de raza holstein en la Comarca Lagunera, México

    OpenAIRE

    Sarai S. Mendoza-Retana; Miguel A. Gallegos-Robles; Uriel González-Salas; José L. García-Hernández; Manuel Fortis-Hernández; Cirilo Vázquez-Vázquez; Héctor I. Trejo-Escareño

    2017-01-01

    La Comarca Lagunera es la cuenca lechera más importante de México. En la actualidad se están utilizando diversas técnicas que permiten evaluar genéticamente el animal a una edad temprana, permitiendo seleccionar futuros reproductores con características deseables. Entre los genes relacionados con la producción de leche, se encuentran el gen Ob también llamado gen Leptina el cual actúa sobre el sistema nervioso central y tejidos periféricos jugando un papel muy importante ...

  1. Direct Imaging and Spectroscopy of a Young Extrasolar Kuiper Belt in the Nearest OB Association

    OpenAIRE

    Currie, Thayne; Lisse, Carey M.; Kuchner, Marc J.; Madhusudhan, Nikku; Kenyon, Scott J.; Thalmann, Christian; Carson, Joseph; Debes, John H.

    2015-01-01

    We describe the discovery of a bright, young Kuiper belt-like debris disk around HD 115600, a $\\sim$ 1.4--1.5 M$_\\mathrm{\\odot}$, $\\sim$ 15 Myr old member of the Sco-Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the \\textit{Gemini Planet Imager} shows the ring has a (luminosity scaled) semi major axis of ($\\sim$ 22 AU) $\\sim$ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral scattering dust, is eccentric (e $\\sim$ 0.1--0.2), and could b...

  2. SCUBA and HIRES Results for Protostellar Cores in the MON OB1 Dark Cloud

    Science.gov (United States)

    Wolf-Chase, G.; Moriarty-Schieven, G.; Fich, M.; Barsony, M.

    1999-05-01

    We have used HIRES-processing of IRAS data and point-source modelling techniques (Hurt & Barsony 1996; O'Linger 1997; Barsony et al. 1998), together with submillimeter continuum imaging using the Submillimeter Common-User Bolometer Array (SCUBA) on the 15-meter James Clerk Maxwell Telescope (JCMT), to search CS cores in the Mon OB1 dark cloud (Wolf-Chase, Walker, & Lada 1995; Wolf-Chase & Walker 1995) for deeply embedded sources. These observations, as well as follow-up millimeter photometry at the National Radio Astronomy Observatory (NRAO) 12-meter telescope on Kitt Peak, have lead to the identification of two Class 0 protostellar candidates, which were previously unresolved from two brighter IRAS point sources (IRAS 06382+0939 & IRAS 06381+1039) in this cloud. Until now, only one Class 0 object had been confirmed in Mon OB1; the driving source of the highly-collimated outflow NGC 2264 G (Ward-Thompson, Eiroa, & Casali 1995; Margulis et al. 1990; Lada & Fich 1996), which lies well outside the extended CS cores. One of the new Class 0 candidates may be an intermediate-mass source associated with an H_2O maser, and the other object is a low-mass source which may be associated with a near-infrared jet, and possibly with a molecular outflow. We report accurate positions for the new Class 0 candidates, based on the SCUBA images, and present new SEDs for these sources, as well as for the brighter IRAS point sources. A portion of this work was performed while GWC held a President's Fellowship from the University of California. MB and GWC gratefully acknowledge financial support from MB's NSF CAREER Grant, AST97-9753229.

  3. Eukaryotic RNA polymerase subunit RPB8 is a new relative of the OB family.

    Science.gov (United States)

    Krapp, S; Kelly, G; Reischl, J; Weinzierl, R O; Matthews, S

    1998-02-01

    RNA polymerase II subunit RPB8 is an essential subunit that is highly conserved throughout eukaryotic evolution and is present in all three types of nuclear RNA polymerases. We report the first high resolution structural insight into eukaryotic RNA polymerase architecture with the solution structure of RPB8 from Saccharomyces cerevisiae. It consists of an eight stranded, antiparallel beta-barrel, four short helical regions and a large, unstructured omega-loop. The strands are connected in classic Greek-key fashion. The overall topology is unusual and contains a striking C2 rotational symmetry. Furthermore, it is most likely a novel associate of the oligonucleotide/oligosaccharide (OB) binding protein class.

  4. Extinctions and Distances to Dark Clouds from 2MASS, MegaCam and IPHAS Surveys: LDN 1525 in the Direction of the Aur OB1 Association

    Directory of Open Access Journals (Sweden)

    Straižys V.

    2010-12-01

    Full Text Available The possibility of applying photometry from the 2MASS J, H, Ks, MegaCam u, g and IPHAS r, i, Hα surveys for determining the distance to the dark cloud LDN1525 (TGU 1192 in the direction of the Aur OB1 association is investigated using the red clump giants. The main dust cloud, probably related to the emission nebulae Sh 2-232, Sh 2-233, Sh 2-235, the molecular cloud and the association Aur OB2, is found to be located at a distance of 1.3 kpc from the Sun. The nebula Sh 2-231 can be an object of the Perseus arm. The maximum extinction AV found in the cloud is close to 6 mag.

  5. The current content of artificial radionuclides in the water of the Tobol-Irtysh river system (from the mouth of the Iset River to the confluence with the Ob River)

    Energy Technology Data Exchange (ETDEWEB)

    Nikitin, Alexander I. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation)]. E-mail: nikitin@typhoon.obninsk.ru; Chumichev, Vladimir B. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Valetova, Nailia K. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Katrich, Ivan Yu. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Kabanov, Alexander I. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Dunaev, Gennady E. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Shkuro, Valentina N. [SI RPA ' Typhoon' of the Roshydromet, 82, Lenin avenue, Obninsk, Kaluga region 249038 (Russian Federation); Rodin, Victor M. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation); Mironenko, Alexander N. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation); Kireeva, Elena V. [Tobolsk Biological Station of RAS, 15, Voikov street, Tobolsk, Tyumen region 626150 (Russian Federation)

    2007-07-15

    Data on content of {sup 90}Sr, {sup 137}Cs, {sup 239,240}Pu and {sup 3}H in water of the Tobol-Irtysh part of the Techa-Iset-Tobol-Irtysh-Ob river system (through which the 'Mayak' PA radioactive wastes are transported) are presented and discussed. The data were received in 2004-2005 under the ISTC project on radioecological monitoring of the Tobol and Irtysh rivers. Monthly observations of {sup 137}Cs, {sup 90}Sr and {sup 3}H content in water in the area of the Tobol and Irtysh confluence have been conducted starting from May 2004. To obtain information on the investigated river system as a whole, the radioecological survey of the Tobol and Irtysh rivers at the section from the mouth of the Iset River to the confluence with the Ob River was carried out in 2004. It is shown that the impact of 'Mayak' PA waste transport by {sup 90}Sr is distinctly traced as far as the area of the Irtysh and Ob confluence.

  6. ECA&D and E-OBS: High-resolution datasets for monitoring climate change and effects on viticulture in Europe

    Directory of Open Access Journals (Sweden)

    Photiadou Christiana

    2017-01-01

    Full Text Available Climate change and climate variability profoundly affect the production of wine. When facing a changing climate, the characteristics of wine produced in each region will change while the natural year-to-year variations in climate will increase variability of income for wine businesses and therefore affect profitability and economic resilience. The challenge posed to the viticulture community is thus to closely monitor these changes to be able to adapt business practices. The European Climate Assessment and Dataset (ECA&D and its gridded version E-OBS are tools to monitor the changing climatic conditions over Europe, with an emphasis on changes in extreme climatic conditions. In this paper, the potential of ECA&D and E-OBS for viticulture is demonstrated by a few examples. The examples include the changing areal suitable for Chardonnay cultivation, showing an expansion to areas which have been too cold only a few decades ago and retraction of optimal conditions from areas which have been suitable in the recent past. Other examples show the change in the diurnal temperature range in the latter stages of the ripening process of grapes and the variability in heavy precipitation events. Finally, first results of a new dataset for South America are presented.

  7. Targeting the OB-Folds of Replication Protein A with Small Molecules

    Directory of Open Access Journals (Sweden)

    Victor J. Anciano Granadillo

    2010-01-01

    Full Text Available Replication protein A (RPA is the main eukaryotic single-strand (ss DNA-binding protein involved in DNA replication and repair. We have identified and developed two classes of small molecule inhibitors (SMIs that show in vitro inhibition of the RPA-DNA interaction. We present further characterization of these SMIs with respect to their target binding, mechanism of action, and specificity. Both reversible and irreversible modes of inhibition are observed for the different classes of SMIs with one class found to specifically interact with DNA-binding domains A and B (DBD-A/B of RPA. In comparison with other oligonucleotide/oligosaccharide binding-fold (OB-fold containing ssDNA-binding proteins, one class of SMIs displayed specificity for the RPA protein. Together these data demonstrate that the specific targeting of a protein-DNA interaction can be exploited towards interrogating the cellular activity of RPA as well as increasing the efficacy of DNA-damaging chemotherapeutics used in cancer treatment.

  8. Plutonium speciation and isotope ratios in Yenisey and Ob river and Yenisey estuary

    International Nuclear Information System (INIS)

    Skipperud, L.; Oughton, DH.; Fifield, K.; Lind, O.C.; Salbu, B.; Brown, J.

    2004-01-01

    Plutonium isotope ratios are known to vary with reactor type, nuclear fuel-burn up time, neutron flux, and energy, and for fallout from nuclear detonations, weapon type and yield. Weapons-grade plutonium is characterized by a low content of the 240 Pu isotope, with 240 Pu/ 239 Pu isotope ratio less than 0.05. In contrast, both global weapons fallout and spent nuclear fuel from civil reactors have higher 240 Pu/ 239 Pu isotope ratios (civil nuclear power reactors have 240 Pu/ 239 Pu atom ratios of between about 0.2-1). Thus, different sources often exhibit characteristic plutonium isotope ratios and these ratios can be used to identify the origin of contamination, calculate inventories, or follow the migration of contaminated sediments and waters. Together with activity measurements and isotope ratios, knowledge of plutonium speciation in the Ob and Yenisey rivers and processes controlling its behaviour in estuarine systems is a prerequisite for predicting the transfer and subsequent environmental impact to Arctic Seas. With this in mind, the study had two objectives: first to determine whether discharges from nuclear installations in the river catchment areas are having any influence on Pu levels in the estuaries; and, second, to investigate the transfer and mobility of plutonium in the Yenisey river and estuary. Plutonium 240/239 ratios were determined using accelerator mass spectrometry (AMS). The data indicated a clear influence from a low 240 Pu: 239 Pu source in surface sediments collected from the Yenisey Estuary, whereas plutonium in the Ob Estuary sediments are dominated by global fallout. The results also show an increase in plutonium concentration and a decrease in isotope ratio going upstream from the estuary. Sequential extractions of sediments indicate that up 70% of the Pu in the Yenisey river is easily mobilized with weak oxidizing agents, which indicates that the Pu is organically bound, while the Pu is more strongly irreversible bound further out

  9. Study of clumping in the Cepheus OB 3 molecular cloud

    International Nuclear Information System (INIS)

    Carr, J.S.

    1987-01-01

    A portion of the Cep OB 3 molecular cloud has been mapped in the (C-13)O (1-0) line on a completely sampled grid with a 1.5-arcmin spacing. A total of 45 individual clouds, or clumps, have been identified in the map, with masses from 3 to 300 solar mass, sizes 3 pc or smaller, and mean densities of a few hundred/cu cm. Power-law correlations are found among the clump properties, namely, M proportional to R exp 2.5 and Delta(v) exp 0.24. These exponents differ somewhat from those found for similar correlations for molecular clouds in previous studies. Determination of the virial masses for the clumps shows that the clumps are not gravitationally bound and must be expanding on a time scale of about 1 Myr. Measurements of the (C-13)O (2-1) line give volume densities of 2000-5000. Comparisons of these densities with the mean volume densities from the (C-13)O (1-0) data suggest that the gas is clumped on a small scale with a volume filling factor of 0.04-0.10. 31 references

  10. New Version of SeismicHandler (SHX) based on ObsPy

    Science.gov (United States)

    Stammler, Klaus; Walther, Marcus

    2016-04-01

    The command line version of SeismicHandler (SH), a scientific analysis tool for seismic waveform data developed around 1990, has been redesigned in the recent years, based on a project funded by the Deutsche Forschungsgemeinschaft (DFG). The aim was to address new data access techniques, simplified metadata handling and a modularized software design. As a result the program was rewritten in Python in its main parts, taking advantage of simplicity of this script language and its variety of well developed software libraries, including ObsPy. SHX provides an easy access to waveforms and metadata via arclink and FDSN webservice protocols, also access to event catalogs is implemented. With single commands whole networks or stations within a certain area may be read in, the metadata are retrieved from the servers and stored in a local database. For data processing the large set of SH commands is available, as well as the SH scripting language. Via this SH language scripts or additional Python modules the command set of SHX is easily extendable. The program is open source, tested on Linux operating systems, documentation and download is found at URL "https://www.seismic-handler.org/".

  11. Leptin receptor 170 kDa (OB-R170) protein expression is reduced in obese human skeletal muscle: a potential mechanism of leptin resistance

    DEFF Research Database (Denmark)

    Fuentes, T; Ara, I; Guadalupe-Grau, A

    2010-01-01

    To examine whether obesity-associated leptin resistance could be due to down-regulation of leptin receptors (OB-Rs) and/or up-regulation of suppressor of cytokine signalling 3 (SOCS3) and protein tyrosine phosphatase 1B (PTP1B) in skeletal muscle, which blunt janus kinase 2-dependent leptin...

  12. Effects of copper mineralogy and methanobactin on cell growth and sMMO activity in Methylosinus trichosporium OB3b

    Directory of Open Access Journals (Sweden)

    C. Dennison

    2011-10-01

    Full Text Available Controls on in situ methanotroph activity are not well understood. One potentially important parameter is copper (Cu because it is the metal-centre of particulate methane monooxygenase (pMMO, the most active enzyme for oxidizing methane to methanol. Further, Cu-to-cell ratios influence the relative expression of pMMO versus the alternate soluble MMO (sMMO in some species. However, most methanotroph studies only have assessed readily soluble forms of Cu (e.g. CuCl2 and there is a dearth of Cu-related activity data for Cu sources more common in the environment. Here we quantified sMMO activity (as a practical indicator of Cu availability and growth kinetics in Methylosinus trichosporium OB3b, an organism that expresses both pMMO and sMMO, when grown on Cu-minerals with differing dissolution equilibria to assess how mineral type and methanobactin (mb might influence in situ methanotroph activity. Mb is a molecule produced by M. trichosporium OB3b that has a high affinity for Cu, reduces Cu toxicity, and may influence Cu availability in terrestrial systems. CuCO3.Cu(OH2 and CuO were chosen for study based on modelling data, reflecting more and less soluble minerals, respectively, and were found to affect M. trichosporium OB3b activity differently. Cells grew without growth lag and with active pMMO on CuCO3.Cu(OH2, regardless of the amount of mineral supplied (−1. The organism also grew well on CuO; however, significant sMMO activity was retained up to 50 μmoles Cu-total l−1, although sMMO activity was suppressed by supplemental mb and-or direct cell-mineral contact. Mb addition increased growth rates (p < 0.05 with both minerals. Results show mb broadly stimulates growth, but Cu mineralogy and mb dictate whether sMMO or pMMO is active in the cells. This explains why sMMO activity has been seen in soils with high Cu and also has implications for predicting dominant MMO activity in terrestrial bioremediation applications.

  13. Evidence for circumstellar obscuration of OB stars

    International Nuclear Information System (INIS)

    Bohannan, B.

    1975-01-01

    Reddish found a strong increase of color excess with increasing stellar luminosity: here referred to as the Reddish Effect: in ten young galactic clusters and associations. New photometric and spectroscopic observations drawn from the literature are combined with data used by Reddish to reconsider the color excess versus intrinsic magnitude diagrams of the same ten stellar groups. The reality of the Effect is questioned in all but one of the systems; this was accomplished by identifying possible foreground stars and by recognizing some of the brightest stars as supergiants, then applying correct intrinsic color indices. After careful reanalysis, the one stellar group to retain an indication of the Reddish Effect is Cygnus OB2. No correlation of reddening with luminosity was found for five additional very young stellar groups in the southern hemisphere; these groups should exhibit the Effect if it is a natural consequence of stellar evolution. Reddish ascribed the correlation to massive circumstellar remnants of material from which the stars formed. However, a peculiar dispersion in color excess could also be attributed to patchy dust within the stellar group. In several stellar systems previously identified as displaying the Reddish Effect, a correlation of observed color excess with dust and gas concentrations is noted on Palomar Sky Survey prints. If present, circumstellar dust clouds should []anifest their existence in modes other than a correlation of color excess with luminosity. The following possibilities are considered and all show negative results: correlation of color excess with spectral type; correlation of reddening slope E/subU//sub -//subB//E/subB//sub -//subV/ with spectral type; observable infrared excess. The preceding astrophysical arguments strongly imply that circumstellar dust remnants from stellar formation do not remain around stars during their main-sequence lifetimes. (auth)

  14. More accurate definition of liquation dome in Na2O-B2O3-SiO2 system

    International Nuclear Information System (INIS)

    Alekseeva, Z.D.; Mazurin, O.V.; Aver'yanov, V.I.; Galakhov, F.Ya.

    1977-01-01

    The liquation region in the system Na 2 O-B 2 O 3 -SiO 2 was investigated. The liquation temperatures were determined by the boundary of disappearance of opalescence in specimens with pre-induced opalescence. Extrapolation of the concentration dependences of the liquation temperature along sections with a constant SiO 2 content to a point indicates that with a SiO 2 content of 20-40% the liquation boundary in the system B 2 O 3 -SiO 2 hardly lies above 450 deg C

  15. [Detection of psychosocial dysfunction in ob-gyn patients].

    Science.gov (United States)

    González-Forteza, C F; Morales Carmona, F; Gutiérrez Calderon, E

    1993-01-01

    The human behavior and its social determinants are critical variables for understanding the etiology, treatment, and prevention of many disorders previously attributed to biological substrates. Among the many categories of human behavior to receive special attention from health researchers and practitioners are life events, coping responses and emotional state. The relation between these categories constituted a particular field of investigation. This relationship rather than forcing to focus on disease, distress, disability, and other failures in human functioning, permits to address health, abilities, resources, and other positive aspects of human functioning. On the other hand, the re-organization of health services considers interdisciplinary work as an objective, as it is necessary to care for the patient in an integral manner, with the consequent benefit of a more efficient service. In addition it is known that patients with psychosocial dysfunctions who use general practice care facilities overutilize these services in an unnecessary manner. With this in mind it is clear that is necessary to balance the service's cost-benefit for a more efficient clinical attention. In this paper we present the results of the categories mentioned above: life events, coping responses and its relationship with emotional state in a representative sample of 399 female patients who in 1986 received services at the National Institute of Perinatology-INPer-. Of these patients, 297 were obstetrical patients -OBS- and 102 gynaecological ones -GINE-. All patients answered these instruments: General Health Questionnaire -GHQ-7 of 30 items, a subscale of Health and Daily Living for Coping Responses and Life Events Scale.(ABSTRACT TRUNCATED AT 250 WORDS)

  16. Migration of global radioactive fallout to the Arctic Ocean (on the example of the Ob's river drainage basin).

    Science.gov (United States)

    Miroshnikov, A; Semenkov, I

    2012-11-01

    This article provides an assessment of the impact of global fallout on (137)Cs contamination in the bottom sediments of Kara Sea. The erosiveness of 10th-level river basins was estimated by landscape-geochemical and geomorphological characteristics. All 10th-level basins (n=154) were separated into three groups: mountain, mountain-lowland and plain. Four different types of basins were identified depending on the geochemical conditions of the migration of radiocaesium in the plain and mountain-lowland. Classifications of types were carried out using the geographic information systems-based approach. The Ob River's macroarena covers 3.5 million km(2). Internal drainage basins cover 23 % of the macroarena and accumulate whole radiocaesium from the global fallout. The remaining territory is transitional for the (137)Cs. The field research works performed in the three plain first-level basins allow one to estimate the radiocaesium run-off. The calculations show that 7 % of (137)Cs was removed from the first-level basin in arable land. Accumulation of radiocaesium in the first-level basin under undisturbed forest is 99.8 %. The research shows that (137)Cs transfer from the humid basins is in the range of 6.9-25.5 TBq and for semi-humid basins 5.6-285.5 TBq. The areas of these basins cover 40 and 8 % of the Ob River's macroarena, respectively. Drainage lakes and reservoir drainage basins make up 22 % of the macroarena. Mountainous and semi-arid drainage basins cover 7 % of the macroarena.

  17. Oczekiwania klienta pokolenia Y w zakresie sposobu obsługi i oferty biur podróży

    OpenAIRE

    Przybylska, Anna

    2015-01-01

    W pracy scharakteryzowano profil klienta w działalności biura podróży oraz rolę, jaką w niej odgrywa. Wskazano na znaczenie odpowiednich relacji z klientem, które wpływają na jego obsługę i zadowolenie. Krótko opisano zarządzanie relacjami z klientem oraz wytyczne do prawidłowego wprowadzenia tych zasad w firmie w celu maksymalizacji zysków. Badania zostały przeprowadzone na grupie konsumentów z przedziału wiekowego charakteryzującego pokolenie Y oraz pokolenie X – w celach ...

  18. Spodbujanje ustvarjalnosti v poletnih počitniških varstvih, sofinanciranih s strani Mestne občine Ljubljana

    OpenAIRE

    Grm, Urša

    2017-01-01

    Spodbujanje ustvarjalnosti skozi umetnost ima ključni pomen pri snovanju novih in različnih idej, izražanju domišljije, kakovostnem preživljanju časa ter izboljšanju kakovosti življenja (Knoll, 2011). Aktivira otrokove intelektualne, čustvene in motivacijske procese (Kroflič in Gobec, 1995). H kakovostnemu preživljanju časa poletnih počitnic prispeva Mestna občina Ljubljana (MOL), ki sofinancira prostočasne in preventivne programe za otroke od 1.–5. razreda osnovne šole s stalnim prebivališče...

  19. Paraffin oil as a "methane vector" for rapid and high cell density cultivation of Methylosinus trichosporium OB3b.

    Science.gov (United States)

    Han, Bing; Su, Tao; Wu, Hao; Gou, Zhongxuan; Xing, Xin-Hui; Jiang, Hao; Chen, Yin; Li, Xin; Murrell, J Colin

    2009-06-01

    Slow growth and relatively low cell densities of methanotrophs have limited their uses in industrial applications. In this study, a novel method for rapid cultivation of Methylosinus trichosporium OB3b was studied by adding a water-immiscible organic solvent in the medium. Paraffin oil was the most effective at enhancing cell growth and final cell density. This is at least partially due to the increase of methane gas transfer between gas and medium phases since methane solubility is higher in paraffin than in water/nitrate minimal salt medium. During cultivation with paraffin oil at 5% (v/v) in the medium, M. trichosporium OB3b cells also showed higher concentrations of the intermediary metabolites, such as formic acid and pyruvic acid, and consumed more methane compared with the control. Paraffin as methane vector to improve methanotroph growth was further studied in a 5-L fermentor at three concentrations (i.e., 2.5%, 5%, and 10%). Cell density reached about 14 g dry weight per liter with 5% paraffin, around seven times higher than that of the control (without paraffin). Cells cultivated with paraffin tended to accumulate around the interface between oil droplets and the water phase and could exist in oil phase in the case of 10% (v/v) paraffin. These results indicated that paraffin could enhance methanotroph growth, which is potentially useful in cultivation of methanotrophs in large scale in industry.

  20. THE BOLOCAM GALACTIC PLANE SURVEY. III. CHARACTERIZING PHYSICAL PROPERTIES OF MASSIVE STAR-FORMING REGIONS IN THE GEMINI OB1 MOLECULAR CLOUD

    International Nuclear Information System (INIS)

    Dunham, Miranda K.; Evans, Neal J.; Harvey, Paul; Merello, Manuel; Rosolowsky, Erik; Cyganowski, Claudia J.; Aguirre, James; Bally, John; Battersby, Cara; Ginsburg, Adam; Glenn, Jason; Stringfellow, Guy S.; Bradley, Eric Todd; Dowell, Darren; Drosback, Meredith; Schlingman, Wayne; Shirley, Yancy L.; Walawender, Josh; Williams, Jonathan P.

    2010-01-01

    We present the 1.1 mm Bolocam Galactic Plane Survey (BGPS) observations of the Gemini OB1 molecular cloud complex, and targeted NH 3 observations of the BGPS sources. When paired with molecular spectroscopy of a dense gas tracer, millimeter observations yield physical properties such as masses, radii, mean densities, kinetic temperatures, and line widths. We detect 34 distinct BGPS sources above 5σ = 0.37 Jy beam -1 with corresponding 5σ detections in the NH 3 (1,1) transition. Eight of the objects show water maser emission (20%). We find a mean millimeter source FWHM of 1.12 pc and a mean gas kinetic temperature of 20 K for the sample of 34 BGPS sources with detections in the NH 3 (1,1) line. The observed NH 3 line widths are dominated by non-thermal motions, typically found to be a few times the thermal sound speed expected for the derived kinetic temperature. We calculate the mass for each source from the millimeter flux assuming the sources are isothermal and find a mean isothermal mass within a 120'' aperture of 230 ± 180 M sun . We find a total mass of 8400 M sun for all BGPS sources in the Gemini OB1 molecular cloud, representing 6.5% of the cloud mass. By comparing the millimeter isothermal mass to the virial mass calculated from the NH 3 line widths within a radius equal to the millimeter source size, we find a mean virial parameter (M vir /M iso ) of 1.0 ± 0.9 for the sample. We find mean values for the distributions of column densities of 1.0 x 10 22 cm -2 for H 2 , and 3.0 x 10 14 cm -2 for NH 3 , giving a mean NH 3 abundance of 3.0 x 10 -8 relative to H 2 . We find volume-averaged densities on the order of 10 3 -10 4 cm -3 . The sizes and densities suggest that in the Gem OB1 region the BGPS is detecting the clumps from which stellar clusters form, rather than smaller, higher density cores where single stars or small multiple systems form.

  1. The distribution and history of nuclear weapons related contamination in sediments from the Ob River, Siberia as determined by isotopic ratios of plutonium and neptunium

    International Nuclear Information System (INIS)

    Kenna, T.C.; Sayles, F.L.

    2002-01-01

    Isotopic ratios of Pu and Np measured in sediment cores from 5 locations in the Ob River drainage basin show clear evidence of input from sources other than global fallout (non-fallout sources). Historical contaminant records obtained by combining isotopic ratio information with chronological information indicate that non-fallout inputs are from several sources that have varied significantly over the past 50 years. Unique isotopic signatures observed in sediments from tributaries that drain areas containing known or suspected sources of non-fallout contamination are used to identify the source of materials in sediments collected at downstream locations. These data can lead to a better understanding of the transport behavior, fate, and relative importance of particle reactive, weapons related contaminants originating from the nuclear facilities Mayak, Tomsk-7, and Semipalitinsk, which lie within the drainage basin. From our work to date, we draw the following conclusions: (1) Persistent non-fallout contamination is observed in the Ob River above its confluence with the Irtysh River, indicating contamination from the Tomsk-7 facility. (2) Non-fallout contamination in the Tobol River above its confluence with the Irtysh River indicates contamination from the Mayak facility. (3) Non-fallout contamination in the Irtysh River above its confluence with the Tobol River indicates contamination from the Semipalitinsk weapons test site. (4) The occurrence of isotopic ratios in Ob Delta sediments that are similar to those observed in source tributaries suggests that contamination from at least two sources has been transported along the length of the river system. (5) Global fallout, a result of high-yield atmospheric weapons tests conducted by the FSU and USA primarily, is the dominant source of Pu and Np to the region; however, there have been brief periods when inputs from non-fallout sources exceeded those from global fallout

  2. TOWARD COMPLETE STATISTICS OF MASSIVE BINARY STARS: PENULTIMATE RESULTS FROM THE CYGNUS OB2 RADIAL VELOCITY SURVEY

    Energy Technology Data Exchange (ETDEWEB)

    Kobulnicky, Henry A.; Lundquist, Michael J.; Burke, Jamison; Chapman, James; Keller, Erica; Lester, Kathryn; Rolen, Emily K.; Topel, Eric; Bhattacharjee, Anirban; Smullen, Rachel A.; Álvarez, Carlos A. Vargas; Runnoe, Jessie C.; Dale, Daniel A.; Brotherton, Michael M. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82070 (United States); Kiminki, Daniel C., E-mail: chipk@uwyo.edu, E-mail: jburke2@swarthmore.edu, E-mail: jc6380@mcla.edu, E-mail: kelle22e@mtholyoke.edu, E-mail: kvl214@lehigh.edu, E-mail: emily.k.rolen@vanderbilt.edu, E-mail: topel@stolaf.edu [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States)

    2014-08-01

    We analyze orbital solutions for 48 massive multiple-star systems in the Cygnus OB2 association, 23 of which are newly presented here, to find that the observed distribution of orbital periods is approximately uniform in log P for P < 45 days, but it is not scale-free. Inflections in the cumulative distribution near 6 days, 14 days, and 45 days suggest key physical scales of ≅0.2, ≅0.4, and ≅1 A.U. where yet-to-be-identified phenomena create distinct features. No single power law provides a statistically compelling prescription, but if features are ignored, a power law with exponent β ≅ –0.22 provides a crude approximation over P = 1.4-2000 days, as does a piece-wise linear function with a break near 45 days. The cumulative period distribution flattens at P > 45 days, even after correction for completeness, indicating either a lower binary fraction or a shift toward low-mass companions. A high degree of similarity (91% likelihood) between the Cyg OB2 period distribution and that of other surveys suggests that the binary properties at P ≲ 25 days are determined by local physics of disk/clump fragmentation and are relatively insensitive to environmental and evolutionary factors. Fully 30% of the unbiased parent sample is a binary with period P < 45 days. Completeness corrections imply a binary fraction near 55% for P < 5000 days. The observed distribution of mass ratios 0.2 < q < 1 is consistent with uniform, while the observed distribution of eccentricities 0.1 < e < 0.6 is consistent with uniform plus an excess of e ≅ 0 systems. We identify six stars, all supergiants, that exhibit aperiodic velocity variations of ∼30 km s{sup –1} attributed to atmospheric fluctuations.

  3. SPITZER IRS SPECTRA OF DEBRIS DISKS IN THE SCORPIUS–CENTAURUS OB ASSOCIATION

    Energy Technology Data Exchange (ETDEWEB)

    Jang-Condell, Hannah [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); Chen, Christine H.; Mittal, Tushar; Lisse, Carey M. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Manoj, P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Homi Bhabha Rd., Mumbai 400005 (India); Watson, Dan [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627 (United States); Nesvold, Erika; Kuchner, Marc [NASA Goddard Space Flight Center, Greenbelt, MD (United States)

    2015-08-01

    We analyze spectra obtained with the Spitzer Infrared Spectrograph (IRS) of 110 B-, A-, F-, and G-type stars with optically thin infrared excess in the Scorpius–Centaurus OB association. The ages of these stars range from 11 to 17 Myr. We fit the infrared excesses observed in these sources by Spitzer IRS and the Multiband Imaging Photometer for Spitzer (MIPS) to simple dust models according to Mie theory. We find that nearly all of the objects in our study can be fit by one or two belts of dust. Dust around lower mass stars appears to be closer in than around higher mass stars, particularly for the warm dust component in the two-belt systems, suggesting a mass-dependent evolution of debris disks around young stars. For those objects with stellar companions, all dust distances are consistent with truncation of the debris disk by the binary companion. The gaps between several of the two-belt systems can place limits on the planets that might lie between the belts, potentially constraining the mass and locations of planets that may be forming around these stars.

  4. Central stars of planetary nebulae. II. New OB-type and emission-line stars

    Science.gov (United States)

    Weidmann, W. A.; Gamen, R.

    2011-07-01

    Context. There are more than 3000 confirmed and probably known Galactic planetary nebulae (PNe), but central star spectroscopic information is available for only 13% of them. Aims: We have undertaken a spectroscopic survey of the central stars in PNe to identify their spectral types. Methods: We performed spectroscopic observations at low resolution with the 2-m telescope at CASLEO, Argentina. Results: We present the spectra of 46 central stars of PNe, most of them are OB-type and emission-line stars. Based on data collected at the Complejo Astronómico El Leoncito (CASLEO), which is operated under agreement between the Consejo Nacional de Investigaciones Científicas y Técnicas de la República Argentina y Universidades Nacionales de La Plata, Córdoba y San Juan, Argentina.The reduced spectra (FITS files) are available in electronic form at the CDS via anonymous ftp to cdsarc.u-strasbg.fr (130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/531/A172

  5. Acoustic and Shear-Wave Velocities in Hydrate-Bearing Sediments Offshore Southwestern Taiwan: Tomography, Converted Waves Analysis and Reverse-Time Migration of OBS Records

    Directory of Open Access Journals (Sweden)

    Philippe Schnurle

    2006-01-01

    Full Text Available A 2.5-D combined seismic reflection and refraction survey has been conducted in the accretionary complex offshore of southwestern Taiwan where BSRs (Bottom Simulating Reflectors are highly concentrated and geochemical signals for the presence of gas hydrate are strong. In this study, we perform velocity analysis of the 6 4-component OBS (Ocean-Bottom Seismometer records along the southernmost transect of this seismic experiment. We utilize 3 independent methods in order to accurately determine the acoustic and shear-wave velocities of the sediments: 1-D Root Mean Square (RMS analysis of the P-P and P-S reflected events on individual datumed components, 2-D inversion of the P-P and P-S reflected and refracted events along the in-line transect, and 3-D acoustic inversion of the first arrivals. The principal sources of bias in the determination of the velocities are the 3-dimentional nature of the topography and the complexity of the underlying structures. The three methods result in consistent velocity profiles. Rapid lateral and vertical variations of the velocities are observed. We then investigate the large scale gas hydrate content through rock physic modeling: at the vertical of each OBS, shear-waves velocities are utilized to estimate the water-filled porosities, and the acoustic velocities predicted for a set of gas hydrate, quartz and clay contents are compared to the observed profiles.

  6. MULTI-EPOCH VERY LONG BASELINE ARRAY OBSERVATIONS OF THE COMPACT WIND-COLLISION REGION IN THE QUADRUPLE SYSTEM Cyg OB2 no. 5

    Energy Technology Data Exchange (ETDEWEB)

    Dzib, Sergio A.; Rodriguez, Luis F.; Loinard, Laurent; Ortiz-Leon, Gisela N.; Araudo, Anabella T. [Centro de Radiostronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, Morelia 58089 (Mexico); Mioduszewski, Amy J., E-mail: s.dzib@crya.unam.mx [National Radio Astronomy Observatory, 1003 Lopezville Road, Socorro, NM 87801 (United States)

    2013-02-15

    We present multi-epoch Very Long Base Array observations of the compact wind-collision region in the Cyg OB2 no. 5 system. These observations confirm the arc-shaped morphology of the emission reported earlier. The total flux as a function of time is roughly constant when the source is 'on', but falls below the detection limit as the wind-collision region approaches periastron in its orbit around the contact binary at the center of the system. In addition, at one of the 'on' epochs, the flux drops to about a fifth of its average value. We suggest that this apparent variation could result from the inhomogeneity of the wind that hides part of the flux rather than from an intrinsic variation. We measured a trigonometrical parallax, for the most compact radio emission of 0.61 {+-} 0.22 mas, corresponding to a distance of 1.65 {sup +0.96} {sub -0.44} kpc, in agreement with recent trigonometrical parallaxes measured for objects in the Cygnus X complex. Using constraints on the total mass of the system and orbital parameters previously reported in the literature, we obtain two independent indirect measurements of the distance to the Cyg OB2 no. 5 system, both consistent with 1.3-1.4 kpc. Finally, we suggest that the companion star responsible for the wind interaction, yet undetected, is of spectral type between B0.5 and O8.

  7. MULTI-EPOCH VERY LONG BASELINE ARRAY OBSERVATIONS OF THE COMPACT WIND-COLLISION REGION IN THE QUADRUPLE SYSTEM Cyg OB2 no. 5

    International Nuclear Information System (INIS)

    Dzib, Sergio A.; Rodríguez, Luis F.; Loinard, Laurent; Ortiz-León, Gisela N.; Araudo, Anabella T.; Mioduszewski, Amy J.

    2013-01-01

    We present multi-epoch Very Long Base Array observations of the compact wind-collision region in the Cyg OB2 no. 5 system. These observations confirm the arc-shaped morphology of the emission reported earlier. The total flux as a function of time is roughly constant when the source is 'on', but falls below the detection limit as the wind-collision region approaches periastron in its orbit around the contact binary at the center of the system. In addition, at one of the 'on' epochs, the flux drops to about a fifth of its average value. We suggest that this apparent variation could result from the inhomogeneity of the wind that hides part of the flux rather than from an intrinsic variation. We measured a trigonometrical parallax, for the most compact radio emission of 0.61 ± 0.22 mas, corresponding to a distance of 1.65 +0.96 –0.44 kpc, in agreement with recent trigonometrical parallaxes measured for objects in the Cygnus X complex. Using constraints on the total mass of the system and orbital parameters previously reported in the literature, we obtain two independent indirect measurements of the distance to the Cyg OB2 no. 5 system, both consistent with 1.3-1.4 kpc. Finally, we suggest that the companion star responsible for the wind interaction, yet undetected, is of spectral type between B0.5 and O8.

  8. Constraining formation of the Eggvin Bank (West of Jan Mayen, N. Atlantic) from OBS data

    Science.gov (United States)

    Tan, P.; Breivik, A. J.; Mjelde, R.; Azuma, R.

    2015-12-01

    The anomalously high magma flux in the Eggvin Bank area has triggered new research efforts to better understand the crustal development in this area. The Eggvin Bank is located between the Jan Mayen Island and the west coast of Greenland. Some proposed origins of the Eggvin Bank are: a distinct plume located beneath Jan Mayen; an extension of the Iceland plume; minor spreading or leakage along West Jan Mayen Fracture Zone (WJMFZ); intruded continental crust extending from Jan Mayen Microcontinent (JMMC); and rifted Greenland sub-continental lithospheric mantle. In this first modern refraction seismic study of the Eggvin Bank, we present a 2D velocity model based on OBS data. The OBSs were deployed approx. N-S over the Eggvin Bank with good data quality constrained by 4 OBSs. The air-gun array used during OBS shooting produced good quality reflection data. Three distinct seamounts are observed along the profile: the northern seamount (water depth 730m), has a flat top with a thin sedimentary veneer on top, which indicates it has been eroded at sea surface; while the southern two seamounts, one (water depth 550m) is less flat with around 100m thick sedimentary units on top, another one is rounded with tiny sedimentary veneer on top having the shallowest water depth (460m). This could suggest that the southern seamounts are younger, since they are shallower but without obvious signs that they were subaerially exposed. However, increased cooling of the lithosphere across the WJMFZ in the north may also contribute to depth differences. A normal fault offsetting sedimentary strata (~300 m) in the Greenland Basin indicates recent tectonic activity north of the Eggvin Bank. The velocity modeling shows crustal thickness with large variations, ranging from 8 km to 14 km, where crustal thickness changes of 4-5 km are associated with 20-30 km wide segments with thick crust under the seamounts. The crust consists of three oceanic crustal layers: upper crust (2.8km/s-4.8km

  9. Polimorfismos del gen ob en bovinos de raza holstein en la Comarca Lagunera, México

    Directory of Open Access Journals (Sweden)

    Sarai S. Mendoza-Retana

    2017-01-01

    Full Text Available La Comarca Lagunera es la cuenca lechera más importante de México. En la actualidad se están utilizando diversas técnicas que permiten evaluar genéticamente el animal a una edad temprana, permitiendo seleccionar futuros reproductores con características deseables. Entre los genes relacionados con la producción de leche, se encuentran el gen Ob también llamado gen Leptina el cual actúa sobre el sistema nervioso central y tejidos periféricos jugando un papel muy importante en la modulación regulación del apetito, ganancia de peso vivo, incremento del metabolismo energético y el anabolismo muscular. Este trabajo se realizó para determinar el polimorfismo de longitud del fragmento de restricción ACI I de gen leptina en el exón 2 y correlacionarlo con los parámetros de producción y calidad de leche. Se recolectaron 100 muestra de sangre de vacas en producción del establo “Lácteos Florida” de Francisco I. Madero municipio de Coahuila, México con tres esta tus de producción: altas, medias y bajas La extracción de ADN se realizó por el método modificado de Salting - Out. Se realizó PCR del gen leptina originando un fragmento de 272 bp de longitud y se realizó PCR - RFLP con la enzima de restricción ACI I y secue nciación, correlacionando los genotipos TT, CT Y CC con tres estatus de producción de leche: altas, medias, bajas. El análisis estadístico indicó que las vacas portadoras del genotipo homocigoto (TT tienen un efecto significativo (P<0.01 con respecto a l as características de producción y calidad de leche ya que tuvieron un mayor consumo de alimento, ganancia de peso, además de una elevada producción de leche en comparación a los genotipos heterocigoto (CT y homocigoto (CC. Los resultados obtenidos muest ran que l a identificación molecular de polimorfismos del gen Ob puede usarse como herramienta de selección genética en bovinos de raza Holstein.

  10. Measurement of Circumstellar Disk Sizes in the Upper Scorpius OB Association with ALMA

    Science.gov (United States)

    Barenfeld, Scott A.; Carpenter, John M.; Sargent, Anneila I.; Isella, Andrea; Ricci, Luca

    2017-12-01

    We present detailed modeling of the spatial distributions of gas and dust in 57 circumstellar disks in the Upper Scorpius OB Association observed with ALMA at submillimeter wavelengths. We fit power-law models to the dust surface density and CO J = 3–2 surface brightness to measure the radial extent of dust and gas in these disks. We found that these disks are extremely compact: the 25 highest signal-to-noise disks have a median dust outer radius of 21 au, assuming an {R}-1 dust surface density profile. Our lack of CO detections in the majority of our sample is consistent with these small disk sizes assuming the dust and CO share the same spatial distribution. Of seven disks in our sample with well-constrained dust and CO radii, four appear to be more extended in CO, although this may simply be due to the higher optical depth of the CO. Comparison of the Upper Sco results with recent analyses of disks in Taurus, Ophiuchus, and Lupus suggests that the dust disks in Upper Sco may be approximately three times smaller in size than their younger counterparts, although we caution that a more uniform analysis of the data across all regions is needed. We discuss the implications of these results for disk evolution.

  11. Preparedness of Ob/Gyn residents for fellowship training in gynecologic oncology

    Directory of Open Access Journals (Sweden)

    David W. Doo

    2015-04-01

    Full Text Available Residency training in obstetrics and gynecology is being challenged by increasingly stringent regulations and decreased operative experience. We sought to determine the perception of preparedness of incoming gynecologic oncology fellows for advanced surgical training in gynecologic oncology. An online survey was sent to gynecologic oncologists involved in fellowship training in the United States. They were asked to evaluate their most recent incoming clinical fellows in the domains of professionalism, level of independence/graduated responsibility, psychomotor ability, clinical evaluation and management, and academia and scholarship using a standard Likert-style scale. The response rate among attending physicians was 40% (n = 105/260 and 61% (n = 28/46 for program directors. Of those who participated, 49% reported that their incoming fellows could not independently perform a hysterectomy, 59% reported that they could not independently perform 30 min of a major procedure, 40% reported that they could not control bleeding, 40% reported that they could not recognize anatomy and tissue planes, and 58% reported that they could not dissect tissue planes. Fellows lacked an understanding of pathophysiology, treatment recommendations, and the ability to identify and treat critically ill patients. In the academic domain, respondents agreed that fellows were deficient in the areas of protocol design (54%, statistical analysis (54%, and manuscript writing (65%. These results suggest that general Ob/Gyn residency is ineffective in preparing fellows for advanced training in gynecologic oncology and should prompt a revision of the goals and objectives of resident education to correct these deficiencies.

  12. Chronic vitamin A-enriched diet feeding regulates hypercholesterolaemia through transcriptional regulation of reverse cholesterol transport pathway genes in obese rat model of WNIN/GR-Ob strain

    Directory of Open Access Journals (Sweden)

    Shanmugam M Jeyakumar

    2016-01-01

    Full Text Available Background & objectives: Hepatic scavenger receptor class B1 (SR-B1, a high-density lipoprotein (HDL receptor, is involved in the selective uptake of HDL-associated esterified cholesterol (EC, thereby regulates cholesterol homoeostasis and improves reverse cholesterol transport. Previously, we reported in euglycaemic obese rats (WNIN/Ob strain that feeding of vitamin A-enriched diet normalized hypercholesterolaemia, possibly through hepatic SR-B1-mediated pathway. This study was aimed to test whether it would be possible to normalize hypercholesterolaemia in glucose-intolerant obese rat model (WNIN/GR/Ob through similar mechanism by feeding identical vitamin A-enriched diet. Methods: In this study, 30 wk old male lean and obese rats of WNIN/GR-Ob strain were divided into two groups and received either stock diet or vitamin A-enriched diet (2.6 mg or 129 mg vitamin A/kg diet for 14 wk. Blood and other tissues were collected for various biochemical analyses. Results: Chronic vitamin A-enriched diet feeding decreased hypercholesterolaemia and normalized abnormally elevated plasma HDL-cholesterol (HDL-C levels in obese rats as compared to stock diet-fed obese groups. Further, decreased free cholesterol (FC and increased esterified cholesterol (EC contents of plasma cholesterol were observed, which were reflected in higher EC to FC ratio of vitamin A-enriched diet-fed obese rats. However, neither lecithin-cholesterol acyltransferase (LCAT activity of plasma nor its expression (both gene and protein in the liver were altered. On the contrary, hepatic cholesterol levels significantly increased in vitamin A-enriched diet fed obese rats. Hepatic SR-B1 expression (both mRNA and protein remained unaltered among groups. Vitamin A-enriched diet fed obese rats showed a significant increase in hepatic low-density lipoprotein receptor mRNA levels, while the expression of genes involved in HDL synthesis, namely, ATP-binding cassette protein 1 (ABCA1 and

  13. Nové poznatky ze studia mineralogie, fluidních inkluzí a izotopů síry v rudách skarnového ložiska v Obřím dole

    Czech Academy of Sciences Publication Activity Database

    Pašava, J.; Veselovský, F.; Dobeš, P.; Haluzová, Eva; Ackerman, Lukáš; Tásler, R.

    2016-01-01

    Roč. 49, č. 1 (2016), s. 47-52 ISSN 0514-8057 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : Obří důl skarn-type deposit * mineralogy * fluid inclusions * sulfur isotopes Subject RIV: DB - Geology ; Mineralogy

  14. Gels and gel-derived glasses in the system Na2O-B2O3-SiO2

    Science.gov (United States)

    Mukherjee, S. P.

    1983-01-01

    The containerless melting of high-purity multicomponent homogeneous gels and gel monoliths offers a unique approach to making ultrapure multicomponent optical glasses in the reduced gravity environment of space. Procedures for preparing and characterizing gels and gel-derived glasses in the system Na2O-B2O3-SiO2 are described. Preparation is based on the polymerization reactions of alkoxysilane with trimethyl borate or boric acid and a suitable sodium compound. The chemistry of the gelling process is discussed in terms of process parameters and the gel compositions. The physicochemical nature of gels prepared by three different procedures was found to be significantly different. Infrared absorption spectra indicate finite differences in the molecular structures of the different gels. The melting of the gel powders and the transformation of porous gel monoliths to transparent 'glass' without melting are described.

  15. OB CITY-Definition of a Family-Based Intervention for Childhood Obesity Supported by Information and Communication Technologies.

    Science.gov (United States)

    Hu, Ruofei; Cancela, Jorge; Arredondo Waldmeyer, Maria Teresa; Cea, Gloria; Vlachopapadopoulou, Elpis-Athina; Fotiadis, Dimitrios I; Fico, Giuseppe

    2016-01-01

    Childhood obesity is becoming one of the 21st century's most important public health problems. Nowadays, the main treatment of childhood obesity is behavior intervention that aims at improve children's lifestyle to arrest the disease. Information and communication technologies (ICTs) have not been widely employed in this intervention, and most of existing ICTs systems are not having a long-term effect. The purpose of this paper is to define a system to support family-based intervention through a state-of-the-art analysis of family-based interventions and related technological solutions first, and then using the analytic hierarchy process to derive a childhood obesity family-based behavior intervention model, and finally to provide a prototype of a system called OB CITY. The system makes use of applied behavior analysis, affective computing technologies, as well as serious game and gamification techniques, to offer long term services in all care dimensions of the family-based behavioral intervention aiming to provide positive effects to the treatment of childhood obesity.

  16. An ALMA continuum survey of circumstellar disks in the upper Scorpius OB association

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, John M.; Ricci, Luca; Isella, Andrea [Department of Astronomy, California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States)

    2014-05-20

    We present ALMA 880 μm continuum observations of 20 K- and M-type stars in the Upper Scorpius OB association (Upper Sco) that are surrounded by protoplanetary disks. These data are used to measure the dust content in disks around low-mass stars (0.1-1.6 M {sub ☉}) at a stellar age of 5-11 Myr. Thirteen sources were detected in the 880 μm dust continuum at ≥3σ with inferred dust masses between 0.3 and 52 M {sub ⊕}. The dust masses tend to be higher around the more massive stars, but the significance is marginal in that the probability of no correlation is p ≈ 0.03. The evolution in the dust content in disks was assessed by comparing the Upper Sco observations with published continuum measurements of disks around ∼1-2 Myr stars in the Class II stage in the Taurus molecular cloud. While the dust masses in the Upper Sco disks are on average lower than in Taurus, any difference in the dust mass distributions is significant at less than 3σ. For stellar masses between 0.49 M {sub ☉} and 1.6 M {sub ☉}, the mean dust mass in disks is lower in Upper Sco relative to Taurus by Δlog M {sub dust} = 0.44 ± 0.26.

  17. DIRECT IMAGING AND SPECTROSCOPY OF A YOUNG EXTRASOLAR KUIPER BELT IN THE NEAREST OB ASSOCIATION

    International Nuclear Information System (INIS)

    Currie, Thayne; Lisse, Carey M.; Kuchner, Marc; Madhusudhan, Nikku; Kenyon, Scott J.; Thalmann, Christian; Carson, Joseph; Debes, John

    2015-01-01

    We describe the discovery of a bright, young Kuiper belt–like debris disk around HD 115600, a ∼1.4–1.5 M ⊙ , ∼15 Myr old member of the Sco–Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the Gemini Planet Imager shows the ring has a (luminosity-scaled) semimajor axis of (∼22 AU) ∼ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral-scattering dust, is eccentric (e ∼ 0.1–0.2), and could be sculpted by analogs to the outer solar system planets. Spectroscopy of the disk ansae reveal a slightly blue to gray disk color, consistent with major Kuiper belt chemical constituents, where water ice is a very plausible dominant constituent. Besides being the first object discovered with the next generation of extreme adaptive optics systems (i.e., SCExAO, GPI, SPHERE), HD 115600's debris ring and planetary system provide a key reference point for the early evolution of the solar system, the structure, and composition of the Kuiper belt and the interaction between debris disks and planets

  18. DIRECT IMAGING AND SPECTROSCOPY OF A YOUNG EXTRASOLAR KUIPER BELT IN THE NEAREST OB ASSOCIATION

    Energy Technology Data Exchange (ETDEWEB)

    Currie, Thayne [National Astronomical Observatory of Japan, Subaru Telescope, Hilo, HI (United States); Lisse, Carey M. [Applied Physics Laboratory, The Johns Hopkins University, Laurel, MD (United States); Kuchner, Marc [NASA Goddard Space Flight Center, Greenbelt, MD (United States); Madhusudhan, Nikku [Institute for Astronomy, University of Cambridge, Cambridge (United Kingdom); Kenyon, Scott J. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Thalmann, Christian [ETH-Zurich, Zurich (Switzerland); Carson, Joseph [Department of Physics and Astronomy, The College of Charleston, Charleston, SC (United States); Debes, John [Space Telescope Science Institute, Baltimore, MD (United States)

    2015-07-01

    We describe the discovery of a bright, young Kuiper belt–like debris disk around HD 115600, a ∼1.4–1.5 M{sub ⊙}, ∼15 Myr old member of the Sco–Cen OB Association. Our H-band coronagraphy/integral field spectroscopy from the Gemini Planet Imager shows the ring has a (luminosity-scaled) semimajor axis of (∼22 AU) ∼ 48 AU, similar to the current Kuiper belt. The disk appears to have neutral-scattering dust, is eccentric (e ∼ 0.1–0.2), and could be sculpted by analogs to the outer solar system planets. Spectroscopy of the disk ansae reveal a slightly blue to gray disk color, consistent with major Kuiper belt chemical constituents, where water ice is a very plausible dominant constituent. Besides being the first object discovered with the next generation of extreme adaptive optics systems (i.e., SCExAO, GPI, SPHERE), HD 115600's debris ring and planetary system provide a key reference point for the early evolution of the solar system, the structure, and composition of the Kuiper belt and the interaction between debris disks and planets.

  19. CARINA OB STARS: X-RAY SIGNATURES OF WIND SHOCKS AND MAGNETIC FIELDS

    International Nuclear Information System (INIS)

    Gagne, Marc; Fehon, Garrett; Savoy, Michael R.; Cohen, David H.; Townsley, Leisa K.; Broos, Patrick S.; Povich, Matthew S.; Corcoran, Michael F.; Walborn, Nolan R.; Remage Evans, Nancy; Moffat, Anthony F. J.; Naze, Yael; Oskinova, Lida M.

    2011-01-01

    The Chandra Carina Complex contains 200 known O- and B-type stars. The Chandra survey detected 68 of the 70 O stars and 61 of 127 known B0-B3 stars. We have assembled a publicly available optical/X-ray database to identify OB stars that depart from the canonical L X /L bol relation or whose average X-ray temperatures exceed 1 keV. Among the single O stars with high kT we identify two candidate magnetically confined wind shock sources: Tr16-22, O8.5 V, and LS 1865, O8.5 V((f)). The O4 III(fc) star HD 93250 exhibits strong, hard, variable X-rays, suggesting that it may be a massive binary with a period of >30 days. The visual O2 If* binary HD 93129A shows soft 0.6 keV and hard 1.9 keV emission components, suggesting embedded wind shocks close to the O2 If* Aa primary and colliding wind shocks between Aa and Ab. Of the 11 known O-type spectroscopic binaries, the long orbital-period systems HD 93343, HD 93403, and QZ Car have higher shock temperatures than short-period systems such as HD 93205 and FO 15. Although the X-rays from most B stars may be produced in the coronae of unseen, low-mass pre-main-sequence companions, a dozen B stars with high L X cannot be explained by a distribution of unseen companions. One of these, SS73 24 in the Treasure Chest cluster, is a new candidate Herbig Be star.

  20. Vitamin A decreases pre-receptor amplification of glucocorticoids in obesity: study on the effect of vitamin A on 11beta-hydroxysteroid dehydrogenase type 1 activity in liver and visceral fat of WNIN/Ob obese rats

    Directory of Open Access Journals (Sweden)

    Ayyalasomayajula Vajreswari

    2011-06-01

    Full Text Available Abstract Background 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1 catalyzes the conversion of inactive glucocorticoids to active glucocorticoids and its inhibition ameliorates obesity and metabolic syndrome. So far, no studies have reported the effect of dietary vitamin A on 11β-HSD1 activity in visceral fat and liver under normal and obese conditions. Here, we studied the effect of chronic feeding of vitamin A-enriched diet (129 mg/kg diet on 11β-HSD1 activity in liver and visceral fat of WNIN/Ob lean and obese rats. Methods Male, 5-month-old, lean and obese rats of WNIN/Ob strain (n = 16 for each phenotype were divided into two subgroups consisting of 8 rats of each phenotype. Control groups received stock diet containing 2.6 mg vitamin A/kg diet, where as experimental groups received diet containing 129 mg vitamin A/Kg diet for 20 weeks. Food and water were provided ad libitum. At the end of the experiment, tissues were collected and 11β-HSD1 activity was assayed in liver and visceral fat. Results Vitamin A supplementation significantly decreased body weight, visceral fat mass and 11β-HSD1 activity in visceral fat of WNIN/Ob obese rats. Hepatic 11β-HSD1 activity and gene expression were significantly reduced by vitamin A supplementation in both the phenotypes. CCAAT/enhancer binding protein α (C/EBPα, the main transcription factor essential for the expression of 11β-HSD1, decreased in liver of vitamin A fed-obese rats, but not in lean rats. Liver × receptor α (LXRα, a nuclear transcription factor which is known to downregulate 11β-HSD1 gene expression was significantly increased by vitamin A supplementation in both the phenotypes. Conclusions This study suggests that chronic consumption of vitamin A-enriched diet decreases 11β-HSD1 activity in liver and visceral fat of WNIN/Ob obese rats. Decreased 11β-HSD1 activity by vitamin A may result in decreased levels of active glucocorticoids in adipose tissue and possibly

  1. Late Paleozoic closure of the Ob-Zaisan Ocean along the Irtysh/Chara shear zone and implications for arc amalgamation and oroclinal bending in the western Central Asian Orogenic Belt

    Science.gov (United States)

    Li, Pengfei; Sun, Min; Rosenbaum, Gideon

    2016-04-01

    The Irtysh/Chara Shear Zone is one of the largest strike-slip systems in the Central Asian Orogenic Belt (CAOB). It records collisional processes of the peri-Siberian orogenic system with the West Junggar-Kazakhstan-Tianshan orogenic system following the closure of the Ob-Zaisan Ocean, but the exact timing of these events remains enigmatic. We conducted detailed structural analysis along the Irtysh Shear Zone (NW China), which together with new geochronological data allows us to reconstruct the tectonic evolution during the final closure of the Ob-Zaisan Ocean. Our results showed that subduction-accretion processes lasted at least until the Late Carboniferous in the Chinese Altai and the East/West Junggar. The subsequent arc amalgamation is characterized by a cycle of crustal thickening, orogenic collapse and transpressional thickening. On a larger scale, the West Junggar- Kazakhstan -Tianshan orogenic system defines a U-shape oroclinal structure (e.g. Xiao et al., 2010). A major phase of oroclinal bending that involved ~110° rotation may have occurred during the Late Devonian to Early Carboniferous (Levashova et al., 2012). Previous authors have linked oroclinal bending with the late Paleozoic amalgamation of the western CAOB, and proposed that a quasi-linear West Junggar- Kazakhstan -Tianshan orogenic system was buckled during the convergence of the Siberian and Tarim cratons following the closure of the Ob-Zaisan Ocean (in the north) and the South Tianshan Ocean (in the south) (e.g. Abrajevitch et al., 2008). This model, however, is not supported by our new data that constrain the closure of the Ob-Zaisan Ocean to the Late Carboniferous. Alternatively, we propose that oroclinal bending may have involved two phases of bending, with the ~110° rotation in the Late Devonian to Early Carboniferous possibly associated with trench retreat. Further tightening may have occurred in response to the convergence of the Siberian and Tarim cratons during the Late

  2. A WIDE-FIELD NARROWBAND OPTICAL SURVEY OF THE BRAID NEBULA STAR FORMATION REGION IN CYGNUS OB7

    International Nuclear Information System (INIS)

    Magakian, Tigran Yu.; Nikogossian, Elena H.; Movsessian, Tigran; Aspin, Colin; Pyo, Tae-Soo; Khanzadyan, Tigran; Smith, Michael D.; Mitchison, Sharon; Davis, Chris J.; Beck, Tracy L.; Moriarty-Schieven, Gerald H.

    2010-01-01

    We study the population of Herbig-Haro (HH) flows and jets in an area of Cygnus OB7 designated the Braid Nebula star formation region. This complex forms part of the L 1003 dark cloud, and hosts two FU Orionis (FUor)-like objects as well as several other active young stars. To trace outflow activity and to relate both known and newly discovered flows to young star hosts we intercompare new, deep, narrowband Hα and [S II] optical images taken on the Subaru 8 m Telescope on Mauna Kea, Hawaii. Our images show that there is considerable outflow and jet activity in this region suggesting the presence of an extensive young star population. We confirm that both of the FUor-like objects drive extensive HH flows and document further members of the flows in both objects. The L 1003 star formation complex is a highly kinematically active region with young stars in several different stages of evolution. We trace collimated outflows from numerous young stars although the origin of some HH objects remains elusive.

  3. OB CITY–Definition of a Family-Based Intervention for Childhood Obesity Supported by Information and Communication Technologies

    Science.gov (United States)

    Hu, Ruofei; Cancela, Jorge; Cea, Gloria; Vlachopapadopoulou, Elpis-Athina; Fotiadis, Dimitrios I.; Fico, Giuseppe

    2016-01-01

    Childhood obesity is becoming one of the 21st century’s most important public health problems. Nowadays, the main treatment of childhood obesity is behavior intervention that aims at improve children’s lifestyle to arrest the disease. Information and communication technologies (ICTs) have not been widely employed in this intervention, and most of existing ICTs systems are not having a long-term effect. The purpose of this paper is to define a system to support family-based intervention through a state-of-the-art analysis of family-based interventions and related technological solutions first, and then using the analytic hierarchy process to derive a childhood obesity family-based behavior intervention model, and finally to provide a prototype of a system called OB CITY. The system makes use of applied behavior analysis, affective computing technologies, as well as serious game and gamification techniques, to offer long term services in all care dimensions of the family-based behavioral intervention aiming to provide positive effects to the treatment of childhood obesity. PMID:27602306

  4. DUST PROPERTIES AND DISK STRUCTURE OF EVOLVED PROTOPLANETARY DISKS IN Cep OB2: GRAIN GROWTH, SETTLING, GAS AND DUST MASS, AND INSIDE-OUT EVOLUTION

    International Nuclear Information System (INIS)

    Sicilia-Aguilar, Aurora; Henning, Thomas; Dullemond, Cornelis P.; Bouwman, Jeroen; Sturm, Bernhard; Patel, Nimesh; Juhász, Attila

    2011-01-01

    We present Spitzer/Infrared Spectrograph spectra of 31 T Tauri stars (TTS) and IRAM/1.3 mm observations for 34 low- and intermediate-mass stars in the Cep OB2 region. Including our previously published data, we analyze 56 TTS and 3 intermediate-mass stars with silicate features in Tr 37 (∼4 Myr) and NGC 7160 (∼12 Myr). The silicate emission features are well reproduced with a mixture of amorphous (with olivine, forsterite, and silica stoichiometry) and crystalline grains (forsterite, enstatite). We explore grain size and disk structure using radiative transfer disk models, finding that most objects have suffered substantial evolution (grain growth, settling). About half of the disks show inside-out evolution, with either dust-cleared inner holes or a radially dependent dust distribution, typically with larger grains and more settling in the innermost disk. The typical strong silicate features nevertheless require the presence of small dust grains, and could be explained by differential settling according to grain size, anomalous dust distributions, and/or optically thin dust populations within disk gaps. M-type stars tend to have weaker silicate emission and steeper spectral energy distributions than K-type objects. The inferred low dust masses are in a strong contrast with the relatively high gas accretion rates, suggesting global grain growth and/or an anomalous gas-to-dust ratio. Transition disks in the Cep OB2 region display strongly processed grains, suggesting that they are dominated by dust evolution and settling. Finally, the presence of rare but remarkable disks with strong accretion at old ages reveals that some very massive disks may still survive to grain growth, gravitational instabilities, and planet formation.

  5. The structure of SSO2064, the first representative of Pfam family PF01796, reveals a novel two-domain zinc-ribbon OB-fold architecture with a potential acyl-CoA-binding role

    International Nuclear Information System (INIS)

    Krishna, S. Sri; Aravind, L.; Bakolitsa, Constantina; Caruthers, Jonathan; Carlton, Dennis; Miller, Mitchell D.; Abdubek, Polat; Astakhova, Tamara; Axelrod, Herbert L; Chiu, Hsiu-Ju; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Feuerhelm, Julie; Grant, Joanna C.; Han, Gye Won; Jaroszewski, Lukasz; Jin, Kevin K.; Klock, Heath E.; Knuth, Mark W.; Kumar, Abhinav; Marciano, David; McMullan, Daniel; Morse, Andrew T.; Nigoghossian, Edward; Okach, Linda; Reyes, Ron; Rife, Christopher L.; Bedem, Henry van den; Weekes, Dana; Xu, Qingping; Hodgson, Keith O.; Wooley, John; Elsliger, Marc-André; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.

    2010-01-01

    The crystal structure of SSO2064, the first structural representative of Pfam family PF01796 (DUF35), reveals a two-domain architecture comprising an N-terminal zinc-ribbon domain and a C-terminal OB-fold domain. Analysis of the domain architecture, operon organization and bacterial orthologs combined with the structural features of SSO2064 suggests a role involving acyl-CoA binding for this family of proteins. SSO2064 is the first structural representative of PF01796 (DUF35), a large prokaryotic family with a wide phylogenetic distribution. The structure reveals a novel two-domain architecture comprising an N-terminal, rubredoxin-like, zinc ribbon and a C-terminal, oligonucleotide/oligosaccharide-binding (OB) fold domain. Additional N-terminal helical segments may be involved in protein–protein interactions. Domain architectures, genomic context analysis and functional evidence from certain bacterial representatives of this family suggest that these proteins form a novel fatty-acid-binding component that is involved in the biosynthesis of lipids and polyketide antibiotics and that they possibly function as acyl-CoA-binding proteins. This structure has led to a re-evaluation of the DUF35 family, which has now been split into two entries in the latest Pfam release (v.24.0)

  6. NEAR-INFRARED VARIABILITY IN YOUNG STARS IN CYGNUS OB7

    Energy Technology Data Exchange (ETDEWEB)

    Rice, Thomas S. [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Wolk, Scott J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin [Institute for Astronomy, University of Hawaii at Manoa, 640 N Aohoku Pl, Hilo, HI 96720 (United States)

    2012-08-10

    We present the first results from a 124 night J, H, K near-infrared monitoring campaign of the dark cloud L 1003 in Cygnus OB7, an active star-forming region. Using three seasons of UKIRT observations spanning 1.5 years, we obtained high-quality photometry on 9200 stars down to J = 17 mag, with photometric uncertainty better than 0.04 mag. On the basis of near-infrared excesses from disks, we identify 30 pre-main-sequence stars, including 24 which are newly discovered. We analyze those stars and find that the NIR excesses are significantly variable. All 9200 stars were monitored for photometric variability; among the field star population, {approx}160 exhibited near-infrared variability (1.7% of the sample). Of the 30 young stellar objects (YSOs), 28 of them (93%) are variable at a significant level. Of the 30 YSOs, twenty-five have near-infrared excess consistent with simple disk-plus-star classical T Tauri models. Nine of these (36%) drift in color space over the course of these observations and/or since Two Micron All Sky Survey observations such that they cross the boundary defining the NIR excess criteria; effectively, they have a transient near-infrared excess. Thus, time-series JHK observations can be used to obtain a more complete sample of disk-bearing stars than single-epoch JHK observations. About half of the YSOs have color-space variations parallel to either the classical T Tauri star locus or a hybrid track which includes the dust reddening trajectory. This indicates that the NIR variability in YSOs that possess accretion disks arises from a combination of variable extinction and changes in the inner accretion disk: either in accretion rate, central hole size, and/or the inclination of the inner disk. While some variability may be due to stellar rotation, the level of variability on the individual stars can exceed a magnitude. This is a strong empirical suggestion that protoplanetary disks are quite dynamic and exhibit more complex activity on short

  7. A Deuteration Survey of Starless Clumps in GemOB1 and the First Quadrant

    Science.gov (United States)

    Henrici, Andrew; Shirley, Yancy L.; Svoboda, Brian

    2018-01-01

    One very strong chemical process in star-forming regions is the fractionation of deuterium in molecules, which results in an increase in the deuterium ratio many orders of magnitude over the ISM [D]/[H] ratio and provides a chemical probe of cold, dense regions. Recent maps of dust continuum emission at (sub)millimeter wavelengths have identified tens of thousands of dense clumps of gas and dust. By comparing these regions to infrared and radio surveys, we have identified starless clump candidates which have no evidence for embedded star formation. These objects represent the earliest phase of star formation throughout the Milky Way. One benefit of the Milky Way surveys is that it is also possible to study the chemistry of entire core and clump populations within a single cloud. We used the 10m Heinrich Hertz Submillimeter Telescope to survey starless clump candidates in the First Quadrant identified from the Bolocam Galactic Plane Survey 1.1 mm continuum in the deuterated molecular transitions of DCO+ 3-2 and N2D+ 3-2. We also survey the entire clump population of the Gemini OB1 molecular cloud. In both surveys, we compared detection statistics and compare deuteration fraction to physical properties of the clumps and their evolutionary stage. High resolution ALMA observations of 9 starless clump candidates of the same lines are used to analyze how the cold deuterated gas is spatially distributed in these clumps.

  8. Spatial clustering of summer temperature maxima from the CNRM-CM5 climate model ensembles & E-OBS over Europe

    Directory of Open Access Journals (Sweden)

    Margot Bador

    2015-09-01

    Full Text Available Reducing the dimensionality of the complex spatio-temporal variables associated with climate modeling, especially ensembles of climate models, is a challenging and important objective. For studies of detection and attribution, it is especially important to maintain information related to the extreme values of the atmospheric processes. Typical methods for data reduction involve summarizing climate model output information through means and variances, which does not preserve any information about the extremes. In order to help solve this challenge, a dependence summary measure appropriate for extreme values must be inferred. Here, we adapt one such measure from a recent study to a larger domain with a different variable and gridded data from observations and climate model ensembles, i.e. E-OBS observations and the CNRM-CM5 model. The handling of such ensembles of data is proposed, as well as a comparison of the spatial clusterings between two different ensembles, here a present-day and a future ensemble of climate simulations. This method yields valid information concerning extremes, while greatly reducing the data set.

  9. VizieR Online Data Catalog: Extinction law in the Cep OB3b young cluster (Allen+, 2014)

    Science.gov (United States)

    Allen, T. S.; Prchlik, J. J.; Megeath, S. T.; Gutermuth, R. A.; Pipher, J. L.; Naylor, T.; Jeffries, R. D.

    2017-06-01

    We use Johnson V and Cousins Rc (hereafter called VR) band phot from the Isaac Newton Telescope (INT), compiled in the catalog of Littlefair et al. (2010, J/MNRAS/403/545). The R-band photometry was obtained using the Sloan r filter. It was calibrated against photometric standard stars measured in the Cousins Rc filter with an arbitrary zero point. Moderate resolution ((λ/Δλ)~1000-2000, FWHM resolution of about 6 Å) optical spectra (covering 4000-9000 Å) were obtained for ~1700 sources toward Cep OB3b using the multi-fiber spectrograph Hectospec on the MMT telescope. About 600 sources were selected for observation because they were determined to be possible cluster members (Allen et al. 2012, J/ApJ/750/125), based on indicators of youth, such as IR emission due to circumstellar dusty material and heightened X-ray activity. We use an extinction map from Allen et al. (2012, J/ApJ/750/125) to initially estimate the extinction toward each source. This map is derived using the 2MASS Point Source Catalog (Skrutskie et al. 2006AJ....131.1163S, Cat. VII/233) H and Ks band photometry of background stars. (1 data file).

  10. [Comparing the Application of Hema-Obs RSS to 250 Pregnancies from Obstetrics/Hematology Consultation in Centro Hospitalar São João, Portugal with the Application of Galit Sarig RSS to 90 Pregnancies from Rambam Health Care Campus, Israel].

    Science.gov (United States)

    Salselas, Ana; Pestana, Inês; Bischoff, Francisco; Guimarães, Mariana; Andrade, Joaquim Aguiar

    2015-01-01

    Pregnant women with thromboembolic diseases, previous thrombotic episodes or thrombophilia family history were supervised in a multidisciplinary Obstetrics/ Hematology consultation in Centro Hospitalar São João EPE, Porto, Portugal. For the evaluation and medication of these women, a risk stratification scale was used. The aim of this study was to validate a Risk Stratification Scale and thromboprophylaxis protocol by means of comparing it with a similar scale, developed and published by Sarig. We have compared: The distribution, by risk groups, obtained through the application of the two scales on pregnant women followed at Centro Hospitalar São João, Porto, Portugal, consultation; the sensibility and specificity for each one of the scales (DeLong scale, applied to Receiver Operating Characteristic) curves; the outcomes in pregnancies followed in Hospital São João, Porto, PortugalResults: According to our Hema-Obs risk stratification scale, 29% were allocated to low-risk, 47% to high-risk and 24% to very-high-risk groups. According to Galit Sarig risk stratification scale, 24% were considered low-risk, 53% moderate, 16% high-risk and 7% as very high-risk group. In our study we observed 9% of spontaneous abortions, in comparison with 18% in the Galit Sarig cohort. From the application of Receiver Operating Characteristic curve to both risk stratification scales, the results of the calculated areas were 58,8% to our Hema-Obs risk stratification scale and 38,7% to Galit Sarig risk stratification scale, with a Delong test significancie of p = 0.0006. We concluded that Hema-Obs risk stratification scale is an effective support for clinical monitoring of therapeutic strategies.

  11. Concentration urinaire de bisphénol A et obésité chez les adultes : résultats de l’Enquête canadienne sur les mesures de la santé

    Directory of Open Access Journals (Sweden)

    Minh T. Do

    2017-01-01

    Full Text Available Introduction : Des études chez l’animal ont révélé que l’exposition au bisphénol A (BPA affecte le métabolisme des lipides et favorise la prise de poids. Des études épidémiologiques récentes appuient aussi l’existence d’un lien entre le BPA et l’obésité chez l’humain, mais la plupart d’entre elles se limitent à une seule mesure de l’adiposité ou ne tiennent pas compte des facteurs de confusion alimentaires possibles. Cette étude vise à examiner les associations entre les concentrations urinaires de BPA et les mesures de l’adiposité dans un échantillon national représentatif des adultes canadiens. Méthodologie : Nous avons réalisé des analyses à l’aide de données de biosurveillance et de données anthropométriques mesurées directement auprès de 4 733 adultes de 18 à 79 ans dans le cadre de l’Enquête canadienne sur les mesures de la santé (2007-2011. Nous avons utilisé des modèles de régression logistique multinomiale et binaire pour estimer les associations entre, d’une part, les concentrations urinaires de BPA et, d’autre part, les diverses catégories d’indice de masse corporelle (IMC (embonpoint par opposition à poids insuffisant ou normal; obésité par opposition à poids insuffisant ou normal et un tour de taille élevé (102 cm ou plus pour les hommes; 88 cm ou plus pour les femmes en tenant compte des facteurs de confusion possibles. Des analyses de régression linéaire ont aussi été effectuées pour évaluer les associations entre les concentrations urinaires de BPA et des mesures de l’IMC et du tour de taille. Résultats : On a pu associer positivement la concentration urinaire de BPA et l’obésité (définie par l’IMC. Le rapport de cotes s’est situé à 1,54 (intervalle de confiance [IC] à 95 % : 1,002 à 2,37 dans le quartile de BPA le plus élevé par rapport au plus bas (test de tendance, p = 0,041. La concentration urinaire de BPA n’a pas été associ

  12. Primary successions of vegetation on technogenic sand patches in oil and gas producing districts of the middle Ob' river basin

    Energy Technology Data Exchange (ETDEWEB)

    Shilova, I I

    1977-11-01

    Intensive economic exploitation of the natural resources of the oil-and-gas producing districts of the central Ob' basin has led to increased exposure of sandy patches over the landscape. These sandy areas are becoming a common site. Technogenic factors involved include, for example, construction projects, oil-drilling and the like. Exposure is accelerated by wind and water erosion. Efforts are underway to reintroduce verdure in the region, and a study has been underway of the features of the ecotope and the stages of natural overgrowth of the area of reclamation. This overgrowth is proceeding well. Vegetation is of the syngenetic succession type, involving four successive stages and formation of associations of a zonal character. Seventy-four species of yeast, 2 species of fungi, 2 of lichens, 19 of Bryophyton and 106 of vascular spore- and covered-seed plants of the area have been recorded, and are tabulated. Recultivation will require due attention to existing conditions. 14 references.

  13. Biogeochemical migration of heavy metals, Ti, V, Mo, Ta, W, and U, in the profile of a low-laid peatbog in the country between the Ob and Tom rivers

    International Nuclear Information System (INIS)

    Efremova, T.T.; Efremov, S.P.; Koutsenogii, K.P.; Peresedov, V.F.

    2003-01-01

    Biogeochemical migration of heavy metals in the course of marsh formation is mainly determined by physical-chemical processes, such as the oxidation-reduction zonality of the peatbog thickness and the state of humous substances (the quality of humus adsorptive barriers). In the process of peatbog formation V, U, Ta are the weakly captured elements while Mo is captured to a relatively higher extent. Elements as Ti and W are found in separate layers. No technogenic degradation of the marsh ecosystem in the Ob and Tom has been observed. (author)

  14. Extended Gamma-Ray Emission from the G25.0+0.0 Region: A Star-forming Region Powered by the Newly Found OB Association?

    Energy Technology Data Exchange (ETDEWEB)

    Katsuta, J. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Uchiyama, Y. [Rikkyo University, Nishi-Ikebukuro, Toshima-ku, Tokyo 171-8501 (Japan); Funk, S., E-mail: katsuta@hep01.hepl.hiroshima-u.ac.jp [Erlangen Centre for Astroparticle Physics, D-91058 Erlangen (Germany)

    2017-04-20

    We report a study of extended γ -ray emission with the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope , which is likely to be the second case of a γ -ray detection from a star-forming region (SFR) in our Galaxy. The LAT source is located in the G25 region, 1.°7 × 2.°1 around ( l , b ) = (25.°0, 0.°0). The γ -ray emission is found to be composed of two extended sources and one pointlike source. The extended sources have similar sizes of about 1.°4 × 0.°6. An ∼0.°4 diameter subregion of one has a photon index of Γ = 1.53 ± 0.15, and is spatially coincident with HESS J1837−069, likely a pulsar wind nebula. The other parts of the extended sources have a photon index of Γ = 2.1 ± 0.2 without significant spectral curvature. Given their spatial and spectral properties, they have no clear associations with sources at other wavelengths. Their γ -ray properties are similar to those of the Cygnus cocoon SFR, the only firmly established γ -ray detection of an SFR in the Galaxy. Indeed, we find bubble-like structures of atomic and molecular gas in G25, which may be created by a putative OB association/cluster. The γ -ray emitting regions appear confined in the bubble-like structure; similar properties are also found in the Cygnus cocoon. In addition, using observations with the XMM-Newton , we find a candidate young massive OB association/cluster G25.18+0.26 in the G25 region. We propose that the extended γ -ray emission in G25 is associated with an SFR driven by G25.18+0.26. Based on this scenario, we discuss possible acceleration processes in the SFR and compare them with the Cygnus cocoon.

  15. Gels and gel-derived glasses in the Na2O-B2O3-SiO2 system. [containerless melting in space

    Science.gov (United States)

    Mukherjee, S. P.

    1982-01-01

    The containerless melting of high-purity multicomponent homogeneous gels and gel-monoliths offers a unique approach to making ultrapure multicomponent optical glasses in the reduced gravity environment of space. Procedures for preparing and characterizing gels and gel-derived glasses in the Na2O-B2O3-SiO2 system are described. Preparation is based on the polymerization reactions of alkoxysilane with trimethyl borate or boric acid and a suitable sodium compound. The chemistry of the gelling process is discussed in terms of process parameters and the gel compositions. The physicochemical nature of gels prepared by three different procedures were found to be significantly different. IR absorption spectra indicate finite differences in the molecular structures of the different gels. The melting of the gel powders and the transformation of porous gel-monoliths to transparent 'glass' without melting are described.

  16. NEAR-INFRARED PERIODIC AND OTHER VARIABLE FIELD STARS IN THE FIELD OF THE CYGNUS OB7 STAR-FORMING REGION

    Energy Technology Data Exchange (ETDEWEB)

    Wolk, Scott J.; Rice, Thomas S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin A. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States)

    2013-04-15

    We present a subset of the results of a three-season, 124 night, near-infrared monitoring campaign of the dark clouds Lynds 1003 and Lynds 1004 in the Cygnus OB7 star-forming region. In this paper, we focus on the field star population. Using three seasons of UKIRT J, H, and K-band observations spanning 1.5 years, we obtained high-quality photometry on 9200 stars down to J = 17 mag, with photometric uncertainty better than 0.04 mag. After excluding known disk-bearing stars we identify 149 variables-1.6% of the sample. Of these, about 60 are strictly periodic, with periods predominantly <2 days. We conclude this group is dominated by eclipsing binaries. A few stars have long period signals of between 20 and 60 days. About 25 stars have weak modulated signals, but it was not clear if these were periodic. Some of the stars in this group may be diskless young stellar objects with relatively large variability due to cool starspots. The remaining {approx}60 stars showed variations which appear to be purely stochastic.

  17. CSO BOLOCAM 1.1 mm CONTINUUM MAPPING OF THE BRAID NEBULA STAR FORMATION REGION IN CYGNUS OB7

    International Nuclear Information System (INIS)

    Aspin, Colin; Beck, Tracy L.; Davis, Chris J.

    2011-01-01

    We present a 1.1 mm map of the Braid Nebula star formation region in Cygnus OB7 taken using Bolocam on the Caltech Submillimeter Observatory. Within the 1 deg 2 covered by the map, we have detected 55 cold dust clumps all of which are new detections. A number of these clumps are coincident with IRAS point sources although the majority are not. Some of the previously studied optical/near-IR sources are detected at 1.1 mm. We estimate total dust/gas masses for the 55 clumps together with peak visual extinctions. We conclude that over the whole region, approximately 20% of the clumps are associated with IRAS sources suggesting that these are protostellar objects. The remaining 80% are classed as starless clumps. In addition, both FU Orionis (FUor) like objects in the field, the Braid Star and HH 381 IRS, are associated with strong millimeter emission. This implies that FUor eruptions can occur at very early stages of pre-main-sequence life. Finally, we determine that the cumulative clump mass function for the region is very similar to that found in both the Perseus and ρ Ophiuchus star-forming regions.

  18. Ocena prostorske razsežnosti žledoloma februarja 2014 v bukovih in smrekovih sestojih v občinah Tolmin in Dobrova - Polhov Gradec s pomočjo tehnologije daljinskega zaznavanja

    OpenAIRE

    Šafran, Aljoša

    2018-01-01

    V magistrskem delu obravnavamo žledolom, ki je ob koncu januarja in začetku februarja 2014 povzročil gmotno škodo ne le na vegetaciji, temveč tudi na energetski in železniški infrastrukturi. Po dosedanjih ocenah gre za enega izmed najobsežnejših žledolomov na območju Slovenije v zadnjih desetletjih. V raziskavi nas je zanimala prostorska razporeditev sprememb v biomasi bukovih in smrekovih sestojev na z žledom prizadetih območjih, zaznanih s pomočjo satelita Landsat. V raziskavo sta bili zaje...

  19. FITspec: A New Algorithm for the Automated Fit of Synthetic Stellar Spectra for OB Stars

    Science.gov (United States)

    Fierro-Santillán, Celia R.; Zsargó, Janos; Klapp, Jaime; Díaz-Azuara, Santiago A.; Arrieta, Anabel; Arias, Lorena; Sigalotti, Leonardo Di G.

    2018-06-01

    In this paper we describe the FITspec code, a data mining tool for the automatic fitting of synthetic stellar spectra. The program uses a database of 27,000 CMFGEN models of stellar atmospheres arranged in a six-dimensional (6D) space, where each dimension corresponds to one model parameter. From these models a library of 2,835,000 synthetic spectra were generated covering the ultraviolet, optical, and infrared regions of the electromagnetic spectrum. Using FITspec we adjust the effective temperature and the surface gravity. From the 6D array we also get the luminosity, the metallicity, and three parameters for the stellar wind: the terminal velocity ({v}∞ ), the β exponent of the velocity law, and the clumping filling factor (F cl). Finally, the projected rotational velocity (v\\cdot \\sin i) can be obtained from the library of stellar spectra. Validation of the algorithm was performed by analyzing the spectra of a sample of eight O-type stars taken from the IACOB spectroscopic survey of Northern Galactic OB stars. The spectral lines used for the adjustment of the analyzed stars are reproduced with good accuracy. In particular, the effective temperatures calculated with the FITspec are in good agreement with those derived from spectral type and other calibrations for the same stars. The stellar luminosities and projected rotational velocities are also in good agreement with previous quantitative spectroscopic analyses in the literature. An important advantage of FITspec over traditional codes is that the time required for spectral analyses is reduced from months to a few hours.

  20. The phenomenon of phase separated in Na2O-B2O3-SiO2, Na2O-SiO2-P2O5 glasses

    International Nuclear Information System (INIS)

    Procyk, B.; Bieniarz, P.; Plichta, E.; Pudelek, B.; Kucinski, G.; Staniewicz-Brudnik, B.

    1997-01-01

    During the thermal treatment, the phenomenon of phase separation has been observed in the some glasses. The glass has became opaque, due to the opalescence of phase separated. Investigations of the phenomenon of phase separation were conducted using the basic systems: Na 2 O-B 2 O 3 -SiO 2 , Na 2 O-SiO 2 -P 2 O 5 and theirs modifications. The occurrence of binodal and spinodal phase decomposition was observed by TEM. The phase separation inhomogeneities have drop-like character and with higher concentration shows a tendency for coalescence. The influence of the chemical composition, temperature and time on the phenomenon of phase separation in the investigated glasses has been defined. (author)

  1. X-RAY EMISSION FROM THE DOUBLE-BINARY OB-STAR SYSTEM QZ CAR (HD 93206)

    International Nuclear Information System (INIS)

    Parkin, E. R.; Naze, Y.; Rauw, G.; Broos, P. S.; Townsley, L. K.; Pittard, J. M.; Moffat, A. F. J.; Oskinova, L. M.; Waldron, W. L.

    2011-01-01

    X-ray observations of the double-binary OB-star system QZ Car (HD 93206) obtained with the Chandra X-ray Observatory over a period of roughly 2 years are presented. The respective orbits of systems A (O9.7 I+b2 v, P A = 21 days) and B (O8 III+o9 v, P B = 6 days) are reasonably well sampled by the observations, allowing the origin of the X-ray emission to be examined in detail. The X-ray spectra can be well fitted by an attenuated three-temperature thermal plasma model, characterized by cool, moderate, and hot plasma components at kT ≅ 0.2, 0.7, and 2 keV, respectively, and a circumstellar absorption of ≅0.2 x 10 22 cm -2 . Although the hot plasma component could be indicating the presence of wind-wind collision shocks in the system, the model fluxes calculated from spectral fits, with an average value of ≅7 x 10 -13 erg s -1 cm -2 , do not show a clear correlation with the orbits of the two constituent binaries. A semi-analytical model of QZ Car reveals that a stable momentum balance may not be established in either system A or B. Yet, despite this, system B is expected to produce an observed X-ray flux well in excess of the observations. If one considers the wind of the O8 III star to be disrupted by mass transfer, the model and observations are in far better agreement, which lends support to the previous suggestion of mass transfer in the O8 III + o9 v binary. We conclude that the X-ray emission from QZ Car can be reasonably well accounted for by a combination of contributions mainly from the single stars and the mutual wind-wind collision between systems A and B.

  2. Identificarea izolatului bacterian P5 obţinut din plante de măr

    Directory of Open Access Journals (Sweden)

    MAGHER Maria

    2016-06-01

    Full Text Available The phytopathogen Erwinia amylovora (Burrill Winslow et al. is a bacterium having a major impact on pome fruit species causing identification problems at some development phenophases of trees. The aim of this paper was to identify the bacterial isolate P5 obtained from apple tree samples using classical and modern methods recommended for the bacterium E. amylovora (API 20E test, gas chromatography, PCR, DASELISA and indirect immunofluorescence. As a result of our investigations, the bacterium Erwinia amylovora was clearly identified. Taking into consideration the quarantine status of the phytopathogen E. amylovora, it is necessary to carry out the phytosanitary test sin order to monitor the presence of fire blight on pome fruit species as well as to implement timely the required preventive and curative control measures. Rezumat. Fitopatogenul Erwinia amylovora (Burrill Winslow et al. este o bacterie cu un impact deosebit asupra speciilor pomicole sămânţoase, care prezintă probleme de identificare la anumite fenofaze de dezvoltare a pomilor. Scopul acestei lucrări a fost de a identifica izolatul bacterian P5, obţinut din probe de măr, prin metode clasice şi contemporane recomandate pentru bacteria E. amylovora (testul API 20E, gaz-cromatografie, PCR, DAS-ELISA, imunofluorescenţă indirectă. În rezultatul cercetărilor a fost identificată bacteria Erwinia amylovora. Având în vedere statutul de carantină al fitopatogenului E. amylovora, se impune necesitatea efectuării obligatorii a sondajelor fitosanitare pentru monitorizarea prezenţei focului bacterian la culturile pomicole sămânţoase şi efectuarea la timp a măsurilor preventive şi curative de combatere.

  3. HD 144548: A young triply eclipsing system in the Upper Scorpius OB association

    Science.gov (United States)

    Alonso, R.; Deeg, H. J.; Hoyer, S.; Lodieu, N.; Palle, E.; Sanchis-Ojeda, R.

    2015-12-01

    The star HD 144548 (=HIP 78977; TYP 6212-1273-1) has been known as a detached eclipsing binary and a bona-fide member of the Upper Scorpius OB association. Continuous photometry from the K2 mission on Campaign Two has revealed the presence of additional eclipses due to the presence of a third star in the system. These are explained by a system composed of the two previously known members of the eclipsing system (Ba and Bb) with a period of 1.63 d, orbiting around an F7-F8V star with a period of 33.945 ± 0.002 d in an eccentric orbit (eA = 0.2652 ± 0.0003). The timing of the eclipses of Ba and Bb reveals the same 33.9 d periodicity, which we interpret as the combination of a light time effect combined with dynamical perturbations on the close system. Here we combine radial velocities and analytical approximations for the timing of the eclipses to derive masses and radii for the three components of the system. We obtain a mass of 1.44 ± 0.04 M⊙ and radius of 2.41 ± 0.03 R⊙ for the A component, and almost identical masses and radii of about 0.96 M⊙ and 1.33 R⊙ for each of the two components of the close binary. HD 144548 is the first triply eclipsing system for which radial velocities of all components could be measured. Partially based on observations made with the Italian Telescopio Nazionale Galileo (TNG) operated by the Fundación Galileo Galilei of the INAF, the Nordic Optical Telescope, operated by the Nordic Optical Telescope Scientific Association, and the William Herschel Telescope (programme DDT58 - PI Lodieu) operated by the Isaac Newton Group on the island of La Palma at the Spanish Observatorio Roque de los Muchachos of the IAC. This paper includes data collected by the Kepler mission. Funding for the Kepler mission is provided by the NASA Science Mission directorate.Appendices are available in electronic form at http://www.aanda.org

  4. NEAR-INFRARED VARIABILITY AMONG YOUNG STELLAR OBJECTS IN THE STAR FORMATION REGION CYGNUS OB7

    Energy Technology Data Exchange (ETDEWEB)

    Wolk, Scott J.; Rice, Thomas S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States)

    2013-08-20

    We present an analysis of near-infrared time-series photometry in J, H, and K bands for about 100 epochs of a 1 Degree-Sign Multiplication-Sign 1 Degree-Sign region of the Lynds 1003/1004 dark cloud in the Cygnus OB7 region. Augmented by data from the Wide-field Infrared Survey Explorer, we identify 96 candidate disk bearing young stellar objects (YSOs) in the region. Of these, 30 are clearly Class I or earlier. Using the Wide-Field Imaging Camera on the United Kingdom Infrared Telescope, we were able to obtain photometry over three observing seasons, with photometric uncertainty better than 0.05 mag down to J Almost-Equal-To 17. We study detailed light curves and color trajectories of {approx}50 of the YSOs in the monitored field. We investigate the variability and periodicity of the YSOs and find the data are consistent with all YSOs being variable in these wavelengths on timescales of a few years. We divide the variability into four observational classes: (1) stars with periodic variability stable over long timescales, (2) variables which exhibit short-lived cyclic behavior, (3) long-duration variables, and (4) stochastic variables. Some YSO variability defies simple classification. We can explain much of the observed variability as being due to dynamic and rotational changes in the disk, including an asymmetric or changing blocking fraction, changes to the inner disk hole size, as well as changes to the accretion rate. Overall, we find that the Class I:Class II ratio of the cluster is consistent with an age of <1 Myr, with at least one individual, wildly varying source {approx}100, 000 yr old. We have also discovered a Class II eclipsing binary system with a period of 17.87 days.

  5. RPA-1 from Leishmania amazonensis (LaRPA-1) structurally differs from other eukaryote RPA-1 and interacts with telomeric DNA via its N-terminal OB-fold domain.

    Science.gov (United States)

    Pavani, R S; Fernandes, C; Perez, A M; Vasconcelos, E J R; Siqueira-Neto, J L; Fontes, M R; Cano, M I N

    2014-12-20

    Replication protein A-1 (RPA-1) is a single-stranded DNA-binding protein involved in DNA metabolism. We previously demonstrated the interaction between LaRPA-1 and telomeric DNA. Here, we expressed and purified truncated mutants of LaRPA-1 and used circular dichroism measurements and molecular dynamics simulations to demonstrate that the tertiary structure of LaRPA-1 differs from human and yeast RPA-1. LaRPA-1 interacts with telomeric ssDNA via its N-terminal OB-fold domain, whereas RPA from higher eukaryotes show different binding modes to ssDNA. Our results show that LaRPA-1 is evolutionary distinct from other RPA-1 proteins and can potentially be used for targeting trypanosomatid telomeres. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  6. SPITZER SPECTROSCOPY OF CIRCUMSTELLAR DISKS IN THE 5 Myr OLD UPPER SCORPIUS OB ASSOCIATION

    International Nuclear Information System (INIS)

    Dahm, S. E.; Carpenter, John M.

    2009-01-01

    We present mid-infrared spectra between 5.2 and 38 μm for 26 disk-bearing members of the ∼5 Myr old Upper Scorpius OB association obtained with the Infrared Spectrograph (IRS) onboard the Spitzer Space Telescope. We find clear evidence for changes in the spectral characteristics of dust emission between the early-type (B+A) and late-type (K+M) infrared excess stars. The early-type members exhibit featureless continuum excesses that become apparent redward of ∼8 μm. In contrast, 10 and 20 μm silicate features or polycyclic aromatic hydrocarbon emission are present in all but one of the late-type excess members of Upper Scorpius. The strength of silicate emission among late-type Upper Scorpius members is spectral-type dependent, with the most prominent features being associated with K5-M2-type stars. By fitting the spectral energy distributions (SED) of a representative sample of low-mass stars with accretion disk models, we find that the SEDs are consistent with models having inner disk radii ranging from ∼0.2 to 1.2 AU. Complementary high-resolution (R ∼ 33, 000) optical (λλ4800-9200) spectra for the Upper Scorpius excess stars were examined for signatures of gaseous accretion. Of the 35 infrared excess stars identified in Upper Scorpius, only seven (all late-type) exhibit definitive signatures of accretion. Mass-accretion rates for these stars were estimated to range from 10 -11 to 10 -8.9 M sun yr -1 . Compared to Class II sources in Taurus-Auriga, the disk population in Upper Scorpius exhibits reduced levels of near- and mid-infrared excess emission and an order of magnitude lower mass-accretion rates. These results suggest that the disk structure has changed significantly over the 2-4 Myr in age separating these two stellar populations. The ubiquity of depleted inner disks in the Upper Scorpius excess sample implies that such disks are a common evolutionary pathway that persists for some time.

  7. Gas expulsions and biological activity recorded offshore Molene Island, Brittany (France): video supervised recording of OBS data and analogue modelling

    Science.gov (United States)

    Klingelhoefer, F.; Géli, L.; Dellong, D.; Evangelia, B.; Tary, J. B.; Bayrakci, G.; Lantéri, N.; Lin, J. Y.; Chen, Y. F.; Chang, E. T. Y.

    2016-12-01

    Ocean bottom seismometers (OBS) commonly record signals from Short Duration Events (SDEs), having characteristics that are very different from those produced by tectonic earthquakes, e.g.: durations Brittany within the field of view of the EMSO-Molene underwater observatory, at a water depth of 12 m. The camera images and the recordings reveal the presence of crabs, octopus and several species of fish. Other acoustic signals can be related to the presence of moving algae or the influence from bad weather. Tides produce characteristic curves in the noise recorded on the geophones. SDEs have been recorded on both instruments, that may well have been caused by gas expulsions from the seabed into the water. In order to verify this hypothesis, an aquarium was filled with water overlying an even grain-sized quartz sand layer. A constant air supply through a narrow tube produced gas bubbles in a regular manner and an immersed ocean bottom geophone recorded the resulting acoustic signals. The bubbles tend to have a uniform size and to produce a waveform very close to those found on the OBSs. By comparing the number of SDEs and the volume of escaped air, estimates can be made regarding the volume of gas escaping the seafloor in different environments.

  8. Cardiac lipid accumulation associated with diastolic dysfunction in obese mice

    DEFF Research Database (Denmark)

    Christoffersen, Christina; Bollano, Entela; Lindegaard, Marie L S

    2003-01-01

    Obesity may confer cardiac dysfunction due to lipid accumulation in cardiomyocytes. To test this idea, we examined whether obese ob/ob mice display heart lipid accumulation and cardiac dysfunction. Ob/ob mouse hearts had increased expression of genes mediating extracellular generation, transport....../ob mice and 2.5 +/- 0.1 in ob/+ mice (P = 0.0001). In contrast, the indexes of systolic function and heart brain natriuretic peptide mRNA expression were only marginally affected and unaffected, respectively, in ob/ob compared with ob/+ mice. The results suggest that ob/ob mouse hearts have increased...... across the myocyte cell membrane, intracellular transport, mitochondrial uptake, and beta-oxidation of fatty acids compared with ob/+ mice. Accordingly, ob/ob mouse hearts contained more triglyceride (6.8 +/- 0.4 vs. 2.3 +/- 0.4 microg/mg; P hearts. Histological examinations...

  9. Structural study of Na2O-B2O3-SiO2 glasses from molecular simulations using a polarizable force field.

    Science.gov (United States)

    Pacaud, Fabien; Delaye, Jean-Marc; Charpentier, Thibault; Cormier, Laurent; Salanne, Mathieu

    2017-10-28

    Sodium borosilicate glasses Na 2 O-B 2 O 3 -SiO 2 (NBS) are complex systems from a structural point of view. Three main building units are present: tetrahedral SiO 4 and BO 4 (B IV ) and triangular BO 3 (B III ). One of the salient features of these compounds is the change of the B III /B IV ratio with the alkali concentration, which is very difficult to capture in force fields-based molecular dynamics simulations. In this work, we develop a polarizable force field that is able to reproduce the boron coordination and more generally the structure of several NBS systems in the glass and in the melt. The parameters of the potential are fitted from density functional theory calculations only, in contrast with the existing empirical potentials for NBS systems. This ensures a strong improvement on the transferability of the parameters from one composition to another. Using this new force field, the structure of NBS systems is validated against neutron diffraction and nuclear magnetic resonance experiments. A special focus is given to the distribution of B III /B IV with respect to the composition and the temperature.

  10. Le surpoids, l’obésité et le contrôle glycémique chez les diabétiques du centre de référence provincial de diabète (CRD), Kénitra, Maroc

    Science.gov (United States)

    Lotfi, Zeghari; Aboussaleh, Youssef; Sbaibi, Rachid; Achouri, Imane; Benguedour, Rachid

    2017-01-01

    Introduction Le diabète est définit comme un trouble de l'assimilation, de l'utilisation et du stockage des sucres apportés par l'alimentation, sa prise en charge est assurée par le suivi du surpoids et l'obésité et le contrôle glycémique régulier. L'objectif de ce travail était l'étude du surpoids, l'obésité et le contrôle glycémique chez 2227 diabétiques de différent type (type 1, 2 et gestationnel), consultants le centre de référence provincial de diabète (CRD), Kénitra-Maroc. Méthodes L'étude s'est déroulée sur une période d'une année du mois janvier au mois décembre 2015, L'évaluation du surpoids et l'obésité a été effectuée par le calcul de l'Indice de Masse Corporelle (IMC=Poids/Taille2 (Kg/m2)), elles sont définit respectivement par IMC > 25 Kg/m2, et IMC > 30 Kg/m2, le poids et la taille ont été mesurés selon les recommandations de l'organisation mondiale de santé (OMS), Le contrôle glycémique a été effectué par l'analyse sanguine de l'Hémoglobine glycosylée et de la Glycémie à jeun. Les normes sont 7% pour l'Hémoglobine glycosylée et 0,70g/l à 1,10g/l pour la Glycémie à jeun. Résultats L'intervalle d'âges des patients est compris entre 8 mois et 80 ans, avec une dominance des diabétiques provenant du milieu urbain (74%) par rapport à ceux provenant du milieu rural (26%). Le surpoids touche l'ensemble de cette population. L'IMC moyen des femmes tends vers l'obésité (IMC≈30): (29,21 Kg/m2 ± 3,1) pour le diabète gestationnel et (29,15 Kg/m2 ± 3,2) pour le diabète de type 2. Les valeurs du contrôle glycémique sont supérieures aux normes: avec 8,5% ± 2,6 > 7% pour l'hémoglobine glycosylée et 1,5 g/l ± 1,3 > 1,10g/l pour la Glycémie à jeun. La différence entre les valeurs de l'hémoglobine glycosylée entre les hommes (8,5 7% ± 2,6) et les femmes (8,1% ± 2,3) n'est pas significative (P > 0,05), même chose pour la Glycémie capillaire à jeun: pour les hommes (1,44 g/l ± 1,1) et les

  11. Borate mineral assemblages in the system Na2OCaOMgOB2O3H2O

    Science.gov (United States)

    Christ, C.L.; Truesdell, A.H.; Erd, Richard C.

    1967-01-01

    he significant known hydrated borate mineral assemblages (principally of the western United States) in the system Na2OCaOz.sbnd;MgOB2O3H2O are expressible in three ternary composition diagrams. Phase rule interpretation of the diagrams is consistent with observation, if the activity of H2O is generally considered to be determined by the geologic environment. The absence of conflicting tie-lines on a diagram indicates that the several mineral assemblages of the diagram were formed under relatively narrow ranges of temperature and pressure. The known structural as well as empirical formulas for the minerals are listed, and the more recent (since 1960) crystal structure findings are discussed briefly. Schematic Gibbs free energy-composition diagrams based on known solubility-temperature relations in the systems Na2B4O7-H2O and Na2B4O7-NaCl-H2O, are highly useful in the interpretation and prediction of the stability relations in these systems; in particular these diagrams indicate clearly that tincalconite, although geologically important, is everywhere a metastable phase. Crystal-chemical considerations indicate that the same thermodynamic and kinetic behavior observed in the Na2B4O7-H2O system will hold in the Ca2B6O11-H2O system. This conclusion is confirmed by the petrologic evidence. The chemical relations among the mineral assemblages of a ternary diagram are expressed by a schematic "activity-activity" diagram. These activity-activity diagrams permit the tracing-out of the paragenetic sequences as a function of changing cation and H2O activities. ?? 1967.

  12. Development and implementation of an automated system to exchange attenuators of the OB85/1 gamma irradiator

    International Nuclear Information System (INIS)

    Silva Junior, Iremar A.; Ramos, Marcio A.G.; Carvalho, Valdir S.; Diniz, Raphael E.; Cescon, Claudinei T.; Vivolo, Vitor; Potiens, Maria da Penha A.

    2011-01-01

    In order to improve the calibration process of portable detectors of the Instrument Calibration Laboratory of IPEN, an automated system to exchange the attenuators of the OB85/1 irradiator system was developed. This automation was developed following this sequence: (i) development of the device with the cooperation of the IPEN Sector of Projects, using the Solid Edge software to design the mechanical part of the exchanging device of the attenuators, in 3D; (ii) simulation with the Festo's FluidSim software to define the pneumatic components and their respective actuators; (iii) machining and assembly of mechanical parts; (iv) assembly of pneumatic components and their actuators, like magnetic pneumatic cylinders, which allow the use of magnetic sensors, used to confirm the attenuators opened or closed positions: actuators 5/2 each, with double solenoid; (v) assembly of the control panel for operating the device remotely from the operating room. With this automation, the technicians in charge of the detectors calibration and research testing will have no hand contact with lead attenuators, improving the calibration process due to the decrease in time spent with manual shift from the attenuators and avoiding accidents, like the fall of the lead attenuators. It has been a concern of the LCI-IPEN group the decrease in the time spent by the technicians in the calibration room controlled areas should follow the recommendations of the radiological protection rules, which recommend the shortest time possible of workers in these areas. Automated systems have, usually, a better rate of reproducibility, due to the small participation by the system operator, so the LCI-IPEN is following the trend of several laboratories and automating its processes. (author)

  13. Seismic velocity variation along the Izu-Bonin arc estaimated from traveltime tomography using OBS data

    Science.gov (United States)

    Obana, K.; Tamura, Y.; Takahashi, T.; Kodaira, S.

    2014-12-01

    The Izu-Bonin (Ogasawara) arc is an intra-oceanic island arc along the convergent plate boundary between the subducting Pacific and overriding Philippine Sea plates. Recent active seismic studies in the Izu-Bonin arc reveal significant along-arc variations in crustal structure [Kodaira et al., 2007]. The thickness of the arc crust shows a remarkable change between thicker Izu (~30 km) and thinner Bonin (~10 km) arcs. In addition to this, several geological and geophysical contrasts, such as seafloor topography and chemical composition of volcanic rocks, between Izu and Bonin arc have been reported [e.g., Yuasa 1992]. We have conducted earthquake observations using ocean bottom seismographs (OBSs) to reveal seismic velocity structure of the crust and mantle wedge in the Izu-Bonin arc and to investigate origin of the along-arc structure variations. We deployed 40 short-period OBSs in Izu and Bonin area in 2006 and 2009, respectively. The OBS data were processed with seismic data recorded at routine seismic stations on Hachijo-jima, Aoga-shima, and Chichi-jima operated by National Research Institute for Earth Science and Disaster Prevention (NIED). More than 5000 earthquakes were observed during about three-months observation period in each experiment. We conducted three-dimensional seismic tomography using manually picked P- and S-wave arrival time data. The obtained image shows a different seismic velocity structures in the mantle beneath the volcanic front between Izu and Bonin arcs. Low P-wave velocity anomalies in the mantle beneath the volcanic front in the Izu arc are limited at depths deeper than those in the Bonin arc. On the other hand, P-wave velocity in the low velocity anomalies beneath volcanic front in the Bonin arc is slower than that in the Izu arc. These large-scale along-arc structure variations in the mantle could relate to the geological and geophysical contrasts between Izu and Bonin arcs.

  14. Breakup Style and Magmatic Underplating West of the Lofoten Islands, Norway, Based on OBS Data.

    Science.gov (United States)

    Breivik, A. J.; Faleide, J. I.; Mjelde, R.; Murai, Y.; Flueh, E. R.

    2014-12-01

    The breakup of the Northeast Atlantic in the Early Eocene was magma-rich, forming the major part of the North Atlantic Igneous Province (NAIP). This is seen as extrusive and intrusive magmatism in the continental domain, and as a thicker than normal oceanic crust produced the first few million years after continental breakup. The maximum magma productivity and the duration of excess magmatism varies along the margins of Northwest Europe and East Greenland, to some extent as a function of the distance from the Iceland hotspot. The Vøring Plateau off mid-Norway is the northernmost of the margin segments in northwestern Europe with extensive magmatism. North of the plateau, magmatism dies off towards the Lofoten Margin, marking the northern boundary of the NAIP here. In 2003, as part of the Euromargins Program we collected an Ocean Bottom Seismometer (OBS) profile from mainland Norway, across the Lofoten Islands, and out into the deep ocean. Forward velocity modeling using raytracing reveals a continental margin that shows transitional features between magma-rich and magma-poor rifting. On one hand, we detect an up to 2 km thick and 40-50 km wide magmatic underplate of the outer continent, on the other hand, continental thinning is greater and intrusive magmatism less than farther south. Continental breakup also appears to be somewhat delayed compared to breakup on the Vøring Plateau, consistent with increased extension. This indicates that magmatic diking, believed to quickly lead to continental breakup of volcanic margins and thus to reduce continental thinning, played a much lesser role here than at the plateau. Early post-breakup oceanic crust is up to 8 km thick, less than half of that observed farther south. The most likely interpretation of these observations, is that the source for the excess magmatism of the NAIP was not present at the Lofoten Margin during rifting, and that the excess magmatism actually observed was the result of lateral transport from the

  15. Roselle is cardioprotective in diet-induced obesity rat model with myocardial infarction.

    Science.gov (United States)

    Si, Lislivia Yiang-Nee; Ali, Siti Aishah Mohd; Latip, Jalifah; Fauzi, Norsyahida Mohd; Budin, Siti Balkis; Zainalabidin, Satirah

    2017-12-15

    Obesity increase the risks of hypertension and myocardial infarction (MI) mediated by oxidative stress. This study was undertaken to investigate the actions of roselle aqueous extract (R) on cardiotoxicity in obese (OB) rats and thereon OB rats subjected to MI. Male Sprague-Dawley rats were fed with either normal diet or high-fat diet for 8weeks. Firstly, OB rats were divided into (1) OB and (2) OB+R (100mg/kg, p.o, 28days). Then, OB rats were subjected to MI (ISO, 85mg/kg, s.c, 2days) and divided into three groups: (1) OB+MI, (2) OB+MI+R and (3) OB+MI+enalapril for another 4weeks. Roselle ameliorated OB and OB+MI's cardiac systolic dysfunction and reduced cardiac hypertrophy and fibrosis. The increased oxidative markers and decreased antioxidant enzymes in OB and OB+MI groups were all attenuated by roselle. These observations indicate the protective effect of roselle on cardiac dysfunction in OB and OB+MI rats, which suggest its potential to be developed as a nutraceutical product for obese and obese patients with MI in the future. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Nonlinear Geometric and Differential Geometric Guidance of UAVs with Vision Sensing for Reactive Obstacle Avoidance

    Science.gov (United States)

    2010-09-29

    1 1 1 2 2 2ˆ ˆ ˆ ˆ ˆ ˆˆ ˆ ˆ ˆ0 0 0 0 0 0 0 0 0 0 T r ob ob ob ob ob ob tr tr trX r r rθ φ θ φ θ φ= (3.28) 29...ˆ ˆ ˆ ˆˆ ˆ ˆ0 0 0 0 0 0 0 T r ob ob ob tr tr trX r rθ φ θ φ⎡ ⎤= ⎣ ⎦ (3.29) Since obstacles are assumed to be point obstacles, it

  17. Analysis of seismic reflectivity and AVO pattern of BSR using OBS data in the southwestern offshore region of Taiwan

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, W.B.; Yang, H.R. [Jinwen Univ. of Science and Technology, Hsintien City, Taipei County, Taiwan (China). Dept. of Environment and Property Management; Schnurle, P.; Liu, C.S. [National Taiwan Univ., Taipei, Taiwan (China). Inst. of Oceanography; Lee, C.S. [National Taiwan Ocean Univ., Keelung, Taiwan (China). Inst. of Applied Earth Science; Wang, Y.; Chung, S.H.; Chen, S.C. [Ministry of Economic Affairs, Taiwan (China). Central Geological Survey

    2008-07-01

    Regional multi-channel seismic reflection profiles that were conducted in Taiwan from 2003 to 2006 resulted in the identification of a gas hydrate-related bottom simulating reflector (BSR) in the broad southwestern offshore region of Taiwan. In order to understand the regional distribution of methane hydrate bearing layers and explore concentrated hydrate bearing layers, this paper presented a comprehensive analysis of reflection coefficient and amplitude-versus-offset (AVO) pattern of BSR using ocean bottom seismographs (OBSs) seismic data acquired in the southwestern offshore region of Taiwan. The study focused on the analysis and interpretation of airgun array signals recorded by OBSs during 2004 and 2006. Ten profiles of seismic reflection/refraction with a total length of about 140 km and recorded by 50 recovered OBSs were acquired on the active and passive margins in offshore southwestern Taiwan. Amplitudes of the direct water arrival, the multiple, and the BSR were picked interactively for all the OBS lines. A quantitative representation of reflector strength was provided by calculation of reflection coefficients. In general, the seafloor reflection coefficients for the active and passive margins were estimated as 0.1-0.25. The paper presented the data and analysis as well as the results of the study. It was concluded that the results of calculated reflection coefficient of the BSR in offshore southwest Taiwan suggested that inferred hydrate concentration for the passive margin profiles was relatively higher than that for the active margin profiles. 4 refs.

  18. Leptin Production by Encapsulated Adipocytes Increases Brown Fat, Decreases Resistin, and Improves Glucose Intolerance in Obese Mice.

    Directory of Open Access Journals (Sweden)

    David J DiSilvestro

    Full Text Available The neuroendocrine effects of leptin on metabolism hold promise to be translated into a complementary therapy to traditional insulin therapy for diabetes and obesity. However, injections of leptin can provoke inflammation. We tested the effects of leptin, produced in the physiological adipocyte location, on metabolism in mouse models of genetic and dietary obesity. We generated 3T3-L1 adipocytes constitutively secreting leptin and encapsulated them in a poly-L-lysine membrane, which protects the cells from immune rejection. Ob/ob mice (OB were injected with capsules containing no cells (empty, OB[Emp], adipocytes (OB[3T3], or adipocytes overexpressing leptin (OB[Lep] into both visceral fat depots. Leptin was found in the plasma of OB[Lep], but not OB[Emp] and OB[3T3] mice at the end of treatment (72 days. The OB[Lep] and OB[3T3] mice have transiently suppressed appetite and weight loss compared to OB[Emp]. Only OB[Lep] mice have greater brown fat mass, metabolic rate, and reduced resistin plasma levels compared to OB[Emp]. Glucose tolerance was markedly better in OB[Lep] vs. OB[Emp] and OB[3T3] mice as well as in wild type mice with high-fat diet-induced obesity and insulin resistance treated with encapsulated leptin-producing adipocytes. Our proof-of-principle study provides evidence of long-term improvement of glucose tolerance with encapsulated adipocytes producing leptin.

  19. Explicit and Implicit Approach vs. Avoidance Tendencies towards High vs. Low Calorie Food Cues in Patients with Obesity and Active Binge Eating Disorder

    Directory of Open Access Journals (Sweden)

    Georgios Paslakis

    2017-09-01

    Full Text Available Patients with binge eating disorder (BED suffer from regular food binges with loss of control. This may be due to dysfunctional approach vs. avoidance tendencies towards food in BED. We applied an approach-avoidance task (AAT, in which n = 24 patients with obesity and active BED (OB-BED, n = 32 patients with obesity without current BED (OB, and n = 25 healthy controls (CO either approached (“pulled” or avoided (“pushed” high (HC vs. low calorie (LC food pictures. We tested the hypothesis that OB-BED patients would show an approach bias (measured as different response times RT towards HC food compared to the other groups. While there was no main effect for group or direction of movement, a significant main effect for calorie (p < 0.001; RT for HC significantly slower than for LC was found. Repeated measures ANOVA (rm-ANOVA for comparison of OB-BED vs. OB vs. CO revealed a significant three-fold interaction group × direction × calorie (p = 0.02. Against our hypothesis, the OB-BED group showed an avoidance bias for LC. In explicit ratings, OB-BED reported a significantly reduced urge to consume LC food compared to the OB group. Similar to OB-BED, CO also showed an avoidance bias for LC. The implications of our results are discussed and future directions in this field of research are presented.

  20. Loss of stearoyl-CoA desaturase 1 rescues cardiac function in obese leptin-deficient mice.

    Science.gov (United States)

    Dobrzyn, Pawel; Dobrzyn, Agnieszka; Miyazaki, Makoto; Ntambi, James M

    2010-08-01

    The heart of leptin-deficient ob/ob mice is characterized by pathologic left ventricular hypertrophy along with elevated triglyceride (TG) content, increased stearoyl-CoA desaturase (SCD) activity, and increased myocyte apoptosis. In the present study, using an ob/ob;SCD1(-/-) mouse model, we tested the hypothesis that lack of SCD1 could improve steatosis and left ventricle (LV) function in leptin deficiency. We show that disruption of the SCD1 gene improves cardiac function in ob/ob mice by correcting systolic and diastolic dysfunction without affecting levels of plasma TG and FFA. The improvement is associated with reduced expression of genes involved in FA transport and lipid synthesis in the heart, as well as reduction in cardiac FFA, diacylglycerol, TG, and ceramide levels. The rate of FA beta-oxidation is also significantly lower in the heart of ob/ob;SCD1(-/-) mice compared with ob/ob controls. Moreover, SCD1 deficiency reduces cardiac apoptosis in ob/ob mice due to increased expression of antiapoptotic factor Bcl-2 and inhibition of inducible nitric oxide synthase and caspase-3 activities. Reduction in myocardial lipid accumulation and inhibition of apoptosis appear to be one of the main mechanisms responsible for improved LV function in ob/ob mice caused by SCD1 deficiency.

  1. Operation UPSHOT-KNOTHOLE, Radiological Safety Operations

    Science.gov (United States)

    1953-06-01

    fi CD tß ED OH (OCfiCfiCfiQQ bb ob ob bb ob ob ob ob ob ob flj <D SÜ (Ü dJ <D(p(U<p(i> >>>>> >>>>> CD CD QQ...PI o in N ~. ^. Ü tD <D T* + + + 93 33 93 c o in o esi r. i- CO CM + + V 33 <u « x...c c C 01 9 O m (U a >> a >• s >> s >• a hä ^>ä b «jgal a^alala^a^ CO CO CO CO CO flj *■" a> 0) QJ

  2. Effects of ovarian steroids and prolactin on the sequential development of nesting behaviour in female budgerigars.

    Science.gov (United States)

    Hutchison, R E

    1975-10-01

    As intact, breeding female budgerigars approach egg-laying, they spend an increasing amount of time in the nestbox and nest hollow. The brood patch area begins to defeather and becomes vascular and the oviduct increases in weight. Precursory albumen forms in the tubular glands of the oviduct. Oestradiol (OB) treatment in combination with prolactin (OB+PL) induced ovariectomized budgerigars to display nesting behaviour which did not differ from that shown by intact females in the 3 days immediately preceding egg-laying. In contrast, OB induced only the initial phase of the nesting sequence and the effects of OB in combination with progesterone (OB+PR) were intermediate between treatments with OB alone and OB+PL. Incubation of artificial eggs occurred only in the OB+PL group and the latency to display of the incubation posture was shorter in the OB+PL group than in the OB+PR group. No incubation posture was displayed by the OB-treated group. Oviduct development was not influenced by prolactin, but progesterone induced precocious development of tubular glands in the magnum region of the oviduct. Treatment with OB+PR induced uniform development of precursor albumen in the tubular glands. Development of the brood patch occurred with both OB+PL and OB+PR treatment. However, OB+PR resulted in defeathering which was advanced in relation to vascularity when compared with intact breeding females, whereas defeathering and vascularity of the OB+PL group did not differ from that of intact females at egg-laying. These results indicate that prolactin in combination with oestradiol was more effective than progesterone not only in inducing the later phases of nesting behaviour but also in initiating incubation behaviour and defeathering of the brood patch area.

  3. Hyperphagia, lower body temperature, and reduced running wheel activity precede development of morbid obesity in New Zealand obese mice.

    Science.gov (United States)

    Jürgens, Hella S; Schürmann, Annette; Kluge, Reinhart; Ortmann, Sylvia; Klaus, Susanne; Joost, Hans-Georg; Tschöp, Matthias H

    2006-04-13

    Among polygenic mouse models of obesity, the New Zealand obese (NZO) mouse exhibits the most severe phenotype, with fat depots exceeding 40% of total body weight at the age of 6 mo. Here we dissected the components of energy balance including feeding behavior, locomotor activity, energy expenditure, and thermogenesis compared with the related lean New Zealand black (NZB) and obese B6.V-Lep(ob)/J (ob/ob) strains (11% and 65% fat at 23 wk, respectively). NZO mice exhibited a significant hyperphagia that, when food intake was expressed per metabolic body mass, was less pronounced than that of the ob/ob strain. Compared with NZB, NZO mice exhibited increased meal frequency, meal duration, and meal size. Body temperature as determined by telemetry with implanted sensors was reduced in NZO mice, but again to a lesser extent than in the ob/ob strain. In striking contrast to ob/ob mice, NZO mice were able to maintain a constant body temperature during a 20-h cold exposure, thus exhibiting a functioning cold-induced thermogenesis. No significant differences in spontaneous home cage activity were observed among NZO, NZB, and ob/ob strains. When mice had access to voluntary running wheels, however, running activity was significantly lower in NZO than NZB mice and even lower in ob/ob mice. These data indicate that obesity in NZO mice, just as in humans, is due to a combination of hyperphagia, reduced energy expenditure, and insufficient physical activity. Because NZO mice differ strikingly from the ob/ob strain in their resistance to cold stress, we suggest that the molecular defects causing hyperphagia in NZO mice are located distal from leptin and its receptor.

  4. Optimization of the Static Human Osteoblast/Osteoclast Co-culture System

    Directory of Open Access Journals (Sweden)

    James Jam Jolly

    2018-03-01

    Full Text Available Osteoblasts (OBs and osteoclasts (OCs are 2 major groups of bone cells. Their cell-to-cell interactions are important to ensure the continuity of the bone-remodeling process. Therefore, the present study was carried out to optimize an OB/OC co-culture system utilizing the human OB cell line hFOB 1.19 and OCs extracted from peripheral blood mononuclear cells (PBMNCs. It was a 2-step procedure, involving the optimization of the OB culture and the co-culture of the OBs with PBMNCs at an optimum ratio. Firstly, pre-OBs were cultured to 90% confluency and the time required for differentiation was determined. OB differentiation was determined using the van Gieson staining to detect the presence of collagen and Alizarin Red for calcium. Secondly, OBs and OCs were co-cultured at the ratios of 1 OC: 1 OB, 1 OC: 4 OBs, 2 OCs: 1 OB, and 1 OC: 2 OBs. Tartrate-resistant acid phosphatase (TRAP staining was used to detect the differentiation of the OCs. The results showed that collagen was present on day 1, whereas calcium was detected as early as day 3. Based on the result of TRAP staining, 1 OC: 2 OBs was taken as the most appropriate ratio. No macrophage colony-stimulating factor and receptor activator of the nuclear factor-κB ligand were added because they were provided by the OBs. In conclusion, these optimization processes are vital as they ensure the exact time point and ratio of the OB/OC co-culture in order to produce a reliable and reproducible co-culture system.

  5. Impaired Coronary and Renal Vascular Function in Spontaneously Type 2 Diabetic Leptin-Deficient Mice.

    Directory of Open Access Journals (Sweden)

    Helena U Westergren

    Full Text Available Type 2 diabetes is associated with macro- and microvascular complications in man. Microvascular dysfunction affects both cardiac and renal function and is now recognized as a main driver of cardiovascular mortality and morbidity. However, progression of microvascular dysfunction in experimental models is often obscured by macrovascular pathology and consequently demanding to study. The obese type 2 diabetic leptin-deficient (ob/ob mouse lacks macrovascular complications, i.e. occlusive atherosclerotic disease, and may therefore be a potential model for microvascular dysfunction. The present study aimed to test the hypothesis that these mice with an insulin resistant phenotype might display microvascular dysfunction in both coronary and renal vascular beds.In this study we used non-invasive Doppler ultrasound imaging to characterize microvascular dysfunction during the progression of diabetes in ob/ob mice. Impaired coronary flow velocity reserve was observed in the ob/ob mice at 16 and 21 weeks of age compared to lean controls. In addition, renal resistivity index as well as pulsatility index was higher in the ob/ob mice at 21 weeks compared to lean controls. Moreover, plasma L-arginine was lower in ob/ob mice, while asymmetric dimethylarginine was unaltered. Furthermore, a decrease in renal vascular density was observed in the ob/ob mice.In parallel to previously described metabolic disturbances, the leptin-deficient ob/ob mice also display cardiac and renal microvascular dysfunction. This model may therefore be suitable for translational, mechanistic and interventional studies to improve the understanding of microvascular complications in type 2 diabetes.

  6. Multiphase formation of the Obří důl polymetallic skarn deposit, West Sudetes, Bohemian Massif: geochemistry and Re-Os dating of sulfide mineralization

    Science.gov (United States)

    Veselovský, František; Ackerman, Lukáš; Pašava, Jan; Žák, Karel; Haluzová, Eva; Creaser, Robert A.; Dobeš, Petr; Erban, Vojtěch; Tásler, Radko

    2018-06-01

    The Obří důl Fe-Cu-As polymetallic sulfide skarn deposit is developed in a metamorphic series in the West Sudetes, Bohemian Massif. It consists of lenses of marble, calc-silicate rocks, and skarns. We studied the Gustav orebody, which is located few hundred meters away from the contact with a large, late-orogenic Variscan Krkonoše-Jizera Plutonic Complex (KJPC) emplaced into shallow crust. Mineralogical and fluid inclusion study evidence indicates that the main sulfide stage, dominated by pyrrhotite, arsenopyrite, and chalcopyrite originated from aqueous hydrothermal fluids with salinity up to 8 wt% NaCl eq. with minimum homogenization temperatures ranging from 324 to 358 °C. These fluids mainly replaced carbonate-rich lithologies. Carbon, oxygen, and strontium isotope data in Ca-rich rocks imply total overprinting by channelized metasomatic fluid flow, which is most probably related to the intrusion of the KJPC, whereas δ34S values of sulfides argue for a magmatic source of sulfur. The Re-Os age of arsenopyrite overlaps published age data for the KJPC and suggests synchronous formation of the main sulfide mineralization and pluton emplacement.

  7. Hepatic steatosis inhibits autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression

    International Nuclear Information System (INIS)

    Inami, Yoshihiro; Yamashina, Shunhei; Izumi, Kousuke; Ueno, Takashi; Tanida, Isei; Ikejima, Kenichi; Watanabe, Sumio

    2011-01-01

    Highlights: → Acidification of autophagosome was blunted in steatotic hepatocytes. → Hepatic steatosis did not disturb fusion of isolated autophagosome and lysosome. → Proteinase activity of cathepsin B and L in autolysosomes was inhibited by steatosis. → Hepatic expression of cathepsin B and L was suppressed by steatosis. -- Abstract: Autophagy, one of protein degradation system, contributes to maintain cellular homeostasis and cell defense. Recently, some evidences indicated that autophagy and lipid metabolism are interrelated. Here, we demonstrate that hepatic steatosis impairs autophagic proteolysis. Though accumulation of autophagosome is observed in hepatocytes from ob/ob mice, expression of p62 was augmented in liver from ob/ob mice more than control mice. Moreover, degradation of the long-lived protein leucine was significantly suppressed in hepatocytes isolated from ob/ob mice. More than 80% of autophagosomes were stained by LysoTracker Red (LTR) in hepatocytes from control mice; however, rate of LTR-stained autophagosomes in hepatocytes were suppressed in ob/ob mice. On the other hand, clearance of autolysosomes loaded with LTR was blunted in hepatocytes from ob/ob mice. Although fusion of isolated autophagosome and lysosome was not disturbed, proteinase activity of cathepsin B and L in autolysosomes and cathepsin B and L expression of liver were suppressed in ob/ob mice. These results indicate that lipid accumulation blunts autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression.

  8. Hepatic steatosis inhibits autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression

    Energy Technology Data Exchange (ETDEWEB)

    Inami, Yoshihiro [Department of Gastroenterology, Juntendo University School of Medicine, Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421 (Japan); Yamashina, Shunhei, E-mail: syamashi@juntendo.ac.jp [Department of Gastroenterology, Juntendo University School of Medicine, Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421 (Japan); Izumi, Kousuke [Department of Gastroenterology, Juntendo University School of Medicine, Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421 (Japan); Ueno, Takashi [Department of Biochemistry, Juntendo University School of Medicine, Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421 (Japan); Tanida, Isei [Department of Biochemistry and Cell Biology, Laboratory of Biomembranes, National Institute of Infectious Disease, Toyama 1-23-1, Shinjuku-ku, Tokyo 162-8640 (Japan); Ikejima, Kenichi; Watanabe, Sumio [Department of Gastroenterology, Juntendo University School of Medicine, Hongo 2-1-1, Bunkyo-ku, Tokyo 113-8421 (Japan)

    2011-09-09

    Highlights: {yields} Acidification of autophagosome was blunted in steatotic hepatocytes. {yields} Hepatic steatosis did not disturb fusion of isolated autophagosome and lysosome. {yields} Proteinase activity of cathepsin B and L in autolysosomes was inhibited by steatosis. {yields} Hepatic expression of cathepsin B and L was suppressed by steatosis. -- Abstract: Autophagy, one of protein degradation system, contributes to maintain cellular homeostasis and cell defense. Recently, some evidences indicated that autophagy and lipid metabolism are interrelated. Here, we demonstrate that hepatic steatosis impairs autophagic proteolysis. Though accumulation of autophagosome is observed in hepatocytes from ob/ob mice, expression of p62 was augmented in liver from ob/ob mice more than control mice. Moreover, degradation of the long-lived protein leucine was significantly suppressed in hepatocytes isolated from ob/ob mice. More than 80% of autophagosomes were stained by LysoTracker Red (LTR) in hepatocytes from control mice; however, rate of LTR-stained autophagosomes in hepatocytes were suppressed in ob/ob mice. On the other hand, clearance of autolysosomes loaded with LTR was blunted in hepatocytes from ob/ob mice. Although fusion of isolated autophagosome and lysosome was not disturbed, proteinase activity of cathepsin B and L in autolysosomes and cathepsin B and L expression of liver were suppressed in ob/ob mice. These results indicate that lipid accumulation blunts autophagic proteolysis via impairment of autophagosomal acidification and cathepsin expression.

  9. Proteomic analysis of oil bodies in mature Jatropha curcas seeds with different lipid content.

    Science.gov (United States)

    Liu, Hui; Wang, Cuiping; Chen, Fan; Shen, Shihua

    2015-01-15

    To reveal the difference among three mature Jatropha curcas seeds (JcVH, variant with high lipid content; JcW, wild type and JcVL, variant with low lipid content) with different lipid content, comparative proteomics was employed to profile the changes of oil body (OB) associated protein species by using gels-based proteomic technique. Eighty-three protein species were successfully identified through LTQ-ES-MS/MS from mature JcW seeds purified OBs. Two-dimensional electrophoresis analysis of J. curcas OB associated protein species revealed they had essential interactions with other organelles and demonstrated that oleosin and caleosin were the most abundant OB structural protein species. Twenty-eight OB associated protein species showed significant difference among JcVH, JcW and JcVL according to statistical analysis. Complementary transient expression analysis revealed that calcium ion binding protein (CalBP) and glycine-rich RNA binding protein (GRP) were well targeted in OBs apart from the oleosins. This study demonstrated that ratio of lipid content to caleosins abundance was involved in the regulation of OB size, and the mutant induced by ethylmethylsulfone treatment might be related to the caleosin like protein species. These findings are important for biotechnological improvement with the aim to alter the lipid content in J. curcas seeds. The economic value of Jatropha curcas largely depends on the lipid content in seeds which are mainly stored in the special organelle called oil bodies (OBs). In consideration of the biological importance and applications of J. curcas OB in seeds, it is necessary to further explore the components and functions of J. curcas OBs. Although a previous study concerning the J. curcas OB proteome revealed oleosins were the major OB protein component and additional protein species were similar to those in other oil seed plants, these identified OB associated protein species were corresponding to the protein bands instead of protein

  10. Characterization of liver changes in ZSF1 rats, an animal model of metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Marta Borges-Canha

    Full Text Available Background: The non-alcoholic fatty liver disease is the hepatic counterpart of the metabolic syndrome. ZSF1 rats are a metabolic syndrome animal model in which liver changes have not been described yet. Aim: The characterization of liver histological and innate immunity changes in ZSF1 rats. Methods: Five groups of rats were included (n = 7 each group: healthy Wistar-Kyoto control rats (Ctrl, hypertensive ZSF1 lean (Ln, ZSF1 obese rats with a normal diet (Ob, ZSF1 obese rates with a high-fat diet (Ob-HFD, and ZSF1 obese rats with low-intensity exercise training (Ob-Ex. The animals were sacrificed at 20 weeks of age, their livers were collected for: a measurements of the area of steatosis, fibrosis and inflammation (histomorphological analysis; and b innate immunity (toll-like receptor [TLR] 2, TLR4, peroxisome proliferator-activated receptor γ [PPARγ], toll interacting protein [TOLLIP] and inflammatory marker (tumor necrosis factor-alpha [TNFvs], interleukin 1 [IL-1] expression analysis by real-time PCR. Results: Ob, Ob-HFD and Ob-Ex were significantly heavier than Ln and Ctrl animals. Ob, Ob-HFD and Ob-Ex animals had impaired glucose tolerance and insulin resistance. ZSF1 Ob, Ob-HFD and Ob-Ex presented a higher degree of steatosis (3,5x; p < 0.05 than Ctrl or ZSF1 Ln rats. Steatohepatitis and fibrosis were not observed in any of the groups. No differences in expression were observed between Ctrl, Ln and Ob animals (except for the significantly higher expression of TOLLIP observed in the Ob vs Ln comparison. Ob-HFD and Ob-Ex rats showed increased expression of PPARγ and TOLLIP as compared to other groups. However, both groups also showed increased expression of TLR2 and TLR4. Nevertheless, this did not translate into a differential expression of TNFα or IL-1 in any of the groups. Conclusion: The ZSF1 model is associated with liver steatosis but not with steatohepatitis or a significantly increased expression of innate immunity or

  11. Effect of Mixed Glass Former on Ionic Conductivity of Silver Boron Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O-(B2O3:WO3)

    International Nuclear Information System (INIS)

    Dehariya, Harsha; Kumar, R; Polu, A R

    2012-01-01

    The idea to explore new 'Superionic Electrolytes', 'Fast ionic conductors' is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 and TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O(B2O3:WO3)], where 0 ≤ x ≤ 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27 C to 200 C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O(B2O3:WO3)] shows the highest conductivity of the order of σrt ∼ 2.76x10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied and reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.

  12. Effect of Mixed Glass Former on Ionic Conductivity of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O-{B2O3:WO3}

    Science.gov (United States)

    Dehariya, Harsha; Kumar, R.; Polu, A. R.

    2012-05-01

    The idea to explore new 'Superionic Electrolytes', "Fast ionic conductors" is due to their tremendous potential applications in solid state electrochemical devices viz. solid state batteries, fuel cells, sensors, super capacitors. Superionic glasses have attracted great deal of attention due to their several advantageous over their crystalline counterparts such as high ionic conductivity, easy preparation, wide selection of compositions, isotropic properties and high stability etc [4-7]. Large numbers of silver ion based glasses have been reported in the literature for the glassy system of AgI:Ag2O: MxOy (MxOy = B2O3, SiO2, P2O5, GeO2, V2O5, As2O5, CrO3, SeO2, MoO3 & TeO3 etc many of them shows high silver ion conductivity [8]. Ion transport behavior of Silver Boro Tungstate glass system x[0.75AgI:0.25AgCl]: (1-x) [Ag2O{B2O3:WO3}], where 0 <= x <= 1 in molar wt% prepared by melt quench technique were reported. The new host [0.75AgI:0.25AgCl] was used as a better alternate in place of conventional host salt AgI. Conductivity measurement were carried out on this glass system as a function of frequency from 50 Hz to 5 MHz, over a temperature range of 27°C to 200°C, for different compositions by Impedance spectroscopy. The composition 0.7[0.75AgI:0.25AgCl]: 0.3[Ag2O{B2O3:WO3}] shows the highest conductivity of the order of σrt ~ 2.76 × 10-2 S/cm, referred to as the Optimum Conducting Composition (OCC). The enhancement in the conductivity has been obtained by mixed former effect. XRD result shows that the system is completely amorphous. Temperature dependence of conductivity of all compositions were studied & reported. Activation energies (Ea) were also evaluated from the slope of .Log(σ) vs 1000/T, Arrhenius plots.

  13. Comparison of onboard low-field magnetic resonance imaging versus onboard computed tomography for anatomy visualization in radiotherapy.

    Science.gov (United States)

    Noel, Camille E; Parikh, Parag J; Spencer, Christopher R; Green, Olga L; Hu, Yanle; Mutic, Sasa; Olsen, Jeffrey R

    2015-01-01

    Onboard magnetic resonance imaging (OB-MRI) for daily localization and adaptive radiotherapy has been under development by several groups. However, no clinical studies have evaluated whether OB-MRI improves visualization of the target and organs at risk (OARs) compared to standard onboard computed tomography (OB-CT). This study compared visualization of patient anatomy on images acquired on the MRI-(60)Co ViewRay system to those acquired with OB-CT. Fourteen patients enrolled on a protocol approved by the Institutional Review Board (IRB) and undergoing image-guided radiotherapy for cancer in the thorax (n = 2), pelvis (n = 6), abdomen (n = 3) or head and neck (n = 3) were imaged with OB-MRI and OB-CT. For each of the 14 patients, the OB-MRI and OB-CT datasets were displayed side-by-side and independently reviewed by three radiation oncologists. Each physician was asked to evaluate which dataset offered better visualization of the target and OARs. A quantitative contouring study was performed on two abdominal patients to assess if OB-MRI could offer improved inter-observer segmentation agreement for adaptive planning. In total 221 OARs and 10 targets were compared for visualization on OB-MRI and OB-CT by each of the three physicians. The majority of physicians (two or more) evaluated visualization on MRI as better for 71% of structures, worse for 10% of structures, and equivalent for 14% of structures. 5% of structures were not visible on either. Physicians agreed unanimously for 74% and in majority for > 99% of structures. Targets were better visualized on MRI in 4/10 cases, and never on OB-CT. Low-field MR provides better anatomic visualization of many radiotherapy targets and most OARs as compared to OB-CT. Further studies with OB-MRI should be pursued.

  14. The potential effects of Ocimum basilicum on health: a review of pharmacological and toxicological studies.

    Science.gov (United States)

    Sestili, Piero; Ismail, Tariq; Calcabrini, Cinzia; Guescini, Michele; Catanzaro, Elena; Turrini, Eleonora; Layla, Anam; Akhtar, Saeed; Fimognari, Carmela

    2018-06-11

    Basil (Ocimum basilicum L., OB) is a plant world widely used as a spice and a typical ingredient of the healthy Mediterranean diet. In traditional medicine, OB is indicated for many maladies and conditions; OB-containing nutritional supplements are increasingly sold. Conversely, safety concerns have been raised about the promutagens and procarcinogens alkenylbenzenes contained in OB. Areas covered: A critical review of the current status of OB as a nutraceutical, the pharmacology of its bioactive components, the rationale for its indications, and its safety. Expert opinion: Due to the polyphenolic and flavonoidic content, OB can be considered as an important ingredient in healthy diets; OB preparations may be effective as chemopreventive agents or adjunctive therapy in the treatment of different clinical conditions. From a toxicological perspective, since the tumorigenic potential of alkenylbenzenes is counteracted by other OB constituents such as nevadensin, it can be concluded that OB consumption in food and preparations is safe. The only concern relates to OB essential oils: in this case, a concentration limit for alkenylbenzenes should be precautionary defined, and the use of plant chemotypes with no or low levels of these alkylbenzenes for the preparation of essential oils should be made compulsory.

  15. A 80 OBS and 30 Land 3-component seismometers array encompassing the 280 km segment of the Lesser Antilles subduction megathrust seismogenic zone: view of current seismicity

    Science.gov (United States)

    Laigle, Mireille; Sapin, Martine; Ruiz, Mario; Diaz, Jordi; Kissling, Edi; Charvis, Philippe; Flueh, Ernst; Hirn, Alfred

    2010-05-01

    An extensive onshore and offshore seismic station array in the Lesser Antilles subduction zone allows to monitor microearthquake activity for a period of 4 months in a region previously outside of reach for detailed observation. Such a network has been possible thanks to a cluster of 3 seismic surveys (TRAIL - F/S Merian, SISMANTILLESII - N/O Atalante, and OBSANTILLES - N/O Antea) for deploying and recovering the instruments from several pools (Geoazur, INSU-IPGP, IFM-GEOMAR, AWI ). It has been followed by an additional deployment of the 28 GeoAzur OBSs (OBSANTILLES - N/O Antea) during 5 months in the south-western half. These operations have been carried out for the seismic investigation of the Antilles megathrust seismogenic zone in the framework of the THALES WAS RIGHT european project, and with also the financial support of the french ANR Catastrophes Telluriques et Tsunamis (SUBSISMANTI) and by the EU SALVADOR Programme of IFM-GEOMAR. Onshore, 30 3-components land stations (CSIC Barcelone, IPG Paris, INSU-RLBM and -LITHOSCOPE) have been temporarily deployed. The deep seismic structure of the whole area has been investigated during these seismic surveys by wide-angle reflection and refraction seismics recorded by these instruments as well as multi-channel reflection seismic imaging (MCS) along a dense grid of crossing profiles at the OBS positions providing excellent velocity information for the upper plate. Both the location and the interpretation of the recorded earthquake activity require constraints on the deep seismic structure, which will be discussed with respect to the 3D geometry of the interplate boundary and oceanic Moho, as well as those of the forearc basement and Moho. Preliminary locations have been obtained within a simple 1D velocity model by taking into account corrections for the variable thickness of the mud- and sediments layers beneath each OBS. The latter are estimated for both P- and S-waves to compensate for the huge structural

  16. [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].

    Science.gov (United States)

    Kharlamova, A S; Barabanov, V M; Saveliev, S V

    2015-01-01

    We provide the data of the olfactory bulbs (OB) development in the human fetuses on the stages from 8 week to birth. Immunochistochemical markers of presynaptic terminals (anti-SNAP-25, -synapsin-I, -synaptophysin) were used to evaluate the maturation of the OB. Differentiation of the OB layers begins from periphery, which implicitly evidences that growth of the olfactory nerves fibers induses not only anatomical differentiation of the OB, but also differentiation of its functional layers. The sites of the developing glomerulus are revealed using the immunochistochemical prosedure on the stage before distinct glomerulus can be identified with common histological procedure. OB conductive system demonstrates immunoreactivity with the antibodies to the presynaptic proteins on the all stages from 10-11 weeks of fetus development. Four stages of the OB development are described. All functional layers of the OB are mature at the 22-weeks stage. Further differentiation of the OB neuroblasts, including lamina formation of the internal granular leyer, glomerular layer development, OB growth continue after 20-22 weeks stage until 38-40 weeks of the fetus develoment. Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development. Complete maturity of the human OB is achived at 38-40 weeks of the prenatal development.

  17. Accumulation of advanced glycation end-products and activation of the SCAP/SREBP Lipogenetic pathway occur in diet-induced obese mouse skeletal muscle.

    Directory of Open Access Journals (Sweden)

    Raffaella Mastrocola

    Full Text Available Aim of this study was to investigate whether advanced glycation end-products (AGEs accumulate in skeletal myofibers of two different animal models of diabesity and whether this accumulation could be associated to myosteatosis. Male C57Bl/6j mice and leptin-deficient ob/ob mice were divided into three groups and underwent 15 weeks of dietary manipulation: standard diet-fed C57 group (C57, n = 10, high-fat high-sugar diet-fed C57 group (HFHS, n = 10, and standard diet-fed ob/ob group (OB/OB, n = 8. HFHS mice and OB/OB mice developed glycometabolic abnormalities in association with decreased mass of the gastrocnemius muscle, fast-to-slow transition of muscle fibers, and lipid accumulation (that occurred preferentially in slow compared to fast fibers. Moreover, we found in muscle fibers of HFHS and OB/OB mice accumulation of AGEs that was preferential for the lipid-accumulating cells, increased expression of the lipogenic pathway SCAP/SREBP, and co-localisation between AGEs and SCAP-(hyperexpressing cells (suggestive for SCAP glycosylation. The increased expression of the SCAP/SREBP lipogenic pathway in muscle fibers is a possible mechanism underlying lipid accumulation and linking myosteatosis to muscle fiber atrophy and fast-to-slow transition that occur in response to diabesity.

  18. Towards Experiments to Test Violation of the Original Bell Inequality

    Directory of Open Access Journals (Sweden)

    Andrei Khrennikov

    2018-04-01

    Full Text Available The aim of this paper is to attract the attention of experimenters to the original Bell (OB inequality that was shadowed by the common consideration of the Clauser–Horne–Shimony–Holt (CHSH inequality. There are two reasons to test the OB inequality and not the CHSH inequality. First of all, the OB inequality is a straightforward consequence to the Einstein–Podolsky–Rosen (EPR argumentation. In addition, only this inequality is directly related to the EPR–Bohr debate. The second distinguishing feature of the OB inequality was emphasized by Itamar Pitowsky. He pointed out that the OB inequality provides a higher degree of violations of classicality than the CHSH inequality. For the CHSH inequality, the fraction of the quantum (Tsirelson bound Q CHSH = 2 2 to the classical bound C CHSH = 2 , i.e., F CHSH = Q CHSH C CHSH = 2 is less than the fraction of the quantum bound for the OB inequality Q OB = 3 2 to the classical bound C OB = 1 , i.e., F OB = Q OB C OB = 3 2 . Thus, by violating the OB inequality, it is possible to approach a higher degree of deviation from classicality. The main problem is that the OB inequality is derived under the assumption of perfect (anti- correlations. However, the last few years have been characterized by the amazing development of quantum technologies. Nowadays, there exist sources producing, with very high probability, the pairs of photons in the singlet state. Moreover, the efficiency of photon detectors was improved tremendously. In any event, one can start by proceeding with the fair sampling assumption. Another possibility is to use the scheme of the Hensen et al. experiment for entangled electrons. Here, the detection efficiency is very high.

  19. Controlling the optical bistability via quantum interference in a four-level N-type atomic system

    International Nuclear Information System (INIS)

    Sahrai, M.; Asadpour, S.H.; Mahrami, H.; Sadighi-Bonabi, R.

    2011-01-01

    We investigate the optical bistability (OB) and optical multi-stability (OM) in a four-level N-type atomic system. The effect of spontaneously generated coherence (SGC) on OB and OM is then discussed. It is found that SGC makes the medium phase dependent, so the optical bistability and multi-stability threshold can be controlled via relative phase between applied fields. We realize that the frequency detuning of probe and coupling fields with the corresponding atomic transition plays an important role in creation OB and OM. Moreover, the effect of laser coupling fields and an incoherent pumping field on reduction of OB and OM threshold is then discussed. - Highlights: → We modulate the optical bistability (OB) in a four-level N-type atomic system. The effect of spontaneously generated coherence on OB is discussed. → Spontaneously generated coherence makes the medium phase dependent. → The frequency of coupling field can reduce OB threshold. → We discuss the effect of an incoherent pumping field on reduction of OB threshold.

  20. Percepción materna de sobrepeso-obesidad infantil y riesgos de salud en Nuevo Laredo, Tamaulipas, México Evaluation of the maternal perception of childhood overweight-obesity and maternal recognition of health risk in a Mexican border city

    Directory of Open Access Journals (Sweden)

    Baldomero Lara-García

    2011-06-01

    Full Text Available OBJETIVOS: Evaluar 1 la percepción materna (PM del peso del hijo, 2 la PM de sobrepeso-obesidad (SP-OB de niños no emparentados(NNE,3laPMde la imagenconriesgode salud y 4 el reconocimiento de riesgos de salud del SP-OB. MATERIAL Y MÉTODOS: Participaron 325 diadas madre-hijo.Se utilizó un panel de siete imágenes.El índice de masa corporal medido del hijo fue el estándar de oro. RESULTADOS: 84 de 100 madres de niños con SP-OB no percibieron adecuadamente el peso del hijo.El 97.5% percibió el SP-OB de NNE y 83.1% la imagen con SP-OB con riesgo de salud. La mayoría reconoció riesgos de salud. CONCLUSIÓN: Es necesario diseñar programas de intervención multidisciplinarios para ayudar a las madres de niños con SP-OB a reconocer de forma adecuada el peso de su hijo y así disminuir la prevalencia de SP-OB en dicha población.OBJECTIVES: To evaluate 1 maternal perception (MP of their child's weight, 2 MP of overweight-obesity (OW-OB of unrelated children (URC,3 MP of image with health risk, and 4 recognition of OW-OB health risks. MATERIAL AND METHODS: A total of 325 mother-child dyads participated.A panel with 7 images was used.The child's body mass index was the gold standard. RESULTS: A total of 84 of 100 mothers of OW-OB children did not accurately perceive their children's weight. Of the total sample, 97.5% perceived the OW-OB of URC and 83.1% the OW-OB image with health risk.Most of the mothers recognized the health risks. CONCLUSION: It is necessary to design multidisciplinary intervention programs to help mothers of OW-OB children accurately recognize their children's weight and, thus, reduce the high prevalence of OW-OB in our population.

  1. Obese mice exhibit an altered behavioural and inflammatory response to lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Catherine B. Lawrence

    2012-09-01

    Obesity is associated with an increase in the prevalence and severity of infections. Genetic animal models of obesity (ob/ob and db/db mice display altered centrally-mediated sickness behaviour in response to acute inflammatory stimuli such as lipopolysaccharide (LPS. However, the effect of diet-induced obesity (DIO on the anorectic and febrile response to LPS in mice is unknown. This study therefore determined how DIO and ob/ob mice respond to a systemic inflammatory challenge. C57BL/6 DIO and ob/ob mice, and their respective controls, were given an intraperitoneal (i.p. injection of LPS. Compared with controls, DIO and ob/ob mice exhibited an altered febrile response to LPS (100 μg/kg over 8 hours. LPS caused a greater and more prolonged anorexic effect in DIO compared with control mice and, in ob/ob mice, LPS induced a reduction in food intake and body weight earlier than it did in controls. These effects of LPS in obese mice were also seen after a fixed dose of LPS (5 μg. LPS (100 μg/kg induced Fos protein expression in several brain nuclei of control mice, with fewer Fos-positive cells observed in the brains of obese mice. An altered inflammatory response to LPS was also observed in obese mice compared with controls: changes in cytokine expression and release were detected in the plasma, spleen, liver and peritoneal macrophages in obese mice. In summary, DIO and ob/ob mice displayed an altered behavioural response and cytokine release to systemic inflammatory challenge. These findings could help explain why obese humans show increased sensitivity to infections.

  2. Star formation history of Canis Major OB1. II. A bimodal X-ray population revealed by XMM-Newton

    Science.gov (United States)

    Santos-Silva, T.; Gregorio-Hetem, J.; Montmerle, T.; Fernandes, B.; Stelzer, B.

    2018-02-01

    Aims: The Canis Major OB1 Association has an intriguing scenario of star formation, especially in the region called Canis Major R1 (CMa R1) traditionally assigned to a reflection nebula, but in reality an ionized region. This work is focussed on the young stellar population associated with CMa R1, for which our previous results from ROSAT, optical, and near-infrared data had revealed two stellar groups with different ages, suggesting a possible mixing of populations originated from distinct star formation episodes. Methods: The X-ray data allow the detected sources to be characterized according to hardness ratios, light curves, and spectra. Estimates of mass and age were obtained from the 2MASS catalogue and used to define a complete subsample of stellar counterparts for statistical purposes. Results: A catalogue of 387 XMM-Newton sources is provided, of which 78% are confirmed as members or probable members of the CMa R1 association. Flares (or similar events) were observed for 13 sources and the spectra of 21 bright sources could be fitted by a thermal plasma model. Mean values of fits parameters were used to estimate X-ray luminosities. We found a minimum value of log(LX [erg/s] ) = 29.43, indicating that our sample of low-mass stars (M⋆ ≤ 0.5 M⊙), which are faint X-ray emitters, is incomplete. Among the 250 objects selected as our complete subsample (defining our "best sample"), 171 are found to the east of the cloud, near Z CMa and dense molecular gas, of which 50% of them are young (10 Myr). The opposite happens to the west, near GU CMa, in areas lacking molecular gas: among 79 objects, 30% are young and 50% are older. These findings confirm that a first episode of distributed star formation occurred in the whole studied region 10 Myr ago and dispersed the molecular gas, while a second, localized episode (<5 Myr) took place in the regions where molecular gas is still present.

  3. Obese diet-induced mouse models of nonalcoholic steatohepatitis-tracking disease by liver biopsy

    Science.gov (United States)

    Kristiansen, Maria Nicoline Baandrup; Veidal, Sanne Skovgård; Rigbolt, Kristoffer Tobias Gustav; Tølbøl, Kirstine Sloth; Roth, Jonathan David; Jelsing, Jacob; Vrang, Niels; Feigh, Michael

    2016-01-01

    AIM: To characterize development of diet-induced nonalcoholic steatohepatitis (NASH) by performing liver biopsy in wild-type and genetically obese mice. METHODS: Male wild-type C57BL/6J (C57) mice (DIO-NASH) and male Lepob/Lepob (ob/ob) mice (ob/ob-NASH) were maintained on a diet high in trans-fat (40%), fructose (22%) and cholesterol (2%) for 26 and 12 wk, respectively. A normal chow diet served as control in C57 mice (lean chow) and ob/ob mice (ob/ob chow). After the diet-induction period, mice were liver biopsied and a blinded histological assessment of steatosis and fibrosis was conducted. Mice were then stratified into groups counterbalanced for steatosis score and fibrosis stage and continued on diet and to receive daily PO dosing of vehicle for 8 wk. Global gene expression in liver tissue was assessed by RNA sequencing and bioinformatics. Metabolic parameters, plasma liver enzymes and lipids (total cholesterol, triglycerides) as well as hepatic lipids and collagen content were measured by biochemical analysis. Non-alcoholic fatty liver disease activity score (NAS) (steatosis/inflammation/ballooning degeneration) and fibrosis were scored. Steatosis and fibrosis were also quantified using percent fractional area. RESULTS: Diet-induction for 26 and 12 wk in DIO-NASH and ob/ob-NASH mice, respectively, elicited progressive metabolic perturbations characterized by increased adiposity, total cholesterol and elevated plasma liver enzymes. The diet also induced clear histological features of NASH including hepatosteatosis and fibrosis. Overall, the metabolic NASH phenotype was more pronounced in ob/ob-NASH vs DIO-NASH mice. During the eight week repeated vehicle dosing period, the metabolic phenotype was sustained in DIO-NASH and ob/ob-NASH mice in conjunction with hepatomegaly and increased hepatic lipids and collagen accumulation. Histopathological scoring demonstrated significantly increased NAS of DIO-NASH mice (0 vs 4.7 ± 0.4, P NASH mice (2.4 ± 0.3 vs 6.3

  4. Olfactory bulb and olfactory sulcus depths are associated with disease duration and attack frequency in multiple sclerosis patients.

    Science.gov (United States)

    Tanik, Nermin; Serin, Halil Ibrahim; Celikbilek, Asuman; Inan, Levent Ertugrul; Gundogdu, Fatma

    2015-11-15

    Multiple sclerosis (MS) is a neuroinflammatory and neurodegenerative disease that progresses to axonal loss and demyelinization. Olfactory dysfunction in patients with MS has been reported frequently. We were interested in the associations of olfactory bulb (OB) and olfactory sulcus depth (OSD) with disease duration and attack frequency. We included 25 patients with MS and 30 age- and sex-matched controls in this study. The Expanded Disability Status Scale, Beck Depression Inventory, and Mini Mental State Examination were applied. OB, OSD, and magnetic resonance imaging plaque numbers were calculated. OB volume and OSD in patients with MS were significantly lower than those in the control group (right and left OB: p<0.001; right OSD: p=0.001; and left OSD: p=0.039). Disease duration was negatively correlated with right and left OB volume (right OB: r=-0.434, p=0.030 and left OB: r=-0.518, p=0.008). Attack frequency was negatively correlated with left OB volume and left OSD (left OB: r=-0.428, p=0.033 and left OSD: r=-0.431, p=0.032). The OB and OSD were atrophied significantly in patients with MS, and this was correlated with disease duration and attack frequency. The left side tended to be dominant. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. Surface Observation Climatic Summaries (SOCS) For Mather AFB, California

    Science.gov (United States)

    1992-02-01

    1100 SPEND (RTS) CE14 GEIS GE25 OBS GE14 GEl8 GE25 OBS GE14 GEl8 GE25 OBS GE14 GEl8 GE25 OBS CATEGORY A 1.7 .5 .1 930 1.6 .6 .1 930 1.6 .4 930 3.4 1.0...ITS) GE14 0E18 GE25 ORS GE14 GEIS GE25 OS GE14 GEl8 GE25 OBS GE14 GE18 GE25 OBS CATEGORY A 5.7 2.4 930 5.2 1.3 .2 930 1.7 .5 .2 930 1.5 .5 .1 930...TIME (LST) 0600 - 2000 ALL HOURS SPEED K75 GE14 GEl8 GE25 OBS GE14 GEl8 UE25 OS CAT Y A 3.5 1.1 .1 4650 2.8 .9

  6. Effects of olive oil and its minor phenolic constituents on obesity-induced cardiac metabolic changes

    Directory of Open Access Journals (Sweden)

    Rocha Katiucha KHR

    2010-10-01

    Full Text Available Abstract Background Olive oil and its minor constituents have been recommended as important dietary therapeutic interventions in preventive medicine. However, a question remains to be addressed: what are the effects of olive oil and its phenolic compounds on obesity-induced cardiac metabolic changes? Methods Male Wistar rats were divided into two groups (n = 24/group: (C receiving standard-chow; (Ob receiving hypercaloric-chow. After 21 days C and Ob groups were divided into four subgroups (n = 6/group:(C standard-chow and saline; (C-Olivestandard-chow and olive-oil (3.0 g/kg.day; (C-Oleuropeinstandard-chow and oleuropein (0.023 mg/kg/day; (C-Cafeic standard-chow and cafeic-acid (2.66 mg/kg/day; (Obreceiving hypercaloric-chow and saline;(Ob-Olive hypercaloric-chow and olive-oil;(Ob-Oleuropein hypercaloric-chow and oleuropein;(Ob-Cafeic hypercaloric-chow and cafeic-acid. Treatments were given twice a week during 21 days. Results After 42 days, obesity was evidenced in Ob rats from enhanced body-weight, surface-area, and body-mass-index. Energy-expenditure, oxygen consumption(VO2 and fat-oxidation were lower in Ob-group than in C. Despite no morphometric changes, Ob-Olive, Ob-Oleuropein and Ob-Cafeic groups had higher VO2, fat-oxidation, myocardial beta-hydroxyacyl coenzyme-A dehydrogenase and lower respiratory-quotient than Ob. Citrate-synthase was highest in Ob-Olive group. Myocardial lipid-hydroperoxide(LH and antioxidant enzymes were unaffected by olive-oil and its compounds in obesity condition, whereas LH was lower and total-antioxidant-substances were higher in C-Olive and C-Oleuropein than in C. Conclusions The present study demonstrated for the first time that olive-oil, oleuropein and cafeic-acid enhanced fat-oxidation and optimized cardiac energy metabolism in obesity conditions. Olive oil and its phenolic compounds improved myocardial oxidative stress in standard-fed conditions.

  7. Scaffold-cell bone engineering in a validated preclinical animal model: precursors vs differentiated cell source.

    Science.gov (United States)

    Berner, A; Henkel, J; Woodruff, M A; Saifzadeh, S; Kirby, G; Zaiss, S; Gohlke, J; Reichert, J C; Nerlich, M; Schuetz, M A; Hutmacher, D W

    2017-07-01

    The properties of osteoblasts (OBs) isolated from the axial skeleton (tOBs) differ from OBs of the orofacial skeleton (mOBs) due to the different embryological origins of the bones. The aim of the study was to assess and compare the regenerative potential of allogenic bone marrow-derived mesenchymal progenitor cells with allogenic tOBs and allogenic mOBs in combination with a mPCL-TCP scaffold in critical-sized segmental bone defects in sheep tibiae. After 6 months, the tibiae were explanted and underwent biomechanical testing, micro-computed tomography (microCT) and histological and immunohistochemical analyses. Allogenic MPCs demonstrated a trend towards a better outcome in biomechanical testing and the mean values of newly formed bone. Biomechanical, microCT and histological analysis showed no significant differences in the bone regeneration potential of tOBs and mOBs in our in vitro study, as well as in the bone regeneration potential of different cell types in vivo. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

  8. Identification of the Relationship between Oil Body Morphology and Oil Content by Microstructure Comparison Combining with QTL Analysis in Brassica napus.

    Science.gov (United States)

    Gu, Jianwei; Chao, Hongbo; Wang, Hao; Li, Yonghong; Li, Dianrong; Xiang, Jun; Gan, Jianping; Lu, Guangyuan; Zhang, Xuekun; Long, Yan; Li, Maoteng

    2016-01-01

    Oil bodies (OBs) are relatively simple but very important organelles comprising a matrix of triacylglycerol (TAG) surrounded by a phospholipid monolayer embedded and covered with unique proteins. The OB structure in Brassica napus with different oil content and the relationship between the oil content and the OB structure needs to be better understood. In this paper, the characteristics of OBs in the embryo of a series of B. napus materials with different oil content ranging from 34% to over 60% were studied. The results indicated that the OB size was significantly positively correlated with the oil content but was significantly negatively correlated with the glucosinolates and the protein content. Many genes associated with TAG synthesis, OB-membrane proteins, and the cell progress regulatory pathway were identified in the confidence interval of co-located QTLs for oil content, fatty acid (FA) compositions, and protein content. Our results suggested that the morphology of OBs might be directly controlled by the genes associated with OB-membrane proteins and indirectly controlled by the genes associated with TAG synthesis and cell progress regulatory pathway.

  9. A DYNAMICAL STUDY OF SUSPECTED RUNAWAY STARS AS TRACES OF PAST SUPERNOVA EXPLOSIONS IN THE REGION OF THE SCORPIUS-CENTAURUS OB ASSOCIATION

    International Nuclear Information System (INIS)

    Jilinski, E.; Ortega, V. G.; Drake, N. A.; De la Reza, R.

    2010-01-01

    We address the question of identifying possible past supernovae events taking place in the region of the Scorpius-Centaurus (Sco-Cen) OB association based on stars proposed by Hoogerwerf et al. With this purpose, we obtained a time series of high-resolution spectra of six stars (HIP 42038, HIP 46950, HIP 48943, HIP 69491, HIP 76013, and HIP 82868) which, according to Hoogerwerf et al., may have been runaway stars with origins in the region of the Sco-Cen association. This also includes the nearby young open clusters IC 2391 and IC 2602. If confirmed, such supernovae events could, in principle, have played a role in triggering the formation of some small stellar groups thought to be associated with the Sco-Cen association. Our analysis shows that, except for HIP 48943, the remaining stars are spectroscopic binary systems. For HIP 46950 and HIP 69491, this was already noted by other authors. Our high-resolution spectra allowed us to obtain the radial velocities for all the stars which, combined with their proper motions and parallaxes from Hipparcos, provide a means to investigate, by retracing their orbits, if the Sco-Cen region was, in fact, the origin of these stars. We find that none of these systems originated in the Sco-Cen region. Exploring the possibility that the birthplace of the studied stars occurred in the clusters IC 2391 and IC 2602, we noticed that at the epoch of 2-3 Myr ago these clusters were at a distance comparable with their tidal radii.

  10. Burst-Switched Optical Networks Supporting Legacy and Future Service Types

    Directory of Open Access Journals (Sweden)

    Gerald Franzl

    2011-01-01

    Full Text Available Focusing on the principles and the paradigm of OBS an overview addressing expectable performance and application issues is presented. Proposals on OBS were published over a decade and the presented techniques spread into many directions. The paper comprises discussions of several challenges that OBS meets, in order to compile the big picture. The OBS principle is presented unrestricted to individual proposals and trends. Merits are openly discussed, considering basic teletraffic theory and common traffic characterisation. A more generic OBS paradigm than usual is impartially discussed and found capable to overcome shortcomings of recent proposals. In conclusion, an OBS that offers different connection types may support most client demands within a sole optical network layer.

  11. Accurate ocean bottom seismometer positioning method inspired by multilateration technique

    Science.gov (United States)

    Benazzouz, Omar; Pinheiro, Luis M.; Matias, Luis M. A.; Afilhado, Alexandra; Herold, Daniel; Haines, Seth S.

    2018-01-01

    The positioning of ocean bottom seismometers (OBS) is a key step in the processing flow of OBS data, especially in the case of self popup types of OBS instruments. The use of first arrivals from airgun shots, rather than relying on the acoustic transponders mounted in the OBS, is becoming a trend and generally leads to more accurate positioning due to the statistics from a large number of shots. In this paper, a linearization of the OBS positioning problem via the multilateration technique is discussed. The discussed linear solution solves jointly for the average water layer velocity and the OBS position using only shot locations and first arrival times as input data.

  12. Occupation and risk of primary fallopian tube carcinoma in Nordic countries

    DEFF Research Database (Denmark)

    Riska, A; Martinsen, J I; Kjaerheim, K

    2012-01-01

    .11-2.29, Obs = 32), nurses (1.49, 1.14-1.92, Obs = 60), shop workers (1.25, 1.07-1.46, Obs = 159) and clerical workers (1.20, 1.07-1.35, Obs = 271) and these sustained over times and different Nordic countries. There was a nonsignificant increased risk for PFTC among welders, printers, painters and chemical...

  13. A Characterization of Movement Skills in Obese Children with and without Prader-Willi Syndrome

    Science.gov (United States)

    Lam, Melanie Y.; Rubin, Daniela A.; Duran, Andrea T.; Chavoya, Frank A.; White, Elizabeth; Rose, Debra J.

    2016-01-01

    Purpose: The aim of this study was twofold: (a) to measure and compare motor proficiency in obese children with Prader-Willi syndrome (OB-PWS) to that in obese children without PWS (OB), and (b) to compare motor proficiency in OB-PWS and OB to normative data. Method: Motor proficiency was measured using the Bruininks-Oseretsky Test of Motor…

  14. Oil Bodies Extracted from High-Fat and Low-Fat Soybeans: Stability and Composition During Storage.

    Science.gov (United States)

    Wang, Qiu Ling; Li Cui, Chun; Jiang, Lian Zhou; Liu, Yue; Liang, Xin Ting; Hou, Jun Cai

    2017-06-01

    Soybeans contain oil bodies (OBs) that encapsulate triacylglycerols (TAGs) with a phospholipid monolayer carrying scattered proteins. In nature, soybean OBs can form natural emulsions in aqueous media and may serve as natural, minimally processed, stable, and pre-emulsified oil for addition into appropriate food systems. In this study, OBs were obtained by aqueous extraction from the mature seeds of 2 soybean crop cultivars, high-fat soybean and low-fat soybeans. The compositions of the extracted OBs were analyzed during storage at room temperature up to 14 d (pH = 7). The oxidative stability of these OBs, stored at 60 °C, was evaluated by measuring the presence of primary (lipid hydroperoxides) and secondary lipid oxidation products (malondialdehyde) by determining the standard peroxide value (PV) and thiobarbituric acid-reactive substances (TBARS) value. During storage, the contents of unsaturated fatty acids, phospholipids, and tocopherols declined in both OBs, while their mean particle diameters (d 32 ) and ζ-potentials increased. The changes in PV and TBARS values exhibited a similar trend for both OBs, but the OBs from low-fat soybeans had significantly lower PV and higher TBARS values than the OBs from high-fat soybean cultivars (P soybean cultivars had good stability during storage. © 2017 Institute of Food Technologists®.

  15. Ob padcu utopije

    Directory of Open Access Journals (Sweden)

    Pascal De Decker

    2009-01-01

    Full Text Available Po koncu 2. svetovne vojne so se začele graditi velike stanovanjske soseske. Pogosto so jih sestavljale stolpnice. Številne le 50 let pozneje podirajo oziroma jih temeljito prenavljajo. Modernistične ideje, ki so jih navdihnili predstavniki kongresa CIAM (Congrès International d’Architecture Moderne in Le Corbusier, so izgubile nekdanjo mikavnost. V tem prispevku si bomo ogledali razvoj dogodkov, predvsem pa se bomo posvetili napačni razlagi (simbolnega pomena bivališča, kakor so ga razumeli predstavniki modernističnega gibanja. Prav to napačno razumevanje je nazadnje pripeljalo do hitrega podiranja teh sosesk.

  16. ANCEIOct-ob-er

    Indian Academy of Sciences (India)

    work of Neumark [2], a British aeronautical engineer, which was published as early as 1965, but not ... You have raised a question that I have always been asking me whenever I get the current ... me want to show off their scholarship and assume the readers know the subject. I used to get ... keep myself away. Resonance is ...

  17. Influence of the metabolic syndrome on leptin and leptin receptor in breast cancer.

    Science.gov (United States)

    Carroll, Paul A; Healy, Laura; Lysaght, Joanne; Boyle, Terry; Reynolds, John V; Kennedy, M John; Pidgeon, Graham; Connolly, Elizabeth M

    2011-08-01

    Obesity and its associated metabolic syndrome (MetS) are recognized risk factors for breast cancer. The molecular basis for this association remains largely unknown. Adipokines, in particular leptin and adiponectin, are thought to form part of the mechanism linking obesity with cancer through their altered expression/production either systemically (endocrine pathway) or locally (paracrine/autocrine pathway). Using quantitative PCR, mRNA expression of adiponectin (AdipoQ) and leptin (Ob) in mammary adipose tissue (MAT), intratumoral leptin and associated ligand receptors (ObR, AdipoR1, and AdipoR2) was examined in 77 patients with complete anthropomorphic and serological data. Expression of Ob in MAT, and ObR in matched tumor tissue was significantly higher in patients with MetS compared to obese only or normal weight cancer patients (P < 0.005). There was no difference in intratumoral leptin adiponectin or its ligand receptors in the same groups. Individual features of MetS correlated with Ob and ObR expression, but not obesity markers (BMI, waist circumference). mRNA expression of leptin (Ob) and ObR, in adipose tissue and matched tumor samples, respectively, appear to be associated with obesity status in breast cancer. Increasing insulin resistance is a predominant feature of this higher Ob/ObR expression observed. These novel data indicate that the MetS may be an amenable risk factor for breast cancer. Copyright © 2011 Wiley-Liss, Inc.

  18. Npas4 Regulates Mdm2 and thus Dcx in Experience-Dependent Dendritic Spine Development of Newborn Olfactory Bulb Interneurons

    Directory of Open Access Journals (Sweden)

    Sei-ichi Yoshihara

    2014-08-01

    Full Text Available Sensory experience regulates the development of various brain structures, including the cortex, hippocampus, and olfactory bulb (OB. Little is known about how sensory experience regulates the dendritic spine development of OB interneurons, such as granule cells (GCs, although it is well studied in mitral/tufted cells. Here, we identify a transcription factor, Npas4, which is expressed in OB GCs immediately after sensory input and is required for dendritic spine formation. Npas4 overexpression in OB GCs increases dendritic spine density, even under sensory deprivation, and rescues reduction of dendrite spine density in the Npas4 knockout OB. Furthermore, loss of Npas4 upregulates expression of the E3-ubiquitin ligase Mdm2, which ubiquitinates a microtubule-associated protein Dcx. This leads to reduction in the dendritic spine density of OB GCs. Together, these findings suggest that Npas4 regulates Mdm2 expression to ubiquitinate and degrade Dcx during dendritic spine development in newborn OB GCs after sensory experience.

  19. Objective evaluation of analyzer performance based on a retrospective meta-analysis of instrument validation studies: point-of-care hematology analyzers.

    Science.gov (United States)

    Cook, Andrea M; Moritz, Andreas; Freeman, Kathleen P; Bauer, Natali

    2017-06-01

    Information on quality requirements and objective evaluation of performance of veterinary point-of-care analyzers (POCAs) is scarce. The study was aimed at assessing observed total errors (TE obs s) for veterinary hematology POCAs via meta-analysis and comparing TE obs to allowable total error (TE a ) specifications based on experts' opinions. The TE obs for POCAs (impedance and laser-based) was calculated based on data from instrument validation studies published between 2006 and 2013 as follows: TE obs = 2 × CV [%] + bias [%]. The CV was taken from published studies; the bias was estimated from the regression equation at 2 different concentration levels of measurands. To fulfill quality requirements, TE obs should be 60% of analyzers showed TE obs hematology variables, respectively. For the CBC, TE obs was TE a (data from 3 analyzers). This meta-analysis is considered a pilot study. Experts' requirements (TE obs < TE a ) were fulfilled for most measurands except HGB (due to instrument-related bias for the ADVIA 2120) and platelet counts. Available data on the WBC differential count suggest an analytic bias, so nonstatistical quality control is recommended. © 2017 American Society for Veterinary Clinical Pathology.

  20. FTO is a relevant factor for the development of the metabolic syndrome in mice.

    Directory of Open Access Journals (Sweden)

    Kathrin Ikels

    Full Text Available The metabolic syndrome is a worldwide problem mainly caused by obesity. FTO was found to be a obesity-risk gene in humans and FTO deficiency in mice led to reduction in adipose tissue. Thus, FTO is an important factor for the development of obesity. Leptin-deficient mice are a well characterized model for analysing the metabolic syndrome. To determine the relevance of FTO for the development of the metabolic syndrome we analysed different parameters in combined homozygous deficient mice (Lep(ob/ob;Fto(-/-. Lep(ob/ob;Fto(-/- mice showed an improvement in analysed hallmarks of the metabolic syndrome in comparison to leptin-deficient mice wild type or heterozygous for Fto. Lep(ob/ob;Fto(-/- mice did not develop hyperglycaemia and showed an improved glucose tolerance. Furthermore, extension of beta-cell mass was prevented in Lep(ob/ob;Fto(-/-mice and accumulation of ectopic fat in the liver was reduced. In conclusion this study demonstrates that FTO deficiency has a protective effect not only on the development of obesity but also on the metabolic syndrome. Thus, FTO plays an important role in the development of metabolic disorders and is an interesting target for therapeutic agents.

  1. Determinant Factors in the Production of a Co-Occluded Binary Mixture of Helicoverpa armigera Alphabaculovirus (HearNPV) Genotypes with Desirable Insecticidal Characteristics

    Science.gov (United States)

    Arrizubieta, Maite; Simón, Oihane; Williams, Trevor; Caballero, Primitivo

    2016-01-01

    A co-occluded binary mixture of Helicoverpa armigera nucleopolyhedrovirus genotypes HearSP1B and HearLB6 at a 1:1 ratio (HearSP1B+HearLB6) was selected for the development of a virus-based biological insecticide, which requires an efficient large-scale production system. In vivo production systems require optimization studies in each host-virus pathosystem. In the present study, the effects of larval instar, rearing density, timing of inoculation, inoculum concentration and temperature on the production of HearSP1B+HearLB6 in its homologous host were evaluated. The high prevalence of cannibalism in infected larvae (40–87%) indicated that insects require individual rearing to avoid major losses in OB production. The OB production of recently molted fifth instars (7.0 x 109 OBs/larva), combined with a high prevalence of mortality (85.7%), resulted in the highest overall OB yield (6.0 x 1011 OBs/100 inoculated larvae), compared to those of third or fourth instars. However, as inoculum concentration did not influence final OB yield, the lowest concentration, LC80 (5.5 x 106 OBs/ml), was selected. Incubation temperature did not significantly influence OB yield, although larvae maintained at 30°C died 13 and 34 hours earlier than those incubated at 26°C and 23°C, respectively. We conclude that the efficient production of HearSP1B+HearLB6 OBs involves inoculation of recently molted fifth instars with a LC80 concentration of OBs followed by individual rearing at 30°C. PMID:27732657

  2. Macronutrients and micronutrients of soybean oil bodies extracted at different pH.

    Science.gov (United States)

    Chen, Yeming; Cao, Yanyun; Zhao, Luping; Kong, Xiangzhen; Hua, Yufei

    2014-07-01

    In this study, the macronutrients and micronutrients of pH 6.8, 8.0, 9.5, and 11.0 extracted soybean oil bodies (OBs) were examined, revealing that soybean OBs might be used as a natural carrier for bioactive components (unsaturated fatty acids, phospholipid, tocopherol, and phytosterol). pH 6.8 extracted OBs (dry basis) contained 85.88% neutral lipid, 8.18% protein, and 5.85% polar lipid (mainly phospholipid) by gravimetric analysis. The percentage of neutral lipid was increased, while those of protein and polar lipid were decreased with increasing pH. Tocopherol (about 75 mg/100 g neutral lipid of OBs) was not affected, while phytosterol was decreased (136 to 110 mg/100 g neutral lipid of OBs) with increasing pH. The detectable total monosaccaride (galactosamine, glucosamine, and glucose) content of extracted OBs was low and also decreased (35.80 to 6.13 mg/100 g neutral lipid of OBs) with increasing pH. The protein of extracted OBs had higher percentage of essential amino acids than soybean protein isolate with tryptophan and methionine as limited amino acids. The fatty acid composition of extracted OBs was rich in linoleic acid (about 59%), oleic acid (about 20%), and α-linolenic acid (about 7%). Oil bodies (OBs) from soybean and other plant seeds are greatly examined owing to their potential utilizations in food ingredients. The determination of its macronutrients and micronutrients would be very meaningful for its efficient utilization in the future. © 2014 Institute of Food Technologists®

  3. Effects of coronal regions on the x-ray flux and ionization conditions in the winds of ob supergiants and of stars

    International Nuclear Information System (INIS)

    Cassinelli, J.P.; Olson, G.L.

    1979-01-01

    The anomalously strong O VI and N V lines in O stars and the C IV lines in B supergiants may be due to Auger ionization by X-rays from a thin coronal zone at the base of the cool stellar winds. We determine the size of a corona that is necessary to produce the overall ionization conditions in zeta Pup as has been deduced by Olson from line profile analysis. In the ionization balance calculations we account for diffuse radiation field in the wind and for the large optical depths in the He II continuum due to radiative and Auger ionization edges of abundant elements. The X-ray flux transmitted through the wind is calculated and compared with upper limits derived for upper limits derived for zeta Pup observations from ANS and Uhuru satellites. It is found that a coronal zone with a temperature of 5x10 6 K and a volume emission measure of 10 58 cm -3 can produce the required ionization in a wind having a temperature of 30,000--35,000 K. The emergent X-ray flux bears little resemblance to the coronal emissivity because of the opacity of the wind. The X-ray flux nearly reaches the upper limits derived from the ANS observations and, at several energy bands, should be detectable by the HEAO B satellite. A simplified analysis of the Auger ionization process is developed and applied to other Of and OB supergiants. We find that the model can explain the presence of C IV and Si IV in supergaints with effective temperatures as low as 12,000 K and can explain the appearance of O VI and N V lines in early type supergiants as late as BO.5 and B2, respectively

  4. Obesity-metabolic derangement exacerbates cardiomyocyte loss distal to moderate coronary artery stenosis in pigs without affecting global cardiac function.

    Science.gov (United States)

    Li, Zi-Lun; Ebrahimi, Behzad; Zhang, Xin; Eirin, Alfonso; Woollard, John R; Tang, Hui; Lerman, Amir; Wang, Shen-Ming; Lerman, Lilach O

    2014-04-01

    Obesity associated with metabolic derangements (ObM) worsens the prognosis of patients with coronary artery stenosis (CAS), but the underlying cardiac pathophysiologic mechanisms remain elusive. We tested the hypothesis that ObM exacerbates cardiomyocyte loss distal to moderate CAS. Obesity-prone pigs were randomized to four groups (n = 6 each): lean-sham, ObM-sham, lean-CAS, and ObM-CAS. Lean and ObM pigs were maintained on a 12-wk standard or atherogenic diet, respectively, and left circumflex CAS was then induced by placing local-irritant coils. Cardiac structure, function, and myocardial oxygenation were assessed 4 wk later by computed-tomography and blood oxygenation level dependent (BOLD) MRI, the microcirculation with micro-computed-tomography, and injury mechanisms by immunoblotting and histology. ObM pigs showed obesity, dyslipidemia, and insulin resistance. The degree of CAS (range, 50-70%) was similar in lean and ObM pigs, and resting myocardial perfusion and global cardiac function remained unchanged. Increased angiogenesis distal to the moderate CAS observed in lean was attenuated in ObM pigs, which also showed microvascular dysfunction and increased inflammation (M1-macrophages, TNF-α expression), oxidative stress (gp91), hypoxia (BOLD-MRI), and fibrosis (Sirius-red and trichrome). Furthermore, lean-CAS showed increased myocardial autophagy, which was blunted in ObM pigs (downregulated expression of unc-51-like kinase-1 and autophagy-related gene-12; P < 0.05 vs. lean CAS) and associated with marked apoptosis. The interaction diet xstenosis synergistically inhibited angiogenic, autophagic, and fibrogenic activities. ObM exacerbates structural and functional myocardial injury distal to moderate CAS with preserved myocardial perfusion, possibly due to impaired cardiomyocyte turnover.

  5. Selection effects on GRB spectral-energy correlations

    International Nuclear Information System (INIS)

    Nava, Lara; Ghirlanda, Giancarlo; Ghisellini, Gabriele

    2009-01-01

    Instrumental selection effects can act upon the estimates of the peak energy E peak obs , the fluence F and the peak flux P of GRBs. If this were the case, then the correlations involving the corresponding rest frame quantities (i.e. E peak , E obs and the peak luminosity L iso ) would be questioned. We estimated, as a function of E peak obs , the minimum peak flux necessary to trigger a GRB and the minimum fluence a burst must have to determine the value of E peak obs by considering different instruments (BATSE, Swift, BeppoSAX). We find that the latter dominates over the former. We then study the E peak obs -fluence (and flux) correlation in the observer plane. GRBs with redshift show well defined E peak obs -F and E peak obs -P correlations: in this planes the selection effects are present, but do not determine the found correlations. This is not true for Swift GRBs with redshift, for which the spectral analysis threshold does affect their distribution in the observer planes. Extending the sample to GRBs without z, we still find a significant E peak obs -F correlation, although with a larger scatter than that defined by GRBs with redshift. We find that 6% are outliers of the Amati correlation. The E peak obs -P correlation of GRBs with or without redshift is the same and no outlier is found among bursts without redshift.

  6. Cumulative incidence of youth obesity is associated with low cardiorespiratory fitness levels and with maternal overweight

    Directory of Open Access Journals (Sweden)

    Anelise Reis Gaya

    2015-12-01

    Full Text Available Abstract This longitudinal study evaluated the association between the incidence of youth overweight/obesity (Ow/Ob and low levels of cardiorespiratory fitness (CRF over 4 years and youths' and their parents' demographic and nutritional characteristics. The randomized sample comprised 398 youth, aged 7-17 years at baseline, from a city in southern Brazil. Subjects were classified as being Ow/Ob according to international body mass index (BMI parameters. Parental weight and height were determined by direct questioning. Youth CRF was measured by a 9-minute walk-and-run test. The cumulative incidences of Ow/Ob and of low CRF levels were 25.1% and 20.5%, respectively. Relative to other youth, youth who were classified as "unhealthy" at baseline (with respect to CRF and by the fourth year were more likely to be classified as Ow/Ob (relative risks: 1.12 and 1.10, respectively. Youth whose mothers were categorized as Ow/Ob were at higher risk of being classified as Ow/Ob than youth whose mothers had normal BMIs (relative risks: 1.19 at baseline and 1.20 in the fourth year. The incidence of Ow/Ob among the former youth was associated with low CRF levels and with maternal Ob.

  7. Pattern of Ambulatory Care Visits to Obstetrician-Gynecologists in Taiwan: A Nationwide Analysis

    Directory of Open Access Journals (Sweden)

    An-Min Lynn

    2015-06-01

    Full Text Available Although obstetrician-gynecologists (OB-GYNs are the main actors in the provision of health care to women, their practice patterns have rarely been analyzed. The current study investigated the nationwide ambulatory visits to OB-GYNs in Taiwan using the National Health Insurance Research Database. From the 1/500 sampling datasets indicating 619,760 ambulatory visits in 2012, it was found that 5.8% (n = 35,697 of the visits were made to OB-GYNs. Two-fifths of the services provided were performed by male OB-GYNs aged 50–59 years. Women of childbearing age accounted for more than half of the visits to OB-GYNs (57.2%, and elderly patients above 60 years accounted for only 7.7%. The most frequent diagnoses were menstrual disorders and other forms of abnormal bleeding from the female genital tract (13.1%. Anti-infective agents were prescribed in 15.1% of the visits to OB-GYNs. The study revealed the proportion of aging practicing OB-GYNs, and our detailed results could contribute to evidence-based discussions on health policymaking.

  8. Obesity is associated with depot-specific alterations in adipocyte DNA methylation and gene expression

    DEFF Research Database (Denmark)

    Sonne, Si Brask; Yadav, Rachita; Yin, Guangliang

    2017-01-01

    The present study aimed to identify genes exhibiting concomitant obesity-dependent changes in DNA methylation and gene expression in adipose tissues in the mouse using diet-induced obese (DIO) C57BL/6J and genetically obese ob/ob mice as models. Mature adipocytes were isolated from epididymal...... and inguinal adipose tissues of ob/ob and DIO C57BL/6J mice. DNA methylation was analyzed by MeDIP-sequencing and gene expression by microarray analysis. The majority of differentially methylated regions (DMRs) were hypomethylated in obese mice. Global methylation of long interspersed elements indicated......57BL/6J mice occurred primarily in exons, whereas inguinal adipocytes of ob/ob mice exhibited a higher enrichment of DMRs in promoter regions than in other regions of the genome, suggesting an influence of leptin on DNA methylation in inguinal adipocytes. We observed altered methylation...

  9. Dicty_cDB: Contig-U15883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi

  10. Hemogasometria de eqüinos submetidos à obstrução experimental do duodeno, íleo e cólon maior Blood gas analysis of horses submitted to experimental obstruction of duodenum, ileum and large colon

    Directory of Open Access Journals (Sweden)

    Paula Alessandra Di Filippo

    2009-02-01

    Full Text Available Visando estudar os parâmetros do equilíbrio ácido-base de eqüinos submetidos a um modelo experimental de obstrução intestinal, 24 animais foram distribuídos em quatro grupos, controle instrumentado (GI, obstrução do duodeno (GII, íleo (GIII e cólon maior (GIV. As amostras de sangue venoso foram coletadas antes das cirurgias (T0, durante as obstruções (T30ob-T180ob e após as desobstruções (T60des-T180des. Os eqüinos do GIV, no T30ob, e os eqüinos do GII, nos T60ob, T90ob e T120ob, apresentaram aumento do pH(v, da cHCO-3(vP e da cBase(v que, acrescidos do aumento da pCO2(v e da ctCO2(v, caracterizou a alcalose metabólica com compensação respiratória. Nos T90ob e T120ob, nos animais do GII, e no T180ob, nos animais do GIII, a pO2(v e a sO2(v tiveram comportamento semelhante. Os valores baixos apresentados pelos animais do GII foram associados à hipercapnia ou à hipoventilação, desencadeadas para a correção da alcalose metabólica. Entretanto, a hipoxemia apresentada pelos animais do GIII foi associada à hipovolemia presente neste período. As alterações ácido-base observadas constituem-se de alterações leves e temporárias, as quais não são capazes de predizer o diagnóstico das obstruções intestinais específicas em eqüinos com cólica. Entretanto, por relacionarem-se diretamente com a precocidade do distúrbio gastrintestinal, elas auxiliam o pesquisador no prognóstico.This study aimed to evaluate parameters of acid-base balance in horses submitted to an experimental model of intestinal obstruction. Twenty-four animals were divided in four groups: instrumented control (GI, duodenum obstruction (GII, ileum obstruction (GIII and large colon obstruction (GIV. Venous blood samples were collected before surgery (T0, during the obstruction (T30ob-T180ob and after unblocking procedures (T60des-T180des. Animals from GIV, at T30ob and animals from GII, at T60ob, T90ob and T120ob, presented higher values for pH(v, c

  11. Leptin deficiency-induced obesity affects the density of mast cells in abdominal fat depots and lymph nodes in mice

    Directory of Open Access Journals (Sweden)

    Altintas Mehmet M

    2012-02-01

    Full Text Available Abstract Background Mast cells are implicated in the pathogenesis of obesity and insulin resistance. Here, we explored the effects of leptin deficiency-induced obesity on the density of mast cells in metabolic (abdominal fat depots, skeletal muscle, and liver and lymphatic (abdominal lymph nodes, spleen, and thymus organs. Fourteen-week-old male leptin-deficient ob/ob mice and their controls fed a standard chow were studied. Tissue sections were stained with toluidine blue to determine the density of mast cells. CD117/c-kit protein expression analysis was also carried out. Furthermore, mast cells containing immunoreactive tumor necrosis factor-α (TNF-α, a proinflammatory cytokine involved in obesity-linked insulin resistance, were identified by immunostaining. Results ob/ob mice demonstrated adiposity and insulin resistance. In abdominal fat depots, mast cells were distributed differentially. While most prevalent in subcutaneous fat in controls, mast cells were most abundant in epididymal fat in ob/ob mice. Leptin deficiency-induced obesity was accompanied by a 20-fold increase in the density of mast cells in epididymal fat, but a 13-fold decrease in subcutaneous fat. This finding was confirmed by CD117/c-kit protein expression analysis. Furthermore, we found that a subset of mast cells in epididymal and subcutaneous fat were immunoreactive for TNF-α. The proportion of mast cells immunoreactive for TNF-α was higher in epididymal than in subcutaneous fat in both ob/ob and control mice. Mast cells were also distributed differentially in retroperitoneal, mesenteric, and inguinal lymph nodes. In both ob/ob mice and lean controls, mast cells were more prevalent in retroperitoneal than in mesenteric and inguinal lymph nodes. Leptin deficiency-induced obesity was accompanied by increased mast cell density in all lymph node stations examined. No significant difference in the density of mast cells in skeletal muscle, liver, spleen, and thymus was

  12. Modulation of insulin-like growth factor 1 levels in human osteoarthritic subchondral bone osteoblasts.

    Science.gov (United States)

    Massicotte, Frédéric; Fernandes, Julio Cesar; Martel-Pelletier, Johanne; Pelletier, Jean-Pierre; Lajeunesse, Daniel

    2006-03-01

    Human osteoarthritis (OA) is characterized by cartilage loss, bone sclerosis, osteophyte formation and inflammation of the synovial membrane. We previously reported that OA osteoblasts (Ob) show abnormal phenotypic characteristics possibly responsible for bone sclerosis and that two subgroups of OA patients can be identified by low or high endogenous production of prostaglandin E2 (PGE2) by OA Ob. Here, we determined that the elevated PGE2 levels in the high OA subgroup were linked with enhanced cyclooxygenase-2 (COX-2) protein levels compared to normal and low OA Ob. A linear relationship was observed between endogenous PGE2 levels and insulin-like growth factor 1 (IGF-1) levels in OA Ob. As parathyroid hormone (PTH) and PGE2 are known stimulators of IGF-1 production in Ob, we next evaluated their effect in OA Ob. Both subgroups increased their IGF-1 production similarly in response to PGE2, while the high OA subgroup showed a blunted response to PTH compared to the low OA group. Conversely, only the high OA group showed a significant inhibition of IGF-1 production when PGE2 synthesis was reduced with Naproxen, a non-steroidal antiinflammatory drug (NSAID) that inhibits cyclooxygenases (COX). The PGE2-dependent stimulation of IGF-1 synthesis was due in part to the cAMP/protein kinase A pathway since both the direct inhibition of this pathway with H-89 and the inhibition of EP2 or EP4 receptors, linked to cAMP production, reduced IGF-1 synthesis. The production of the most abundant IGF-1 binding proteins (IGFBPs) in bone tissue, IGFBP-3, -4, and -5, was lower in OA compared to normal Ob independently of the OA group. Under basal condition, OA Ob expressed similar IGF-1 mRNA to normal Ob; however, PGE2 stimulated IGF-1 mRNA expression more in OA than normal Ob. These data suggest that increased IGF-1 levels correlate with elevated endogenous PGE2 levels in OA Ob and that higher IGF-1 levels in OA Ob could be important for bone sclerosis in OA.

  13. Associations of maternal employment and three-generation families with pre-school children's overweight and obesity in Japan.

    Science.gov (United States)

    Watanabe, E; Lee, J S; Kawakubo, K

    2011-07-01

    Maternal employment has been shown to be associated with childhood overweight and obesity (Ow/Ob), but the presence of family members who care for children in place of the mothers might influence children's Ow/Ob and lifestyles. The influence of maternal employment on children's Ow/Ob should be examined together with the presence of caregivers such as grandparents. The effects of maternal employment and the presence of grandparents on lifestyles and Ow/Ob in Japanese pre-school children were investigated. Cross-sectional study on 2114 children aged 3-6 years who attended all childcare facilities in a city and primary caregivers was conducted. Children's weight and height, family environments (family members, maternal employment, single parent, number of siblings and parental Ow/Ob) and lifestyles (dietary, physical activity and sleeping habits) were surveyed using a self-administered questionnaire. Ow/Ob was defined by the International Obesity Task Force cut-offs. The eligible participants were 1765 children. The prevalence of Ow/Ob was 8.4% in boys and 9.9% in girls. Maternal employment was associated positively with irregular mealtimes, unfixed snacking times, bedtime after 10 p.m. and nighttime sleep duration of less than 10 h, whereas three-generation families were associated negatively with irregular mealtimes after adjustment for children's characteristics and family environments. Irregular mealtimes (OR (95% CI); 2.03 (1.36, 3.06)) and nighttime sleep duration of less than 10 h (1.96 (1.28, 3.01)) were associated with increased risks of being Ow/Ob. Both maternal employment and three-generation families were significantly associated with children's Ow/Ob. However, three-generation families maintained a significant association (1.59 (1.08, 2.35)) after adjustment for maternal employment. These study results suggest that the grandparents who care for pre-school children in place of mothers are more likely to contribute to childhood Ow/Ob than maternal

  14. Uveal effusion syndrome in 104 eyes: Response to corticosteroids – The 2017 Axel C. Hansen lecture

    Directory of Open Access Journals (Sweden)

    Carol L Shields

    2017-01-01

    Full Text Available Purpose: The purpose of the study was to investigate the corticosteroids for uveal effusion syndrome (UES. Methods: Retrospective series of 104 eyes with UES treated with oral corticosteroids (OCS, periocular corticosteroids (PCS, topical corticosteroids (TCS, or observation (OBS. Main outcome measure was UES resolution. Results: Of 104 eyes, treatment included OCS (n = 27, PCS (n = 12, TCS (n = 11, and OBS (n = 54. A comparison of the four groups (OCS vs. PCS vs. TCS vs. OBS revealed differences in those managed with OCS versus OBS as younger (66 vs. 72 years, P = 0.049, PCS versus OBS as male (100% vs. 54%, P = 0.002, PCS versus OBS with decreased visual acuity (VA/visual field (91% vs. 51%, P = 0.018, and OBS versus OCS as asymptomatic (28% vs. 0%, P = 0.001. Of the 59 with follow-up information, management included OCS (n = 21, PCS (n = 12, TCS (n = 6, and OBS (n = 20. There were differences in initial VA <20/400 in PCS versus OBS (42% vs. 5%, P = 0.018, effusion thickness in TCS versus OCS (7 vs. 3 mm, P = 0.004, and serous retinal detachment in PCS versus OBS (100% vs. 30%, P < 0.001 and PCS versus OCS (100% vs. 57%, P = 0.012. Regarding outcomes, VA showed less worsening in OCS versus OBS (0% vs. 30%, P = 0.008 and OCS versus PCS (0% vs. 33%, P = 0.012. There was no difference in rate of effusion resolution or effusion recurrence. Overall, using combination of corticosteroid therapies, effusion resolution was achieved in 56/59 (95% cases and the need for surgical management with scleral windows was necessary in only 3/59 (5% cases. Complications included cataract (n = 9 and no instance of steroid-induced glaucoma. Conclusion: Management of UES is complex and depends on disease severity. Using various corticosteroid delivery routes, UES control was achieved in 95%, and scleral window surgery was required in only 5%. A trial of corticosteroids can benefit patients with UES.

  15. Leptin Signaling Is Required for Adaptive Changes in Food Intake, but Not Energy Expenditure, in Response to Different Thermal Conditions

    Science.gov (United States)

    Kaiyala, Karl J.; Ogimoto, Kayoko; Nelson, Jarrell T.; Schwartz, Michael W.; Morton, Gregory J.

    2015-01-01

    Survival of free-living animals depends on the ability to maintain core body temperature in the face of rapid and dramatic changes in their thermal environment. If food intake is not adjusted to meet the changing energy demands associated with changes of ambient temperature, a serious challenge to body energy stores can occur. To more fully understand the coupling of thermoregulation to energy homeostasis in normal animals and to investigate the role of the adipose hormone leptin to this process, comprehensive measures of energy homeostasis and core temperature were obtained in leptin-deficient ob/ob mice and their wild-type (WT) littermate controls when housed under cool (14°C), usual (22°C) or ∼ thermoneutral (30°C) conditions. Our findings extend previous evidence that WT mice robustly defend normothermia in response to either a lowering (14°C) or an increase (30°C) of ambient temperature without changes in body weight or body composition. In contrast, leptin-deficient, ob/ob mice fail to defend normothermia at ambient temperatures lower than thermoneutrality and exhibit marked losses of both body fat and lean mass when exposed to cooler environments (14°C). Our findings further demonstrate a strong inverse relationship between ambient temperature and energy expenditure in WT mice, a relationship that is preserved in ob/ob mice. However, thermal conductance analysis indicates defective heat retention in ob/ob mice, irrespective of temperature. While a negative relationship between ambient temperature and energy intake also exists in WT mice, this relationship is disrupted in ob/ob mice. Thus, to meet the thermoregulatory demands of different ambient temperatures, leptin signaling is required for adaptive changes in both energy intake and thermal conductance. A better understanding of the mechanisms coupling thermoregulation to energy homeostasis may lead to the development of new approaches for the treatment of obesity. PMID:25756181

  16. Leptin/HER2 crosstalk in breast cancer: in vitro study and preliminary in vivo analysis

    International Nuclear Information System (INIS)

    Fiorio, Elena; Bonetti, Franco; Giordano, Antonio; Cetto, Gian Luigi; Surmacz, Eva; Mercanti, Anna; Terrasi, Marianna; Micciolo, Rocco; Remo, Andrea; Auriemma, Alessandra; Molino, Annamaria; Parolin, Veronica; Di Stefano, Bruno

    2008-01-01

    Obesity in postmenopausal women is associated with increased breast cancer risk, development of more aggressive tumors and resistance to certain anti-breast cancer treatments. Some of these effects might be mediated by obesity hormone leptin, acting independently or modulating other signaling pathways. Here we focused on the link between leptin and HER2. We tested if HER2 and the leptin receptor (ObR) can be coexpressed in breast cancer cell models, whether these two receptors can physically interact, and whether leptin can transactivate HER2. Next, we studied if leptin/ObR can coexist with HER2 in breast cancer tissues, and if presence of these two systems correlates with specific clinicopathological features. Expression of ObR, HER2, phospo-HER2 was assessed by immonoblotting. Physical interactions between ObR and HER2 were probed by immunoprecipitation and fluorescent immunostaining. Expression of leptin and ObR in breast cancer tissues was detected by immunohistochemistry (IHC). Associations among markers studied by IHC were evaluated using Fisher's exact test for count data. HER2 and ObR were coexpressed in all studied breast cancer cell lines. In MCF-7 cells, HER2 physically interacted with ObR and leptin treatment increased HER2 phosphorylation on Tyr 1248. In 59 breast cancers, the presence of leptin was correlated with ObR (the overall association was about 93%). This result was confirmed both in HER2-positive and in HER2-negative subgroups. The expression of leptin or ObR was numerically more frequent in larger (> 10 mm) tumors. Coexpression of HER2 and the leptin/ObR system might contribute to enhanced HER2 activity and reduced sensitivity to anti-HER2 treatments

  17. Early peroxisome proliferator-activated receptor gamma regulated genes involved in expansion of pancreatic beta cell mass

    Directory of Open Access Journals (Sweden)

    Vivas Yurena

    2011-12-01

    Full Text Available Abstract Background The progression towards type 2 diabetes depends on the allostatic response of pancreatic beta cells to synthesise and secrete enough insulin to compensate for insulin resistance. The endocrine pancreas is a plastic tissue able to expand or regress in response to the requirements imposed by physiological and pathophysiological states associated to insulin resistance such as pregnancy, obesity or ageing, but the mechanisms mediating beta cell mass expansion in these scenarios are not well defined. We have recently shown that ob/ob mice with genetic ablation of PPARγ2, a mouse model known as the POKO mouse failed to expand its beta cell mass. This phenotype contrasted with the appropriate expansion of the beta cell mass observed in their obese littermate ob/ob mice. Thus, comparison of these models islets particularly at early ages could provide some new insights on early PPARγ dependent transcriptional responses involved in the process of beta cell mass expansion Results Here we have investigated PPARγ dependent transcriptional responses occurring during the early stages of beta cell adaptation to insulin resistance in wild type, ob/ob, PPARγ2 KO and POKO mice. We have identified genes known to regulate both the rate of proliferation and the survival signals of beta cells. Moreover we have also identified new pathways induced in ob/ob islets that remained unchanged in POKO islets, suggesting an important role for PPARγ in maintenance/activation of mechanisms essential for the continued function of the beta cell. Conclusions Our data suggest that the expansion of beta cell mass observed in ob/ob islets is associated with the activation of an immune response that fails to occur in POKO islets. We have also indentified other PPARγ dependent differentially regulated pathways including cholesterol biosynthesis, apoptosis through TGF-β signaling and decreased oxidative phosphorylation.

  18. A SEARCH FOR STELLAR-MASS BLACK HOLES VIA ASTROMETRIC MICROLENSING

    Energy Technology Data Exchange (ETDEWEB)

    Lu, J. R. [Astronomy Department, University of California, Berkeley, CA 94720 (United States); Sinukoff, E. [Institute for Astronomy, University of Hawai‘i at Mānoa, Honolulu, HI 96822 (United States); Ofek, E. O. [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Rehovot, 76100 (Israel); Udalski, A.; Kozlowski, S. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland)

    2016-10-10

    While dozens of stellar-mass black holes (BHs) have been discovered in binary systems, isolated BHs have eluded detection. Their presence can be inferred when they lens light from a background star. We attempt to detect the astrometric lensing signatures of three photometrically identified microlensing events, OGLE-2011-BLG-0022, OGLE-2011-BLG-0125, and OGLE-2012-BLG-0169 (OB110022, OB110125, and OB120169), located toward the Galactic Bulge. These events were selected because of their long durations, which statistically favors more massive lenses. Astrometric measurements were made over one to two years using laser-guided adaptive optics observations from the W. M. Keck Observatory. Lens model parameters were first constrained by the photometric light curves. The OB120169 light curve is well fit by a single-lens model, while both OB110022 and OB110125 light curves favor binary lens models. Using the photometric fits as prior information, no significant astrometric lensing signal was detected and all targets were consistent with linear motion. The significant lack of astrometric signal constrains the lens mass of OB110022 to 0.05–1.79 M {sub ⊙} in a 99.7% confidence interval, which disfavors a BH lens. Fits to OB110125 yielded a reduced Einstein crossing time and insufficient observations during the peak, so no mass limits were obtained. Two degenerate solutions exist for OB120169, which have a lens mass between 0.2–38.8 M {sub ⊙} and 0.4–39.8 M {sub ⊙} for a 99.7% confidence interval. Follow-up observations of OB120169 will further constrain the lens mass. Based on our experience, we use simulations to design optimal astrometric observing strategies and show that with more typical observing conditions the detection of BHs is feasible.

  19. Size matters - The olfactory bulb as a marker for depression.

    Science.gov (United States)

    Rottstaedt, F; Weidner, K; Strauß, T; Schellong, J; Kitzler, H; Wolff-Stephan, S; Hummel, T; Croy, I

    2018-03-15

    Major Depression is mainly related to structural and functional alterations in brain networks involving limbic and prefrontal regions. Reduced olfactory sensitivity in depression is associated with reduced olfactory bulb (OB) volume. We determined if the OB volume reduction is a specific biomarker for depression and whether its diagnostic accuracy allows its use as a valid biomarker to support its diagnosis. 84 in-patients with mixed mental disorders and 51 age-matched healthy controls underwent structural MR imaging with a spin-echo T2-wheighted sequence. Individual OB volume was calculated manually (interrater-reliability = .81, p < .001) and compared between groups. Multiple regression analysis with OB volume as dependent variable and Receiver Operator Characteristic analysis to obtain its diagnostic accuracy for depression were ruled out. Patients exhibited a 13.5% reduced OB volume. Multiple regression analysis showed that the OB volume variation was best explained by depression (β = -.19), sex (β = -.31) and age (β = -.29), but not by any other mental disorder. OB volume attained a diagnostic accuracy of 68.1% for depression. The patient group mainly contained highly comorbid patients with mostly internalizing disorders which limits the generalisability of the results of the regression analysis. The OB may serve as a marker for depression. We assume that reduced neural olfactory input to subsequent limbic and salience processing structures moderates this relation. However, the OB was in an inferior position compared to conventional questionnaires for diagnosis of depression. Combination with further structural or functional measurements is suggested. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. Effects of high fat diet, ovariectomy, and physical activity on leptin receptor expression in rat brain and white fat tissue.

    Science.gov (United States)

    Blažetić, Senka; Labak, Irena; Viljetić, Barbara; Balog, Marta; Vari, Sandor G; Krivošíková, Zora; Gajdoš, Martin; Kramárová, Patrícia; Kebis, Anton; Vuković, Rosemary; Puljak, Livia; Has-Schön, Elizabeta; Heffer, Marija

    2014-06-01

    To evaluate in a rat animal model whether ovariectomy, high fat diet (HFD), and physical activity in the form of running affect leptin receptor (Ob-R) distribution in the brain and white fat tissue compared to sham (Sh) surgery, standard diet (StD), and sedentary conditions. The study included 48 female laboratory Wistar rats (4 weeks old). Following eight weeks of feeding with standard or HFD, rats were subjected to either OVX or Sh surgery. After surgery, all animals continued StD or HFD for the next 10 weeks. During these 10 weeks, ovariectomy and Sh groups were subjected to physical activity or sedentary conditions. Free-floating immunohistochemistry and Western blot methods were carried out to detect Ob-R in the brain and adipose tissue. StD-ovariectomy-sedentary group had a greater number of Ob-R positive neurons in lateral hypothalamic nuclei than StD-Sh-sedentary group. There was no difference in Ob-R positive neurons in arcuatus nuclei between all groups. Ob-R distribution in the barrel cortex was higher in HFD group than in StD group. Ob-R presence in perirenal and subcutaneous fat was decreased in StD-ovariectomy group. HFD and ovariectomy increased Ob-R distribution in lateral hypothalamic nuclei, but there was no effect on arcuatus nuclei. Our results are first to suggest that HFD, ovariectomy, and physical activity affect Ob-R distribution in the barrel cortex, which might be correlated with the role of Ob-R in election of food in rats.

  1. Cellular and molecular cues of glucose sensing in the rat olfactory bulb

    Directory of Open Access Journals (Sweden)

    Dolly eAl Koborssy

    2014-10-01

    Full Text Available In the brain, glucose homeostasis of extracellular fluid is crucial to the point that systems specifically dedicated to glucose sensing are found in areas involved in energy regulation and feeding behavior. Olfaction is a major sensory modality regulating food consumption. Nutritional status in turn modulates olfactory detection. Recently it has been proposed that some olfactory bulb (OB neurons respond to glucose similarly to hypothalamic neurons. However, the precise molecular cues governing glucose sensing in the OB are largely unknown. To decrypt these molecular mechanisms, we first used immunostaining to demonstrate a strong expression of two neuronal markers of glucose-sensitivity, insulin-dependent glucose transporter type 4 (GLUT4, and sodium glucose co-transporter type 1 (SGLT1 in specific OB layers. We showed that expression and mapping of GLUT4 but not SGLT1 were feeding state-dependent. In order to investigate the impact of metabolic status on the delivery of blood-borne glucose to the OB, we measured extracellular fluid glucose concentration using glucose biosensors simultaneously in the OB and cortex of anesthetized rats. We showed that glucose concentration in the OB is higher than in the cortex, that metabolic steady-state glucose concentration is independent of feeding state in the two brain areas, and that acute changes in glycemic conditions affect bulbar glucose concentration alone. These data provide new evidence of a direct relationship between the OB and peripheral metabolism, and emphasize the importance of glucose for the OB network, providing strong arguments toward establishing the OB as a glucose-sensing organ.

  2. Roles of Obstetrician-Gynecologist Hospitalists with Changes in the Obstetrician-Gynecologist Workforce and Practice.

    Science.gov (United States)

    Tessmer-Tuck, Jennifer A; Rayburn, William F

    2015-09-01

    Obstetrician-gynecologists (OB-GYNs) are the fourth largest group of physicians and the only specialty dedicated solely to women's health care. The specialty is unique in providing 24-hour inpatient coverage, surgical care and ambulatory preventive health care. This article identifies and reviews changes in the OB-GYN workforce, including more female OB-GYNs, an increasing emphasis on work-life balance, more sub-specialization, larger group practices with more employed physicians and, finally, an emphasis on quality and performance improvement. It then describes the evolution of the OB-GYN hospitalist movement to date and the role of OB-GYN hospitalists in the future with regard to these workforce changes. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Logika vernakularne arhitekture nasproti novemu grajenemu tkivu. Bele lise prostorskega načrtovanja

    Directory of Open Access Journals (Sweden)

    Domen Zupančič

    2004-01-01

    Full Text Available Vernakularna arhitektura je preverjena arhitektura, tako v času kot materialu in funkciji. Prikazana je sistemska napaka, ki se je pokazala ob izrednem dogodku – močni nalivi v kratkem časovnem obdobju. Načrtovanje in razvoj podeželja je proces, v katerem sodeluje množica strokovnjakov, uporabnikov prostora in ostalih uradov ter ustanov. V občini Kranjska Gora je bila komunikacija med občino, občani in strokovnim krogom intenzivna in kakovostna. Ocenjujem jo kot šolski primer pravilnega komuniciranja. Navkljub temu pa se je ob izrednem dogodku pokazalo nekaj šibkih členov v tej verigi – bele lise v matriki prostorskega načrtovanja.

  4. Chronic rejection of a lung transplant is characterized by a profile of specific autoantibodies

    DEFF Research Database (Denmark)

    Hagedorn, Peter; Burton, Christopher M.; Carlsen, Jørn

    2010-01-01

    Obliterative bronchiolitis (OB) continues to be the major limitation to long-term survival after lung transplantation. The specific aetiology and pathogenesis of OB are not well understood. To explore the role of autoreactivity in OB, we spotted 751 different self molecules onto glass slides, and...

  5. Mixed genotype transmission bodies and virions contribute to the maintenance of diversity in an insect virus

    Science.gov (United States)

    Clavijo, Gabriel; Williams, Trevor; Muñoz, Delia; Caballero, Primitivo; López-Ferber, Miguel

    2010-01-01

    An insect nucleopolyhedrovirus naturally survives as a mixture of at least nine genotypes. Infection by multiple genotypes results in the production of virus occlusion bodies (OBs) with greater pathogenicity than those of any genotype alone. We tested the hypothesis that each OB contains a genotypically diverse population of virions. Few insects died following inoculation with an experimental two-genotype mixture at a dose of one OB per insect, but a high proportion of multiple infections were observed (50%), which differed significantly from the frequencies predicted by a non-associated transmission model in which genotypes are segregated into distinct OBs. By contrast, insects that consumed multiple OBs experienced higher mortality and infection frequencies did not differ significantly from those of the non-associated model. Inoculation with genotypically complex wild-type OBs indicated that genotypes tend to be transmitted in association, rather than as independent entities, irrespective of dose. To examine the hypothesis that virions may themselves be genotypically heterogeneous, cell culture plaques derived from individual virions were analysed to reveal that one-third of virions was of mixed genotype, irrespective of the genotypic composition of the OBs. We conclude that co-occlusion of genotypically distinct virions in each OB is an adaptive mechanism that favours the maintenance of virus diversity during insect-to-insect transmission. PMID:19939845

  6. Ocean bottom seismometer technology

    Science.gov (United States)

    Prothero, William A., Jr.

    Seismometers have been placed on the ocean bottom for about 45 years, beginning with the work of Ewing and Vine [1938], and their current use to measure signals from earthquakes and explosions constitutes an important research method for seismological studies. Approximately 20 research groups are active in the United Kingdom, France, West Germany, Japan, Canada, and the United States. A review of ocean bottom seismometer (OBS) instrument characteristics and OBS scientific studies may be found in Whitmarsh and Lilwall [1984]. OBS instrumentation is also important for land seismology. The recording systems that have been developed have been generally more sophisticated than those available for land use, and several modern land seismic recording systems are based on OBS recording system designs.The instrumentation developed for OBS work was the topic of a meeting held at the University of California, Santa Barbara, in July 1982. This article will discuss the state of the art of OBS Technology, some of the problems remaining to be solved, and some of the solutions proposed and implemented by OBS scientists and engineers. It is not intended as a comprehensive review of existing instrumentation.

  7. Oligoclonal bands in the cerebrospinal fluid and increased brain atrophy in early stages of relapsing-remitting multiple sclerosis

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Rojas

    2012-08-01

    Full Text Available OBJECTIVE: To determine if the presence of oligoclonal bands (OB at early stages of multiple sclerosis was associated with higher brain atrophy, when compared with patients without OB. METHODS: Relapsing-remitting multiple sclerosis (RRMS patients with less than two years of disease onset and OB detection in cerebrospinal fluid (CSF were included. SIENAX was used for total brain volume (TBV, gray matter volume (GMV, and white matter volume (WMV. RESULTS: Forty patients were included, 29 had positive IgG-OB. No differences were found between positive and negative patients in gender, expanded disability status scale (EDSS, treatment received, and T2/T1 lesion load. TBV in positive IgG-OB patients was 1.5 mm³ x 10(6 compared with 1.64 mm³ x 10(6 in the negative ones (p=0.02. GMV was 0.51 mm³ x 10(6 in positive IgG-OB compared with 0.62 mm³ x 10(6 in negative ones (p=0.002. No differences in WMV (p=0.09 were seen. CONCLUSIONS: IgG-OB in the CSF was related to neurodegeneration magnetic resonance (MR markers in early RRMS.

  8. TORO: ninety-six-week virologic and immunologic response and safety evaluation of enfuvirtide with an optimized background of antiretrovirals

    NARCIS (Netherlands)

    Reynes, Jacques; Arastéh, Keikawus; Clotet, Bonaventura; Cohen, Calvin; Cooper, David A.; Delfraissy, Jean-François; Eron, Joseph J.; Henry, Keith; Katlama, Christine; Kuritzkes, Daniel R.; Lalezari, Jacob P.; Lange, Joep; Lazzarin, Adriano; Montaner, Julio S. G.; Nelson, Mark; O' Hearn, Mary; Stellbrink, Hans-Jürgen; Trottier, Benoit; Walmsley, Sharon L.; Buss, Neil E.; DeMasi, Ralph; Chung, Jain; Donatacci, Lucille; Guimaraes, Denise; Rowell, Lucy; Valentine, Adeline; Wilkinson, Martin; Salgo, Miklos P.

    2007-01-01

    The additional 48-week optional treatment extension of the T-20 versus Optimized Regimen Only (TORO) studies evaluated long-term safety and efficacy of enfuvirtide (ENF) through week 96 in patients receiving ENF plus optimized background (OB) and patients switching to ENF plus OB from OB alone.

  9. Association of Obesity, BMI, and Hispanic Ethnicity on Ambulatory Status in Children with Spinal Dysraphism followed near the California-Mexico Border.

    Science.gov (United States)

    McDonald, Michelle L; Huang, Andy; Proudfoot, James A; Le, Joan T; Chiang, George J; Bush, Ruth A

    2016-01-01

    Evaluate the relationship between body mass index (BMI), overweight status (OW), or obesity (OB) and ambulatory status in a predominantly Hispanic population of children with spinal dysraphism (SD). Retrospective data were extracted from records of 272 children and youth aged 0-24 years with a diagnosis of SD. Body mass index (BMI) and OW / OB rates were calculated for children 0-3 years, 4-11 years, and adolescents older than 11. Ethnicity was predominantly Hispanic (65.4%). No difference in mean BMI or OW / OB rate was found between ambulation groups (p = .20; p = .72). Mean BMI and OW / OB rate increased with increasing age in all groups (p < .001; p = .02). Forty-four percent of patients were OW / OB, which was greater among Hispanics (48.2%) compared with non-Hispanics [(35.2%), p = .03]. Female gender was a risk factor for increased BMI among Hispanics (p = .00). Despite no difference in ambulatory status, increasing BMI and OW / OB are associated with Hispanic ethnicity and increasing age.

  10. Low fish oil intake improves insulin sensitivity, lipid profile and muscle metabolism on insulin resistant MSG-obese rats.

    Science.gov (United States)

    Yamazaki, Ricardo K; Brito, Gleisson A P; Coelho, Isabela; Pequitto, Danielle C T; Yamaguchi, Adriana A; Borghetti, Gina; Schiessel, Dalton Luiz; Kryczyk, Marcelo; Machado, Juliano; Rocha, Ricelli E R; Aikawa, Julia; Iagher, Fabiola; Naliwaiko, Katya; Tanhoffer, Ricardo A; Nunes, Everson A; Fernandes, Luiz Claudio

    2011-04-28

    Obesity is commonly associated with diabetes, cardiovascular diseases and cancer. The purpose of this study was to determinate the effect of a lower dose of fish oil supplementation on insulin sensitivity, lipid profile, and muscle metabolism in obese rats. Monosodium glutamate (MSG) (4 mg/g body weight) was injected in neonatal Wistar male rats. Three-month-old rats were divided in normal-weight control group (C), coconut fat-treated normal weight group (CO), fish oil-treated normal weight group (FO), obese control group (Ob), coconut fat-treated obese group (ObCO) and fish oil-treated obese group (ObFO). Obese insulin-resistant rats were supplemented with fish oil or coconut fat (1 g/kg/day) for 4 weeks. Insulin sensitivity, fasting blood biochemicals parameters, and skeletal muscle glucose metabolism were analyzed. Obese animals (Ob) presented higher Index Lee and 2.5 fold epididymal and retroperitoneal adipose tissue than C. Insulin sensitivity test (Kitt) showed that fish oil supplementation was able to maintain insulin sensitivity of obese rats (ObFO) similar to C. There were no changes in glucose and HDL-cholesterol levels amongst groups. Yet, ObFO revealed lower levels of total cholesterol (TC; 30%) and triacylglycerol (TG; 33%) compared to Ob. Finally, since exposed to insulin, ObFO skeletal muscle revealed an increase of 10% in lactate production, 38% in glycogen synthesis and 39% in oxidation of glucose compared to Ob. Low dose of fish oil supplementation (1 g/kg/day) was able to reduce TC and TG levels, in addition to improved systemic and muscle insulin sensitivity. These results lend credence to the benefits of n-3 fatty acids upon the deleterious effects of insulin resistance mechanisms.

  11. C-Mpl Is Expressed on Osteoblasts and Osteoclasts and Is Important in Regulating Skeletal Homeostasis.

    Science.gov (United States)

    Meijome, Tomas E; Baughman, Jenna T; Hooker, R Adam; Cheng, Ying-Hua; Ciovacco, Wendy A; Balamohan, Sanjeev M; Srinivasan, Trishya L; Chitteti, Brahmananda R; Eleniste, Pierre P; Horowitz, Mark C; Srour, Edward F; Bruzzaniti, Angela; Fuchs, Robyn K; Kacena, Melissa A

    2016-04-01

    C-Mpl is the receptor for thrombopoietin (TPO), the main megakaryocyte (MK) growth factor, and c-Mpl is believed to be expressed on cells of the hematopoietic lineage. As MKs have been shown to enhance bone formation, it may be expected that mice in which c-Mpl was globally knocked out (c-Mpl(-/-) mice) would have decreased bone mass because they have fewer MKs. Instead, c-Mpl(-/-) mice have a higher bone mass than WT controls. Using c-Mpl(-/-) mice we investigated the basis for this discrepancy and discovered that c-Mpl is expressed on both osteoblasts (OBs) and osteoclasts (OCs), an unexpected finding that prompted us to examine further how c-Mpl regulates bone. Static and dynamic bone histomorphometry parameters suggest that c-Mpl deficiency results in a net gain in bone volume with increases in OBs and OCs. In vitro, a higher percentage of c-Mpl(-/-) OBs were in active phases of the cell cycle, leading to an increased number of OBs. No difference in OB differentiation was observed in vitro as examined by real-time PCR and functional assays. In co-culture systems, which allow for the interaction between OBs and OC progenitors, c-Mpl(-/-) OBs enhanced osteoclastogenesis. Two of the major signaling pathways by which OBs regulate osteoclastogenesis, MCSF/OPG/RANKL and EphrinB2-EphB2/B4, were unaffected in c-Mpl(-/-) OBs. These data provide new findings for the role of MKs and c-Mpl expression in bone and may provide insight into the homeostatic regulation of bone mass as well as bone loss diseases such as osteoporosis. © 2015 Wiley Periodicals, Inc.

  12. Computational identification and phylogenetic analysis of the oil-body structural proteins, oleosin and caleosin, in castor bean and flax.

    Science.gov (United States)

    Hyun, Tae Kyung; Kumar, Dhinesh; Cho, Young-Yeol; Hyun, Hae-Nam; Kim, Ju-Sung

    2013-02-25

    Oil bodies (OBs) are the intracellular particles derived from oilseeds. These OBs store lipids as a carbon resource, and have been exploited for a variety of industrial applications including biofuels. Oleosin and caleosin are the common OB structural proteins which are enabling biotechnological enhancement of oil content and OB-based pharmaceutical formations via stabilizing OBs. Although the draft whole genome sequence information for Ricinus communis L. (castor bean) and Linum usitatissimum L. (flax), important oil seed plants, is available in public database, OB-structural proteins in these plants are poorly indentified. Therefore, in this study, we performed a comprehensive bioinformatic analysis including analysis of the genome sequence, conserved domains and phylogenetic relationships to identify OB structural proteins in castor bean and flax genomes. Using comprehensive analysis, we have identified 6 and 15 OB-structural proteins from castor bean and flax, respectively. A complete overview of this gene family in castor bean and flax is presented, including the gene structures, phylogeny and conserved motifs, resulting in the presence of central hydrophobic regions with proline knot motif, providing an evolutionary proof that this central hydrophobic region had evolved from duplications in the primitive eukaryotes. In addition, expression analysis of L-oleosin and caleosin genes using quantitative real-time PCR demonstrated that seed contained their maximum expression, except that RcCLO-1 expressed maximum in cotyledon. Thus, our comparative genomics analysis of oleosin and caleosin genes and their putatively encoded proteins in two non-model plant species provides insights into the prospective usage of gene resources for improving OB-stability. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Melatonin Efficacy in Obese Leptin-Deficient Mice Heart

    Directory of Open Access Journals (Sweden)

    Alessandra Stacchiotti

    2017-12-01

    Full Text Available Cardiomyocytes are particularly sensitive to oxidative damage due to the link between mitochondria and sarcoplasmic reticulum necessary for calcium flux and contraction. Melatonin, important indoleamine secreted by the pineal gland during darkness, also has important cardioprotective properties. We designed the present study to define morphological and ultrastructural changes in cardiomyocytes and mainly in mitochondria of an animal model of obesity (ob/ob mice, when treated orally or not with melatonin at 100 mg/kg/day for 8 weeks (from 5 up to 13 week of life. We observed that ob/ob mice mitochondria in sub-sarcolemmal and inter-myofibrillar compartments are often devoid of cristae with an abnormally large size, which are called mega-mitochondria. Moreover, in ob/ob mice the hypertrophic cardiomyocytes expressed high level of 4hydroxy-2-nonenal (4HNE, a marker of lipid peroxidation but scarce degree of mitofusin2, indicative of mitochondrial sufferance. Melatonin oral supplementation in ob/ob mice restores mitochondrial cristae, enhances mitofusin2 expression and minimizes 4HNE and p62/SQSTM1, an index of aberrant autophagic flux. At pericardial fat level, adipose tissue depot strictly associated with myocardium infarction, melatonin reduces adipocyte hypertrophy and inversely regulates 4HNE and adiponectin expressions. In summary, melatonin might represent a safe dietary adjuvant to hamper cardiac mitochondria remodeling and the hypoxic status that occur in pre-diabetic obese mice at 13 weeks of life.

  14. Clinical Variability in Cardiovascular Disease Risk Factor Screening and Management in Adolescent and Young Adult Women with Polycystic Ovary Syndrome.

    Science.gov (United States)

    Baer, Tamara E; Milliren, Carly E; Walls, Courtney; DiVasta, Amy D

    2015-10-01

    To review the clinical presentation, evaluation, and management of normal-weight (NW), overweight (OW), and obese (OB) adolescent and young adult women with polycystic ovary syndrome (PCOS) during a 2-year follow-up. Retrospective chart review. One hundred seventy-three adolescent and young adult women, aged 12-22 years, diagnosed with PCOS. Demographic, health data, and laboratory measures were abstracted from 3 clinic visits: baseline and 1- and 2-year follow-up. Subjects were classified as NW, OW, or OB. Longitudinal data were analyzed using repeated-measures analysis of variance. Body mass index, self-reported concerns, and lifestyle changes. Most patients (73%) were OW or OB. Family history of type 2 diabetes was greater in OW (38%) and OB (53%) patients compared with NW (22%) patients (P = .002). Acanthosis nigricans was identified in OW (62%) and OB (21%) patients but not in NW patients (0%; P insulin (P PCOS were OW or OB. Substantial clinical variability existed in cardiovascular disease (CVD) screening; among those screened, OW and OB patients had greater CVD risk factors. Despite self-reported concerns about weight and diabetes risk among OW and OB patients, no clinically significant change in body mass index percentile occurred. Evidence-based interventions and recommendations for screening tests are needed to address CVD risk in adolescents and young adults with PCOS. Copyright © 2015 North American Society for Pediatric and Adolescent Gynecology. Published by Elsevier Inc. All rights reserved.

  15. Consumption of Two Healthy Dietary Patterns Restored Microbiota Dysbiosis in Obese Patients with Metabolic Dysfunction.

    Science.gov (United States)

    Haro, Carmen; García-Carpintero, Sonia; Rangel-Zúñiga, Oriol A; Alcalá-Díaz, Juan F; Landa, Blanca B; Clemente, José C; Pérez-Martínez, Pablo; López-Miranda, José; Pérez-Jiménez, Francisco; Camargo, Antonio

    2017-12-01

    The consumption of two healthy diets (Mediterranean (MED) and low-fat (LF) diets) may restore the gut microbiome dysbiosis in obese patients depending on the degree of metabolic dysfunction. The differences in bacterial community at baseline and after 2 years of dietary intervention of 106 subjects from the CORDIOPREV study were analyzed, 33 of whom were obese patients with severe metabolic disease (5 criteria for metabolic syndrome) (MetS-OB), 32 obese patients without metabolic dysfunction (2 or less criteria for metabolic syndrome) (NonMetS-OB) and 41 non-obese subjects (NonMetS-NonOB). Our study showed a marked dysbiosis in people with severe metabolic disease (Met-OB), compared with obese people without MetS (NonMetS-OB) and non-obese people (NonMetS-NonOB). This disbiotic pattern was reversed by consumption of both MED (35% of calories as fat (22% MUFA fat, 6% PUFA fat and <10% saturated fat) or LF (<30% total fat (<10% saturated fat, 12%-14% MUFA fat and 6-8% PUFA fat) diets, whereas no significant microbiota changes were observed in NonMetS-NonOB and NonMetS-OB groups. Our results suggest that the chronic intake of two healthy dietary patterns partially restores the gut microbiome dysbiosis in obese patients with coronary heart disease, depending on the degree of metabolic dysfunction. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Rozwój morfologiczny i sprawności specjalnej 13 – letnich chłopców trenujących piłkę nożną w Klubie Sportowym „Pogoń” Łobżenica = Morphological and a special efficiency development 13-years old boys soccer summer training in a sports club "Chase" Łobżenica

    Directory of Open Access Journals (Sweden)

    Mariusz Klimczyk

    2016-07-01

      Słowa kluczowe: test, sprawność fizyczna, sprawność specjalna, piłka nożna, rozwój morfologiczny.   Abstract The aim of the work was to identify the morphological development and efficiency of a special 13-years old boys soccer summer training in "Chasing" Łobżenica. The test group consisted of 17 players who attended training classes three times a week (training unit was 60 minutes. In addition, participated four times a week in physical education classes in school. The study took place in two periods: the first in August 2015, and the second in April 2016. Measured weight and height of the body and was carried out "technical performance for boys aged 10-14 years old," George Talaga. There was progress and large diversity of subjects. Correlation between morphological features, and obtained points in the test performance special was released to moderate the relationship between these characteristics. The work shows that when the young player does not attend regularly for training, no progression of their skills. It is therefore necessary to systematic monitoring by the skill level of students, and applying adjustments in the training plan to in the future make it easier to eliminate this phenomenon. Keywords: test, physical fitness, the efficiency of the special, football, morphological development.

  17. Assessing the osteoblast transcriptome in a model of enhanced bone formation due to constitutive G{sub s}–G protein signaling in osteoblasts

    Energy Technology Data Exchange (ETDEWEB)

    Wattanachanya, Lalita, E-mail: lalita_md@yahoo.com [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States); Division of Endocrinology and Metabolism, Department of Medicine, Faculty of Medicine, Chulalongkorn University and King Chulalongkorn Memorial Hospital, Thai Red Cross Society, Bangkok (Thailand); Wang, Liping, E-mail: lipingwang05@yahoo.com [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States); Millard, Susan M., E-mail: susan.millard@mater.uq.edu.au [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States); Lu, Wei-Dar, E-mail: weidar_lu@yahoo.com [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States); O’Carroll, Dylan, E-mail: dylancocarroll@gmail.com [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States); Hsiao, Edward C., E-mail: Edward.Hsiao@ucsf.edu [Division of Endocrinology and Metabolism, Department of Medicine, University of California, San Francisco, CA (United States); Conklin, Bruce R., E-mail: bconklin@gladstone.ucsf.edu [Gladstone Institute of Cardiovascular Disease, San Francisco, CA (United States); Department of Medicine, University of California, San Francisco, CA (United States); Department of Cellular and Molecular Pharmacology, University of California, San Francisco, CA (United States); Nissenson, Robert A., E-mail: Robert.Nissenson@ucsf.edu [Endocrine Research Unit, Veterans Affairs Medical Center and Departments of Medicine and Physiology, University of California, San Francisco, CA (United States)

    2015-05-01

    G protein-coupled receptor (GPCR) signaling in osteoblasts (OBs) is an important regulator of bone formation. We previously described a mouse model expressing Rs1, an engineered constitutively active G{sub s}-coupled GPCR, under the control of the 2.3 kb Col I promoter. These mice showed a dramatic age-dependent increase in trabecular bone of femurs. Here, we further evaluated the effects of enhanced G{sub s} signaling in OBs on intramembranous bone formation by examining calvariae of 1- and 9-week-old Col1(2.3)/Rs1 mice and characterized the in vivo gene expression specifically occurring in osteoblasts with activated G{sub s} G protein-coupled receptor signaling, at the cellular level rather than in a whole bone. Rs1 calvariae displayed a dramatic increase in bone volume with partial loss of cortical structure. By immunohistochemistry, Osterix was detected in cells throughout the inter-trabecular space while Osteocalcin was expressed predominantly in cells along bone surfaces, suggesting the role of paracrine mediators secreted from OBs driven by 2.3 kb Col I promoter could influence early OB commitment, differentiation, and/or proliferation. Gene expression analysis of calvarial OBs revealed that genes affected by Rs1 signaling include those encoding proteins important for cell differentiation, cytokines and growth factors, angiogenesis, coagulation, and energy metabolism. The set of G{sub s}-GPCRs and other GPCRs that may contribute to the observed skeletal phenotype and candidate paracrine mediators of the effect of G{sub s} signaling in OBs were also determined. Our results identify novel detailed in vivo cellular changes of the anabolic response of the skeleton to G{sub s} signaling in mature OBs. - Highlights: • OB expression of an engineered G{sub s}-coupled receptor dramatically increases bone mass. • We investigated the changes in gene expression in vivo in enhanced OB G{sub s} signaling. • Genes in cell cycle and transcription were increased in

  18. Towards Experiments to Test Violation of the Original Bell Inequality

    Science.gov (United States)

    Khrennikov, Andrei; Basieva, Irina

    2018-04-01

    The aim of this note is to attract attention of experimenters to the original Bell (OB) inequality which was shadowed by the common consideration of the CHSH inequality. There are two reasons to test the OB inequality and not the CHSH inequality. First of all, the OB inequality is a straightforward consequence to the EPR-argumentation. And only this inequality is related to the EPR-Bohr debate. However, the last statement can be objected by some experts working in quantum foundations. Therefore to convince experimenters to perform the OB-violation experiment, we prefer to concentrate on the second distinguishing feature of the OB inequality which was emphasized by I. Pitowsky. He pointed out that the OB inequality provides a higher degree of violations of classicality than the CHSH inequality. The main problem is that the OB inequality is derived under the assumption of perfect (anti-) correlations. However, the last years were characterized by the amazing development of quantum technologies. Nowadays, there exist sources producing with very high probability the pairs of photons in the singlet state. Moreover, the efficiency of photon detectors was improved tremendously. In any event one can start by proceeding with the fair sampling assumption. Another possibility is to use the scheme of Hensen et al. experiment for entangled electrons.

  19. Buncrana Community Hospital, Maginn Avenue, Buncrana, Donegal.

    LENUS (Irish Health Repository)

    Owens, Lisa A

    2010-03-01

    OBJECTIVE A prospective study of the impact of obesity on pregnancy outcome in glucose-tolerant women. RESEARCH DESIGN AND METHODS The Irish Atlantic Diabetes in Pregnancy network advocates universal screening for gestational diabetes. Women with normoglycemia and a recorded booking BMI were included. Maternal and infant outcomes correlated with booking BMI are reported. RESULTS A total of 2,329 women fulfilled the criteria. Caesarean deliveries increased in overweight (OW) (odds ratio 1.57 [95% CI 1.24-1.98]) and obese (OB) (2.65 [2.03-3.46]) women. Hypertensive disorders increased in OW (2.30 [1.55-3.40]) and OB (3.29 [2.14-5.05]) women. Reported miscarriages increased in OB (1.4 [1.11-1.77]) women. Mean birth weight was 3.46 kg in normal BMI (NBMI), 3.54 kg in OW, and 3.62 kg in OB (P < 0.01) mothers. Macrosomia occurred in 15.5, 21.4, and 27.8% of babies of NBMI, OW, and OB mothers, respectively (P < 0.01). Shoulder dystocia occur in 4% (>4 kg) compared with 0.2% (<4 kg) babies (P < 0.01). Congenital malformation risk increased for OB (2.47 [1.09-5.60]) women. CONCLUSIONS OW and OB glucose-tolerant women have greater adverse pregnancy outcomes.

  20. Overweight and obesity in New Caledonian adults: Results from measured and adjusted self-reported anthropometric data.

    Science.gov (United States)

    Corsenac, Philippe; Annesi-Maesano, Isabella; Hoy, Damian; Roth, Adam; Rouchon, Bernard; Capart, Isabelle; Taylor, Richard

    2017-11-01

    To estimate the overweight (OW) and obesity (Ob) prevalence and associated socio-demographic risk factors in New Caledonian adults aged 18-67years. From a randomly selected cross-sectional population survey, self-reported (n=2513) and measured (n=736) height and weight data were collected. Separate linear regression analyses for measured weight and height were performed, using cases with both self-reported weight and height and socio-demographic variables. The final weight and height assigned to each case was either measured or predicted from the regression (n=2075). OW prevalence was defined as: Body Mass Index (BMI) ≥25 and F) OW was 26% (95% CI: 23-28), Ob 34% (95% CI: 31-37) and OW-Ob 60% (95% CI: 57-63). Compared to Melanesians (OR=1.0) for male/female: Polynesians had the highest prevalence of OW (1.7/1.5), Ob (4.7/3.5), and OW-Ob (3.0/2.5); New Caledonian-born Europeans had greater OW, Ob and OW-Ob (0.3/0.4) than immigrant Europeans (0.2/0.2). Findings contribute to obesity comparisons with other Pacific Islands, and they establish trends in New Caledonia for targeting policies and strategies of prevention. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. ATLANTIC DIP: the impact of obesity on pregnancy outcome in glucose-tolerant women.

    LENUS (Irish Health Repository)

    Owens, Lisa A

    2010-03-01

    OBJECTIVE A prospective study of the impact of obesity on pregnancy outcome in glucose-tolerant women. RESEARCH DESIGN AND METHODS The Irish Atlantic Diabetes in Pregnancy network advocates universal screening for gestational diabetes. Women with normoglycemia and a recorded booking BMI were included. Maternal and infant outcomes correlated with booking BMI are reported. RESULTS A total of 2,329 women fulfilled the criteria. Caesarean deliveries increased in overweight (OW) (odds ratio 1.57 [95% CI 1.24-1.98]) and obese (OB) (2.65 [2.03-3.46]) women. Hypertensive disorders increased in OW (2.30 [1.55-3.40]) and OB (3.29 [2.14-5.05]) women. Reported miscarriages increased in OB (1.4 [1.11-1.77]) women. Mean birth weight was 3.46 kg in normal BMI (NBMI), 3.54 kg in OW, and 3.62 kg in OB (P < 0.01) mothers. Macrosomia occurred in 15.5, 21.4, and 27.8% of babies of NBMI, OW, and OB mothers, respectively (P < 0.01). Shoulder dystocia occur in 4% (>4 kg) compared with 0.2% (<4 kg) babies (P < 0.01). Congenital malformation risk increased for OB (2.47 [1.09-5.60]) women. CONCLUSIONS OW and OB glucose-tolerant women have greater adverse pregnancy outcomes.

  2. Lgl1 Is Required for Olfaction and Development of Olfactory Bulb in Mice

    Science.gov (United States)

    Li, Zhenzu; Zhang, Tingting; Lin, Zhuchun; Hou, Congzhe; Zhang, Jian; Men, Yuqin; Li, Huashun

    2016-01-01

    Lethal giant larvae 1 (Lgl1) was initially identified as a tumor suppressor in Drosophila and functioned as a key regulator of epithelial polarity and asymmetric cell division. In this study, we generated Lgl1 conditional knockout mice mediated by Pax2-Cre, which is expressed in olfactory bulb (OB). Next, we examined the effects of Lgl1 loss in the OB. First, we determined the expression patterns of Lgl1 in the neurogenic regions of the embryonic dorsal region of the LGE (dLGE) and postnatal OB. Furthermore, the Lgl1 conditional mutants exhibited abnormal morphological characteristics of the OB. Our behavioral analysis exhibited greatly impaired olfaction in Lgl1 mutant mice. To elucidate the possible mechanisms of impaired olfaction in Lgl1 mutant mice, we investigated the development of the OB. Interestingly, reduced thickness of the MCL and decreased density of mitral cells (MCs) were observed in Lgl1 mutant mice. Additionally, we observed a dramatic loss in SP8+ interneurons (e.g. calretinin and GABAergic/non-dopaminergic interneurons) in the GL of the OB. Our results demonstrate that Lgl1 is required for the development of the OB and the deletion of Lgl1 results in impaired olfaction in mice. PMID:27603780

  3. Occipital bending (Yakovlevian torque) in bipolar depression.

    Science.gov (United States)

    Maller, Jerome J; Anderson, Rodney; Thomson, Richard H; Rosenfeld, Jeffrey V; Daskalakis, Zafiris J; Fitzgerald, Paul B

    2015-01-30

    Differing levels of occipital lobe asymmetry and enlarged lateral ventricles have been reported within patients with bipolar disorder (BD) compared with healthy controls, suggesting different rates of occipital bending (OB). This may exert pressure on subcortical structures, such as the hippocampus, reduced among psychiatric patients. We investigated OB prevalence in 35 patients with BD and 36 healthy controls, and ventricular and occipital volumes. Prevalence was four times higher among BD patients (12/35 [34.3%]) than in control subjects (3/36 [8.3%]), as well as larger lateral ventricular volumes (LVVs). Furthermore, we found OB to relate to left-to-right ventricular and occipital lobe volume (OLV) ratios. Those with OB also had reduced left-to-right hippocampal volume ratios. The results suggest that OB is more common among BD patients than healthy subjects, and prevalent in both BD Type I and Type II patients. We posit that anomalies in neural pruning or ventricular enlargement may precipitate OB, consequently resulting in one occipital lobe twisting around the other. Although the clinical implications of these results are unclear, the study suggests that asymmetrical ventricular volume matched with a pattern of oppositely asymmetrical occipital volume is related to OB and may be a marker of psychiatric illness. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. Integrated Haematological Profiles of Redox Status, Lipid, and Inflammatory Protein Biomarkers in Benign Obesity and Unhealthy Obesity with Metabolic Syndrome

    Directory of Open Access Journals (Sweden)

    Carla Lubrano

    2015-01-01

    Full Text Available The pathogenesis of obesity (OB and metabolic syndrome (MetS implies free radical-, oxidized lipid- (LOOH-, and inflammatory cytokine-mediated altered pathways in target organs. Key elements of the transition from benign OB to unhealthy OB+MetS remain unclear. Here, we measured a panel of redox, antioxidant, and inflammation markers in the groups of OB patients (67 with, 45 without MetS and 90 controls. Both OB groups displayed elevated levels of adipokines and heavy oxidative stress (OS evidenced by reduced levels of glutathione, downregulated glutathione-S-transferase, increased 4-hydroxynonenal-protein adducts, reactive oxygen species, and membrane-bound monounsaturated fatty acids (MUFA. Exclusively in OB+MetS, higher-than-normal glutathione peroxidase activity, tumor necrosis factor-α, and other proinflammatory cytokines/chemokines/growth factors were observed; a combination of high adipokine plasminogen activator inhibitor-1 and MUFA was consistent with increased cardiovascular risk. The uncomplicated OB group showed features of adaptation to OS such as decreased levels of vitamin E, activated superoxide dismutase, and inhibited catalase, suggesting H2O2 hyperproduction. Proinflammatory cytokine pattern was normal, except few markers like RANTES, a suitable candidate for therapeutic approaches to prevent a setting of MetS by inhibition of LOOH-primed leukocyte chemotaxis/recruitment to target tissues.

  5. Characterization of a thermostable recombinant l-rhamnose isomerase from Caldicellulosiruptor obsidiansis OB47 and its application for the production of l-fructose and l-rhamnulose.

    Science.gov (United States)

    Chen, Ziwei; Xu, Wei; Zhang, Wenli; Zhang, Tao; Jiang, Bo; Mu, Wanmeng

    2018-04-01

    l-Hexoses are rare sugars that are important components and precursors in the synthesis of biological compounds and pharmaceutical drugs. l-Rhamnose isomerase (L-RI, EC 5.3.1.14) is an aldose-ketose isomerase that plays a significant role in the production of l-sugars. In this study, a thermostable, l-sugar-producing L-RI from the hyperthermophile Caldicellulosiruptor obsidiansis OB47 was characterized. The recombinant L-RI displayed maximal activity at pH 8.0 and 85 °C and was significantly activated by Co 2+ . It exhibited a relatively high thermostability, with measured half-lives of 24.75, 11.55, 4.15 and 3.30 h in the presence of Co 2+ at 70, 75, 80 and 85 °C, respectively. Specific activities of 277.6, 57.9, 13.7 and 9.6 U mg -1 were measured when l-rhamnose, l-mannose, d-allose and l-fructose were used as substrates, respectively. l-Rhamnulose was produced with conversion ratios of 44.0% and 38.6% from 25 and 50 g L -1 l-rhamnose, respectively. l-Fructose was also efficiently produced by the L-RI, with conversion ratios of 67.0% and 58.4% from 25 and 50 g L -1 l-mannose, respectively. The recombinant L-RI could effectively catalyze the formation of l-rhamnulose and l-fructose, suggesting that it was a promising candidate for industrial production of l-rhamnulose and l-fructose. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  6. Up-to-date concentrations of long-lived artificial radionuclides in the Tom and Ob rivers in the area influenced by discharges from Siberian chemical combine

    International Nuclear Information System (INIS)

    Nikitin, A.I.; Kryshev, I.I.; Bashkirov, N.I.; Valetova, N.K.; Dunaev, G.E.; Kabanov, A.I.; Katrich, I.Yu; Krutovsky, A.O.; Nikitin, V.A.; Petrenko, G.I.; Polukhina, A.M.; Selivanova, G.V.; Shkuro, V.N.

    2012-01-01

    The Siberian Chemical Combine (SCC) is located in Seversk (formerly known as Tomsk-7) in the Tomsk Region of the Russian Federation. The main contribution of radionuclides in the SCC process water discharged into the Tom River was from the single-pass reactors, now removed from service (the last SCC reactor was shutdown on June 5, 2008). The data on the concentrations of 90 Sr, 137 Cs, 239,240 Pu and other artificial radionuclides in water, bottom sediments and flood-plain soils of the Tom and Ob rivers from Tomsk to the confluence of the rivers, are presented and discussed. The results of measurements carried out after shutdown of the last SCC single-pass reactor indicated no radiologically significant consequences of SCC activities for the studied water environment compartments. Contemporary activity concentrations of long-lived artificial radionuclides 3 H, 90 Sr, 137 Cs and 239,240 Pu in river water were below the intervention levels established by current regulations of the Russian Federation for these radionuclides. The results of 3 H analysis in water from the Tom and Samuska rivers demonstrated no inflow of contaminated formation water to surface water from the sites where liquid radioactive wastes of the SCC were injected below the surface. However, the density of flood-plain soil contamination by long-lived 137 Cs in the area influenced by SCC liquid discharges was higher than regional technogenic background. There were local flood-plain areas contaminated not only by 137 Cs, but also other gamma-emitters, such as 60 Co and 152 Eu.

  7. WHAT WE DON’T TALK ABOUT WHEN WE DON’T TALK ABOUT SEX1: RESULTS OF A NATIONAL SURVEY OF UNITED STATES OBSTETRICIAN/GYNECOLOGISTS

    Science.gov (United States)

    SOBECKI, Janelle N.; CURLIN, Farr A.; RASINSKI, Kenneth A.; LINDAU, Stacy Tessler

    2012-01-01

    Introduction Sexuality is a key aspect of women’s physical and psychological health. Research shows both patients and physicians face barriers to communication about sexuality. Given their expertise and training in addressing conditions of the female genital tract across the female life course, obstetrician/gynecologists (ob/gyns) are well-positioned among all physicians to address sexuality issues with female patients. New practice guidelines for management of female sexual dysfunction and the importance of female sexual behavior and function to virtually all aspects of ob/gyn care, and to women’s health more broadly, warrant up-to-date information regarding ob/gyns’ sexual history-taking routine. Aims To determine obstetrician/gynecologists’ practices of communication with patients about sexuality, and to examine the individual and practice-level correlates of such communication. Methods A population-based sample of 1154 practicing U.S. obstetrician/gynecologists (53% male; mean age 48 years) was surveyed regarding their practices of communication with patients about sex. Main Outcome Measures Self-reported frequency measures of ob/gyns’ communication practices with patients including whether or not ob/gyns discuss patients’ sexual activities, sexual orientation, satisfaction with sexual life, pleasure with sexual activity, and sexual problems or dysfunction, as well as whether or not one ever expresses disapproval of or disagreement with patients’ sexual practices. Multivariable analysis was used to correlate physicians’ personal and practice characteristics with these communication practices. Results Survey response rate was 65.6%. Sixty-three percent of ob/gyns reported routinely assessing patients’ sexual activities; 40% routinely asked about sexual problems. Fewer asked about sexual satisfaction (28.5%), sexual orientation/identity (27.7%), or pleasure with sexual activity (13.8%). A quarter of ob/gyns reported they had expressed

  8. Obstetrician-gynecologists' objections to and willingness to help patients obtain an abortion.

    Science.gov (United States)

    Harris, Lisa H; Cooper, Alexandra; Rasinski, Kenneth A; Curlin, Farr A; Lyerly, Anne Drapkin

    2011-10-01

    To describe obstetrician-gynecologists' (ob-gyns') views and willingness to help women seeking abortion in a variety of clinical scenarios. We conducted a mailed survey of 1,800 U.S. ob-gyns. We presented seven scenarios in which patients sought abortions. For each, respondents indicated if they morally objected to abortion and if they would help patients obtain an abortion. We analyzed predictors of objection and assistance. The response rate was 66%. Objection to abortion ranged from 16% (cardiopulmonary disease) to 82% (sex selection); willingness to assist ranged from 64% (sex selection) to 93% (cardiopulmonary disease). Excluding sex selection, objection was less likely among ob-gyns who were female (odds ratio [OR] 0.5, 95% confidence interval [CI] 0.4-0.8), urban (OR 0.3, 95% CI 0.1-0.7), or Jewish (OR 0.3, 95% CI 0.1-0.7) compared with male, rural, or religiously unaffiliated ob-gyns. Objection was more likely among ob-gyns from the South (OR 1.9, 95% CI 1.2-3.0) or Midwest (OR 1.9, 95% CI 1.2-3.1), and among Catholic, Evangelical Protestant, or Muslim ob-gyns, or those for whom religion was most important, compared with reference. Among ob-gyns who objected to abortion in a given case, approximately two-thirds would help patients obtain an abortion. Excluding sex selection, assistance despite objection was more likely among female (OR 1.8, 95% CI 1.1-2.9) and United States-born ob-gyns (OR 2.2, 95% CI 1.1-4.7) and less likely among southern ob-gyns (OR 0.3, 95% CI 0.2-0.6) or those for whom religion was most important (OR 0.3, 95% CI 0.1-0.7). Most ob-gyns help patients obtain an abortion even when they morally object to abortion in that case. Willingness to assist varies by clinical context and physician characteristics. II.

  9. Obstetrician–Gynecologists’ Objections to and Willingness to Help Patients Obtain an Abortion

    Science.gov (United States)

    Harris, Lisa H; Cooper, Alexandra; Rasinski, Kenneth A; Curlin, Farr A; Lyerly, Anne Drapkin

    2014-01-01

    Objective To describe obstetrician–gynecologists’ (ob-gyns) views and willingness to help women seeking abortion in a variety of clinical scenarios. Methods We conducted a mailed survey of 1,800 U.S. ob-gyns. We presented seven scenarios in which patients sought abortion. For each, respondents indicated if they morally objected to abortion and if they would help patients obtain an abortion. We analyzed predictors of objection and assistance. Results The response rate was 66%. Objection to abortion ranged from 16% (cardiopulmonary disease) to 82% (sex selection); willingness to assist ranged from 64% (sex selection) to 93% (cardiopulmonary disease). Excluding sex selection, objection was less likely among ob-gyns who were female (odds ratio [OR] 0.5, 95% confidence interval [CI] 0.4–0.8), urban (OR 0.3, CI 0.1–0.7), or Jewish (OR 0.3, CI 0.1–0.7) compared to male, rural, or unaffiliated ob-gyns. Objection was more likely among ob-gyns from the South (OR 1.9, CI 1.2–3.0) or Midwest (OR 1.9, CI 1.2–3.1), and among Catholic, evangelical Protestant, or Muslim ob-gyns, or those for whom religion was most important, compared to reference. Among ob-gyns who objected to abortion in a given case, approximately two-thirds nevertheless help patients obtain an abortion. Excluding sex selection, assistance despite objection was more likely among female (OR 1.8, CI 1.1–2.9) and US-born ob-gyns (OR 2.2, CI 1.1–4.7), and less likely among Southern ob-gyns (OR 0.3, CI 0.2–0.6), or those for whom religion was most important (OR 0.3, CI 0.1–0.7). Conclusions Most ob-gyns help patients obtain an abortion even when they morally object to abortion in that case. Willingness to assist varies by clinical context and physician characteristics. PMID:21934455

  10. Magnitude conversion to unified moment magnitude using orthogonal regression relation

    Science.gov (United States)

    Das, Ranjit; Wason, H. R.; Sharma, M. L.

    2012-05-01

    Homogenization of earthquake catalog being a pre-requisite for seismic hazard assessment requires region based magnitude conversion relationships. Linear Standard Regression (SR) relations fail when both the magnitudes have measurement errors. To accomplish homogenization, techniques like Orthogonal Standard Regression (OSR) are thus used. In this paper a technique is proposed for using such OSR for preparation of homogenized earthquake catalog in moment magnitude Mw. For derivation of orthogonal regression relation between mb and Mw, a data set consisting of 171 events with observed body wave magnitudes (mb,obs) and moment magnitude (Mw,obs) values has been taken from ISC and GCMT databases for Northeast India and adjoining region for the period 1978-2006. Firstly, an OSR relation given below has been developed using mb,obs and Mw,obs values corresponding to 150 events from this data set. M=1.3(±0.004)m-1.4(±0.130), where mb,proxy are body wave magnitude values of the points on the OSR line given by the orthogonality criterion, for observed (mb,obs, Mw,obs) points. A linear relation is then developed between these 150 mb,obs values and corresponding mb,proxy values given by the OSR line using orthogonality criterion. The relation obtained is m=0.878(±0.03)m+0.653(±0.15). The accuracy of the above procedure has been checked with the rest of the data i.e., 21 events values. The improvement in the correlation coefficient value between mb,obs and Mw estimated using the proposed procedure compared to the correlation coefficient value between mb,obs and Mw,obs shows the advantage of OSR relationship for homogenization. The OSR procedure developed in this study can be used to homogenize any catalog containing various magnitudes (e.g., ML, mb, MS) with measurement errors, by their conversion to unified moment magnitude Mw. The proposed procedure also remains valid in case the magnitudes have measurement errors of different orders, i.e. the error variance ratio is

  11. 医用OB胶联合几丁聚糖-胶原导管修复兔面神经损伤的实验研究%Facial nerve repair with OB glue and chitosan-collagen conduit:An experimental study in rabbits

    Institute of Scientific and Technical Information of China (English)

    屈振宇; 曲卫国; 马卫东; 曲晓娟; 张璐; 裘罡

    2011-01-01

    PORFUSE: To explore the effect of using OB glue combined with chitosan-collagen conduit to repair rabbit facial nerve injury. METHODS: Thirty Chinese rabbits were divided into 3 groups randomly. The injury in right facial nerve of rabbits was repaired using: nerve autografts (group I ), OB glue (group Ⅱ), and OB glue with chitosan-collagen conduit (group Ⅲ) in 3 groups,respectively. Gross observation, electrophysiological study, histological study and image analysis were performed 16 weeks postoperatively .The data was subjected to one-way ANOVA with SPSS 17.0 software package to evaluate nerve regeneration. RESULTS: Nerve regeneration was obvious observed 16 weeks postoperatively and could resist certain tension . Chitosan-collagen conduit was degraded 16 weeks postoperatively and restrained the formation of neuroma. The tissue adhesions in group I and group Ⅱ was more severe than in group Ⅲ. The recovery of neuro-muscular function was good in 3 groups,and motor nerve action potential was not significantly different among 3 groups (P>0.05),but the compound muscle action potential (CMAP) of regenerated nerve was significantly higher in group Ⅲ than in group Ⅱ (P0.05).Different degree of hyperplasia of fibrous connective tissue and new formed capillaries was noted ,nrnl inflammatory cell infiltration was also found in 3 groups. The effect of chitosan - collagen ennduil in group Ⅲ was observed both under low magnification of microscope and high nullification with Gomori's silver staining.The recovery rale of myelinated fibrr cross section diameler in 3 groups was different (p0.05 ). CONCLUSION: Chitnsan-collagRn conduit has excellent biocompatibilty. It can be OB glue to repair nerves injuries with good results. Supported by Dalian Outstanding Science and Technology Talents Fund (2006J23JH016).%目的:探讨医用OB胶联合几丁聚糖--胶原导管修复兔面神经损伤的效果.方法:30只健康中国大耳白兔随机分为3

  12. Peritumoral adipose tissue as a source of inflammatory and angiogenic factors in colorectal cancer.

    Science.gov (United States)

    Amor, S; Iglesias-de la Cruz, M C; Ferrero, E; García-Villar, O; Barrios, V; Fernandez, N; Monge, L; García-Villalón, A L; Granado, M

    2016-02-01

    Obesity is a risk factor for the development of human colorectal cancer (CC). The aim of this work is to report the inflammatory and angiogenic scenario in lean (BMI  30 kg/m2) patients with and without CC and to assess the role of peritumoral adipose tissue in CC-induced inflammation. Patients were divided in four experimental groups: obese patients with CC (OB-CC), lean patients with CC (LEAN-CC), obese patients without CC (OB), and lean patients without CC (LEAN). Plasma levels of pro-inflammatory cytokines (interleukin (IL)-6, IL-4, IL-8) and granulocyte-macrophage colony-stimulating factor (GM-CSF) were increased in OB-CC patients. Peritumoral adipose tissue (TF) explants and cultured mature adipocytes secreted higher amounts of nitrites and nitrates than did control and non-tumoral (NTF) adipose tissue both alone and in response to lipopolysaccharide (LPS). Nitrite and nitrate secretion was also increased in TF explants from OB-CC patients compared with that from LEAN-CC patients. Gene expression of adiponectin, tumor necrosis factor alpha (TNF-α), insulin-like growth factor type I (IGF-I), cyclooxygenase-2 (COX-2), and peroxisome proliferator-activated receptor γ (PPAR-γ) was increased in TF explants from CC patients. LPS increased the gene expression of IL-6, IL-10, TNF-α, vascular endothelial growth factor (VEGF), and COX-2 in OB and in TF explants from OB-CC patients. COX-2 and PPAR-γ inhibition further increased LPS-induced release of nitrites and nitrates in TF explants and adipocytes from OB-CC patients. In conclusion, OB-CC patients have increased plasma levels of pro-inflammatory and angiogenic factors. TF from OB-CC patients shows an increased secretion of inflammatory markers compared with both TF from LEAN-CC and non-tumoral adipose tissue (AT) through a COX-2- and PPAR-γ-independent mechanism.

  13. Anisomycin administered in the olfactory bulb and dorsal hippocampus impaired social recognition memory consolidation in different time-points.

    Science.gov (United States)

    Pena, R R; Pereira-Caixeta, A R; Moraes, M F D; Pereira, G S

    2014-10-01

    To identify an individual as familiar, rodents form a specific type of memory named social recognition memory. The olfactory bulb (OB) is an important structure for social recognition memory, while the hippocampus recruitment is still controversial. The present study was designed to elucidate the OB and the dorsal hippocampus contribution to the consolidation of social memory. For that purpose, we tested the effect of anisomycin (ANI), which one of the effects is the inhibition of protein synthesis, on the consolidation of social recognition memory. Swiss adult mice with cannulae implanted into the CA1 region of the dorsal hippocampus or into the OB were exposed to a juvenile during 5 min (training session; TR), and once again 1.5 h or 24 h later to test social short-term memory (S-STM) or social long-term memory (S-LTM), respectively. To study S-LTM consolidation, mice received intra-OB or intra-CA1 infusion of saline or ANI immediately, 3, 6 or 18 h after TR. ANI impaired S-LTM consolidation in the OB, when administered immediately or 6h after TR. In the dorsal hippocampus, ANI was amnesic only if administered 3 h after TR. Furthermore, the infusion of ANI in either OB or CA1, immediately after training, did not affect S-STM. Moreover, ANI administered into the OB did not alter the animal's performance in the buried food-finding task. Altogether, our results suggest the consolidation of S-LTM requires both OB and hippocampus participation, although in different time points. This study may help shedding light on the specific roles of the OB and dorsal hippocampus in social recognition memory. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Nutritional status modulates behavioural and olfactory bulb Fos responses to isoamyl acetate or food odour in rats: roles of orexins and leptin.

    Science.gov (United States)

    Prud'homme, M J; Lacroix, M C; Badonnel, K; Gougis, S; Baly, C; Salesse, R; Caillol, M

    2009-09-15

    Food odours are major determinants for food choice, and their detection depends on nutritional status. The effects of different odour stimuli on both behavioural responses (locomotor activity and sniffing) and Fos induction in olfactory bulbs (OB) were studied in satiated or 48-h fasted rats. We focused on two odour stimuli: isoamyl acetate (ISO), as a neutral stimulus either unknown or familiar, and food pellet odour, that were presented to quiet rats during the light phase of the day. We found significant effects of nutritional status and odour stimulus on both behavioural and OB responses. The locomotor activity induced by odour stimuli was always more marked in fasted than in satiated rats, and food odour induced increased sniffing activity only in fasted rats. Fos expression was quantified in periglomerular, mitral and granular OB cell layers. As a new odour, ISO induced a significant increase in Fos expression in all OB layers, similar in fasted and satiated rats. Significant OB responses to familiar odours were only observed in fasted rats. Among the numerous peptides shown to vary after 48 h of fasting, we focused on orexins (for which immunoreactive fibres are present in the OB) and leptin, as a peripheral hormone linked to adiposity, and tested their effects of food odour. The administration of orexin A in satiated animals partially mimicked fasting, since food odour increased OB Fos responses, but did not induce sniffing. The treatment of fasted animals with either an orexin receptors antagonist (ACT-078573) or leptin significantly decreased both locomotor activity, time spent sniffing food odour and OB Fos induction in all cell layers, thus mimicking a satiated status. We conclude that orexins and leptin are some of the factors that can modify behavioural and OB Fos responses to a familiar food odour.

  15. Deletion genotypes reduce occlusion body potency but increase occlusion body production in a Colombian Spodoptera frugiperda nucleopolyhedrovirus population.

    Directory of Open Access Journals (Sweden)

    Gloria Barrera

    Full Text Available A Colombian field isolate (SfCOL-wt of Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV is a mixture of different genotypes. To evaluate the insecticidal properties of the different genotypic variants, 83 plaque purified virus were characterized. Ten distinct genotypes were identified (named A through J. SfCOL-A was the most prevalent (71±2%; mean ± SE showing a PstI restriction profile indistinguishable to that of SfCOL-wt. The remaining nine genotypes presented genomic deletions of 3.8 - 21.8 Kb located mainly between nucleotides 11,436 and 33,883 in the reference genome SfMNPV-B, affecting the region between open reading frames (ORFs sf20 and sf33. The insecticidal activity of each genotype from SfCOL-wt and several mixtures of genotypes was compared to that of SfCOL-wt. The potency of SfCOL-A occlusion bodies (OBs was 4.4-fold higher than SfCOL-wt OBs, whereas the speed of kill of SfCOL-A was similar to that of SfCOL-wt. Deletion genotype OBs were similarly or less potent than SfCOL-wt but six deletion genotypes were faster killing than SfCOL-wt. The potency of genotype mixtures co-occluded within OBs were consistently reduced in two-genotype mixtures involving equal proportions of SfCOL-A and one of three deletion genotypes (SfCOL-C, -D or -F. Speed of kill and OB production were improved only when the certain genotype mixtures were co-occluded, although OB production was higher in the SfCOL-wt isolate than in any of the component genotypes, or mixtures thereof. Deleted genotypes reduced OB potency but increased OB production of the SfCOL-wt population, which is structured to maximize the production of OBs in each infected host.

  16. Deletion Genotypes Reduce Occlusion Body Potency but Increase Occlusion Body Production in a Colombian Spodoptera frugiperda Nucleopolyhedrovirus Population

    Science.gov (United States)

    Barrera, Gloria; Williams, Trevor; Villamizar, Laura; Caballero, Primitivo; Simón, Oihane

    2013-01-01

    A Colombian field isolate (SfCOL-wt) of Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV) is a mixture of different genotypes. To evaluate the insecticidal properties of the different genotypic variants, 83 plaque purified virus were characterized. Ten distinct genotypes were identified (named A through J). SfCOL-A was the most prevalent (71±2%; mean ± SE) showing a PstI restriction profile indistinguishable to that of SfCOL-wt. The remaining nine genotypes presented genomic deletions of 3.8 - 21.8 Kb located mainly between nucleotides 11,436 and 33,883 in the reference genome SfMNPV-B, affecting the region between open reading frames (ORFs) sf20 and sf33. The insecticidal activity of each genotype from SfCOL-wt and several mixtures of genotypes was compared to that of SfCOL-wt. The potency of SfCOL-A occlusion bodies (OBs) was 4.4-fold higher than SfCOL-wt OBs, whereas the speed of kill of SfCOL-A was similar to that of SfCOL-wt. Deletion genotype OBs were similarly or less potent than SfCOL-wt but six deletion genotypes were faster killing than SfCOL-wt. The potency of genotype mixtures co-occluded within OBs were consistently reduced in two-genotype mixtures involving equal proportions of SfCOL-A and one of three deletion genotypes (SfCOL-C, -D or -F). Speed of kill and OB production were improved only when the certain genotype mixtures were co-occluded, although OB production was higher in the SfCOL-wt isolate than in any of the component genotypes, or mixtures thereof. Deleted genotypes reduced OB potency but increased OB production of the SfCOL-wt population, which is structured to maximize the production of OBs in each infected host. PMID:24116220

  17. The Stem Cell Marker Lgr5 Defines a Subset of Postmitotic Neurons in the Olfactory Bulb.

    Science.gov (United States)

    Yu, Yiqun; Moberly, Andrew H; Bhattarai, Janardhan P; Duan, Chen; Zheng, Qian; Li, Fangqi; Huang, Hugh; Olson, William; Luo, Wenqin; Wen, Tieqiao; Yu, Hongmeng; Ma, Minghong

    2017-09-27

    Lgr5, leucine-rich repeat-containing G-protein coupled receptor 5, is a bona fide biomarker for stem cells in multiple tissues. Lgr5 is also expressed in the brain, but the identities and properties of these Lgr5 + cells are still elusive. Using an Lgr5-EGFP reporter mouse line, we found that, from early development to adulthood, Lgr5 is highly expressed in the olfactory bulb (OB), an area with ongoing neurogenesis. Immunostaining with stem cell, glial, and neuronal markers reveals that Lgr5 does not label stem cells in the OB but instead labels a heterogeneous population of neurons with preference in certain subtypes. Patch-clamp recordings in OB slices reveal that Lgr5-EGFP + cells fire action potentials and display spontaneous excitatory postsynaptic events, indicating that these neurons are integrated into OB circuits. Interestingly, R-spondin 3, a potential ligand of Lgr5, is also expressed in the adult OB. Collectively, our data indicate that Lgr5-expressing cells in the OB are fully differentiated neurons and imply distinct roles of Lgr5 and its ligand in postmitotic cells. SIGNIFICANCE STATEMENT Lgr5 (leucine-rich repeat-containing G-protein coupled receptor 5) is a bona fide stem cell marker in many body organs. Here we report that Lgr5 is also highly expressed in the olfactory bulb (OB), the first relay station in the brain for processing odor information and one of the few neural structures that undergo continuous neurogenesis. Surprisingly, Lgr5 is not expressed in the OB stem cells, but instead in a few subtypes of terminally differentiated neurons, which are incorporated into the OB circuit. This study reveals that Lgr5 + cells in the brain represent a nonstem cell lineage, implying distinct roles of Lgr5 in postmitotic neurons. Copyright © 2017 the authors 0270-6474/17/379403-12$15.00/0.

  18. Low fish oil intake improves insulin sensitivity, lipid profile and muscle metabolism on insulin resistant MSG-obese rats

    Directory of Open Access Journals (Sweden)

    Iagher Fabiola

    2011-04-01

    Full Text Available Abstract Background Obesity is commonly associated with diabetes, cardiovascular diseases and cancer. The purpose of this study was to determinate the effect of a lower dose of fish oil supplementation on insulin sensitivity, lipid profile, and muscle metabolism in obese rats. Methods Monosodium glutamate (MSG (4 mg/g body weight was injected in neonatal Wistar male rats. Three-month-old rats were divided in normal-weight control group (C, coconut fat-treated normal weight group (CO, fish oil-treated normal weight group (FO, obese control group (Ob, coconut fat-treated obese group (ObCO and fish oil-treated obese group (ObFO. Obese insulin-resistant rats were supplemented with fish oil or coconut fat (1 g/kg/day for 4 weeks. Insulin sensitivity, fasting blood biochemicals parameters, and skeletal muscle glucose metabolism were analyzed. Results Obese animals (Ob presented higher Index Lee and 2.5 fold epididymal and retroperitoneal adipose tissue than C. Insulin sensitivity test (Kitt showed that fish oil supplementation was able to maintain insulin sensitivity of obese rats (ObFO similar to C. There were no changes in glucose and HDL-cholesterol levels amongst groups. Yet, ObFO revealed lower levels of total cholesterol (TC; 30% and triacylglycerol (TG; 33% compared to Ob. Finally, since exposed to insulin, ObFO skeletal muscle revealed an increase of 10% in lactate production, 38% in glycogen synthesis and 39% in oxidation of glucose compared to Ob. Conclusions Low dose of fish oil supplementation (1 g/kg/day was able to reduce TC and TG levels, in addition to improved systemic and muscle insulin sensitivity. These results lend credence to the benefits of n-3 fatty acids upon the deleterious effects of insulin resistance mechanisms.

  19. Omentin-1 Stimulates Human Osteoblast Proliferation through PI3K/Akt Signal Pathway

    Directory of Open Access Journals (Sweden)

    Shan-Shan Wu

    2013-01-01

    Full Text Available It has been presumed that adipokines deriving from adipose tissue may play important roles in bone metabolism. Omentin-1, a novel adipokine, which is selectively expressed in visceral adipose tissue, has been reported to stimulate proliferation and inhibit differentiation of mouse osteoblast. However, little information refers to the effect of omentin-1 on human osteoblast (hOB proliferation. The current study examined the potential effects of omentin-1 on proliferation in hOB and the signal pathway involved. Omentin-1 promoted hOB proliferation in a dose-dependent manner as determined by [3H]thymidine incorporation. Western blot analysis revealed that omentin-1 induced activation of Akt (phosphatidylinositol-3 kinase downstream effector and such effect was impeded by transfection of hOB with Akt-siRNA. Furthermore, LY294002 (a selective PI3K inhibitor and HIMO (a selective Akt inhibitor abolished the omentin-1-induced hOB proliferation. These findings indicate that omentin-1 induces hOB proliferation via the PI3K/Akt signaling pathway and suggest that osteoblast is a direct target of omentin-1.

  20. Potassium and calcium channel gene expression in small arteries in porcine and rat models of diet-induced obesity (Poster)

    DEFF Research Database (Denmark)

    Jensen, Lars Jørn; Salomonsson, Max; Sørensen, Charlotte Mehlin

    2014-01-01

    Obesity is an increasing problem worldwide leading to cardiovascular morbidity. Only limited information exists on the transcriptional regulation of arterial K+ and Ca2+ channels in obesity. We quantified, by real-time PCR, mRNA expression of K+ channels and L-type Ca2+ channels (LTCC) in small...... mesenteric (MA), middle cerebral (MCA), and left coronary arteries (LCA) of lean vs. obese rats and minipigs. Male Sprague Dawley rats were fed a high-fat (FAT; N=5), high-fructose (FRUC; N=7), high-fat/high-fructose (FAT/FRUC; N=7) or standard diet (STD; N=7-11) for 28 Weeks. FAT and FAT/FRUC became obese...... increased in OB and OB+DIAB. BKca, IKca, SKca and/or LTCC mRNA was up-regulated in LCA from OB and OB+DIAB (n.s.). Expression of BKca mRNA was increased, whereas IKca mRNA decreased in MCA from OB (n.s.). SKca mRNA was decreased in MA from OB (n.s.). Diet-induced obesity in rats and minipigs lead to complex...

  1. The daidzein- and estradiol- induced anorectic action in CCK or leptin receptor deficiency rats.

    Science.gov (United States)

    Fujitani, Mina; Mizushige, Takafumi; Bhattarai, Keshab; Iwahara, Asami; Aida, Ryojiro; Kishida, Taro

    2015-01-01

    We investigated the effect of daidzein feeding and estradiol treatment on food intake in cholecystokinin-1 receptor (CCK1R) deficiency, leptin receptor (ObRb) deficiency rats and their wild-type rats. These rats underwent an ovariectomy or a sham operation. For the 5 week experiment, each rat was divided in three groups: control, daidzein (150 mg/kg diet), and estradiol (4.2 μg/rat/day) groups. In both CCK1R+ and CCK1R- rats, daidzein feeding and estradiol treatment significantly decreased food intake. Daidzein feeding significantly reduced food intake in ovariectomized ObRb- rats, although not in ObRb+ rats. Estradiol treatment significantly lowered food intake in ovariectomized ObRb+ and ObRb- rats. In the ovariectomized rats, estradiol treatment significantly increases uterine weight, while daidzein feeding did not change it, suggesting that daidzein might have no or weak estrogenic effect in our experiment. These results suggest that CCK1R and ObRb signalings were not essential for the daidzein- and estradiol-induced anorectic action.

  2. Cross-cultural industrial organizational psychology and organizational behavior: A hundred-year journey.

    Science.gov (United States)

    Gelfand, Michele J; Aycan, Zeynep; Erez, Miriam; Leung, Kwok

    2017-03-01

    In celebration of the anniversary of the Journal of Applied Psychology ( JAP ), we take a hundred-year journey to examine how the science of cross-cultural industrial/organizational psychology and organizational behavior (CCIO/OB) has evolved, both in JAP and in the larger field. We review broad trends and provide illustrative examples in the theoretical, methodological, and analytic advances in CCIO/OB during 4 main periods: the early years (1917-1949), the middle 20th century (1950-1979), the later 20th century (1980-2000), and the 21st century (2000 to the present). Within each period, we discuss key historical and societal events that influenced the development of the science of CCIO/OB, major trends in research on CCIO/OB in the field in general and JAP in particular, and important milestones and breakthroughs achieved. We highlight pitfalls in research on CCIO/OB and opportunities for growth. We conclude with recommendations for the next 100 years of CC IO/OB research in JAP and beyond. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  3. Early cell adhesion events differ between osteoporotic and non-osteoporotic osteoblasts.

    Science.gov (United States)

    Perinpanayagam, H; Zaharias, R; Stanford, C; Brand, R; Keller, J; Schneider, G

    2001-11-01

    In osteoporosis, the regenerative capacity of bone is compromised, which may involve altered osteoblast (OB) activity. This could be attributed to an inappropriate synthesis and assembly of an extracellular matrix (ECM), altered cell adhesion to the ECM, or be due to inappropriate downstream activation of adhesion-mediated signaling cascades through proteins such as focal adhesion kinase (FAK). The purpose of our study was to compare early adhesion-mediated events using previously described and characterized clinically derived OBs obtained from human patients undergoing major joint arthroplasty for osteoporosis or osteoarthritis. The presence or absence of osteoporosis was established with a radiographic index. Using light microscopy and crystal violet staining, we show that OB cells derived from sites of osteoporosis do not attach and spread as well as non-osteoporotic (OP) OB cells. OP cells initially have a more rounded morphology, and show significantly less (P attachment to serum-coated tissue culture plastic over a 24 h time period. Immunofluorescent labeling after 24 h of attachment showed that OP OB focal adhesions (FAs) and stress fibers were less defined, and that the OP cells were smaller and had a more motile phenotype. When normalized protein lysates were Western blotted for phosphotyrosine (PY) a band corresponding to pp125FAK was identified. FAK tyrosine phosphorylation was evident at 6 h in both the OP and non-OP OBs, but decreased or was absent through 24 h in OP OBs. These results suggest early adhesion-mediated events, such as cell adhesion, attachment, and FAK signaling via PY may be altered in OP OBs.

  4. Harsh Parenting and Food Insecurity in Adolescence: The Association With Emerging Adult Obesity.

    Science.gov (United States)

    Lohman, Brenda J; Gillette, Meghan T; Neppl, Tricia K

    2016-07-01

    As the first study of its kind, the overall purpose of this article was to examine the relationships and interactions between harsh parenting (HP) and food insecurity (FI) in adolescence on the development of overweight/obesity (OW/OB) in emerging adulthood. Data came from the Iowa Youth and Families Project, a longitudinal study of 451 adolescent youth and their families that began in 1989 in the rural Midwest. Adolescents were aged 13 years at the initial assessment, and weight status in emerging adulthood was measured 10 years later at age 23. Experiencing HP in adolescence predicted greater odds of OW/OB at 23 years old. Higher body mass indexes of the adolescent and his or her father in adolescence also increased the odds of being OW/OB at 23 years. Having parents with higher levels of education lowered the odds of being OW/OB in emerging adulthood. Finally, females who experienced high levels of FI and HP in adolescence had higher odds of OW/OB at 23 years in comparison to males. HP, in combination with FI in adolescence, predicted OW/OB for females in emerging adulthood but not for males. This study contributes to an understanding of the interplay between multiple influences in adolescence: namely, parenting and economic influences. Assessing antecedents to OW/OB in emerging adulthood via multiple pathways provides a more complex understanding of how and why adolescents turn into OW/OB adults. Copyright © 2016 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  5. Maternal obesity accelerates fetal pancreatic beta-cell but not alpha-cell development in sheep: prenatal consequences.

    Science.gov (United States)

    Ford, Stephen P; Zhang, Liren; Zhu, Meijun; Miller, Myrna M; Smith, Derek T; Hess, Bret W; Moss, Gary E; Nathanielsz, Peter W; Nijland, Mark J

    2009-09-01

    Maternal obesity affects offspring weight, body composition, and organ function, increasing diabetes and metabolic syndrome risk. We determined effects of maternal obesity and a high-energy diet on fetal pancreatic development. Sixty days prior to breeding, ewes were assigned to control [100% of National Research Council (NRC) recommendations] or obesogenic (OB; 150% NRC) diets. At 75 days gestation, OB ewes exhibited elevated insulin-to-glucose ratios at rest and during a glucose tolerance test, demonstrating insulin resistance compared with control ewes. In fetal studies, ewes ate their respective diets from 60 days before to 75 days after conception when animals were euthanized under general anesthesia. OB and control ewes increased in body weight by approximately 43% and approximately 6%, respectively, from diet initiation until necropsy. Although all organs were heavier in fetuses from OB ewes, only pancreatic weight increased as a percentage of fetal weight. Blood glucose, insulin, and cortisol were elevated in OB ewes and fetuses on day 75. Insulin-positive cells per unit pancreatic area were 50% greater in fetuses from OB ewes as a result of increased beta-cell mitoses rather than decreased programmed cell death. Lambs of OB ewes were born earlier but weighed the same as control lambs; however, their crown-to-rump length was reduced, and their fat mass was increased. We conclude that increased systemic insulin in fetuses from OB ewes results from increased glucose exposure and/or cortisol-induced accelerated fetal beta-cell maturation and may contribute to premature beta-cell function loss and predisposition to obesity and metabolic disease in offspring.

  6. Cooperative Hurricane Network Obs

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Observations from the Cooperative Hurricane Reporting Network (CHURN), a special network of stations that provided observations when tropical cyclones approached the...

  7. The OBS control plane

    DEFF Research Database (Denmark)

    Manolova, Anna Vasileva; Ruepp, Sarah Renée

    2010-01-01

    . The applicability analysis carried out here focuses on the actual feasibility of the integration and the potential trade-offs which appear when two contradicting principles are combined. Taking advantage of the flexibility of the GMPLS control plane does not seem to be as easy and as straightforward as expected...

  8. Doppiaggio in italiano del film 'Astérix et Obélix - Au service de Sa Majesté'. Trasposizione degli elementi culturali e umoristici

    Directory of Open Access Journals (Sweden)

    Alessandra Rollo

    2016-01-01

    Full Text Available Abstract – At present, audiovisual translation is one of the most interesting and stimulating domains within the field of Translation Studies. Resting on a rich semiotic apparatus, marked by the interplay of a double channel of communication – audio/visual – with different types of signs – verbal/non-verbal codes, the audiovisual text is a complex one, whose transfer from one language into another represents a challenging task for every professional in this field. Especially in dubbing, the translator/adapter has to work on the interlinguistic level as well as on the intersemiotic level (iconic, paralinguistic elements, etc.: as many codes having great semantic potential and transmitting useful cultural information, as we shall see in the film which we have taken as the object of our analyses: Astérix et Obélix: Au Service de Sa Majesté (2012. This fourth film adaptation (except cartoons of Astérix’s adventures offers a series of gags playing on the parody of typical traditions, symbols, linguistic clichés and cultural stereotypes associated with British culture. Italian dubbing resorts to different translation strategies, some of which come under a foreignizing approach, aiming at preserving the original’s colour and mood, whereas others are in line with a domesticating approach, in order to bring the product closer to the final audience. Indeed, instead of stressing the idea of a polarization or a dichotomy between two contrasting perspectives, we find it advisable to envisage a gradation between two instances which occur at the same time and coexist in a complementary way during the translation process.   Keywords: audiovisual translation; dubbing; cultural elements; humorous elements; foreignization/domestication.     Résumé – La traduction audiovisuelle se configure à l’heure actuelle comme l’un des domaines les plus intéressants et les plus stimulants dans le panorama des etudes traductologiques. Reposant sur

  9. Influence of Term of Exposure to High-Fat Diet-Induced Obesity on Myocardial Collagen Type I and III

    International Nuclear Information System (INIS)

    Silva, Danielle Cristina Tomaz da; Lima-Leopoldo, Ana Paula; Leopoldo, André Soares; Campos, Dijon Henrique Salomé de; Nascimento, André Ferreira do; Oliveira, Sílvio Assis Junior de; Padovani, Carlos Roberto; Cicogna, Antonio Carlos

    2014-01-01

    Obesity is a risk factor for many medical complications; medical research has shown that hemodynamic, morphological and functional abnormalities are correlated with the duration and severity of obesity. Present study determined the influence of term of exposure to high-fat diet-induced obesity on myocardial collagen type I and III. Thirty-day-old male Wistar rats were randomly distributed into two groups: a control (C) group fed a standard rat chow and an obese (Ob) group alternately fed one of four palatable high-fat diets. Each diet was changed daily, and the rats were maintained on their respective diets for 15 (C 15 and Ob 15 ) and 30 (C 30 and Ob 30 ) consecutive weeks. Obesity was determined by adiposity index. The Ob 15 group was similar to the C 15 group regarding the expression of myocardial collagen type I; however, expression in the Ob 30 group was less than C 30 group. The time of exposure to obesity was associated with a reduction in collagen type I in Ob 30 when compared with Ob 15 . Obesity did not affect collagen type III expression. This study showed that the time of exposure to obesity for 30 weeks induced by unsaturated high-fat diet caused a reduction in myocardial collagen type I expression in the obese rats. However, no effect was seen on myocardial collagen type III expression

  10. Synergistic effect of energy drinks and overweight/obesity on cardiac autonomic testing using the Valsalva maneuver in university students.

    Science.gov (United States)

    Majeed, Farrukh; Yar, Talay; Alsunni, Ahmed; Alhawaj, Ali Fouad; AlRahim, Ahmed; Alzaki, Muneer

    2017-01-01

    Obesity and caffeine consumption may lead to autonomic disturbances that can result in a wide range of cardiovascular disorders. To determine autonomic disturbances produced by the synergistic effects of overweight or obesity (OW/OB) and energy drinks. Cross-sectional, analytical. Physiology department at a university in Saudi Arabia. University students, 18-22 years of age, of normal weight (NW) and OW/OB were recruited by convenience sampling. Autonomic testing by the Valsalva ratio (VR) along with systolic and diastolic blood pressure, pulse pressure, and mean arterial blood pressure were measured at baseline (0 minute) and 60 minutes after energy drink consumption. Autonomic disturbance, hemodynamic changes. In 50 (27 males and 23 females) subjects, 21 NW and 29 OW/OB, a significant decrease in VR was observed in OW/OB subjects and in NW and OW/OB females at 60 minutes after energy drink consumption. Values of systolic and diastolic blood pressure, pulse pressure and mean arterial blood pressure were also significantly higher in OW/OB and in females as compared to NW and males. BMI was negatively correlated with VR and diastolic blood pressure at 60 minutes. Obesity and energy drinks alter autonomic functions. In some individuals, OW/OB may augment these effects. Due to time and resource restraints, only the acute effects of energy drinks were examined.

  11. Involvement of Amylin and Leptin in the Development of Projections from the Area Postrema to the Nucleus of the Solitary Tract

    Directory of Open Access Journals (Sweden)

    Kathrin Abegg

    2017-11-01

    Full Text Available The area postrema (AP and the nucleus of the solitary tract (NTS are important hindbrain centers involved in the control of energy homeostasis. The AP mediates the anorectic action and the inhibitory effect on gastric emptying induced by the pancreatic hormone amylin. Amylin’s target cells in the AP project to the NTS, an integrative relay center for enteroceptive signals. Perinatal hormonal and metabolic factors influence brain development. A postnatal surge of the adipocyte-derived hormone leptin represents a developmental signal for the maturation of projections between hypothalamic nuclei controlling energy balance. Amylin appears to promote neurogenesis in the AP in adult rats. Here, we examined whether amylin and leptin are required for the development of projections from the AP to the NTS in postnatal and adult mice by conducting neuronal tracing studies with DiI in amylin- (IAPP−/− and leptin-deficient (ob/ob mice. Compared to wild-type littermates, postnatal (P10 and adult (P60 IAPP−/− mice showed a significantly reduced density of AP-NTS projections. While AP projections were also reduced in postnatal (P14 ob/ob mice, AP-NTS fiber density did not differ between adult ob/ob and wild-type animals. Our findings suggest a crucial function of amylin for the maturation of neuronal brainstem pathways controlling energy balance and gastrointestinal function. The impaired postnatal development of neuronal AP-NTS projections in ob/ob mice appears to be compensated in this experimental model during later brain maturation. It remains to be elucidated whether an amylin- and leptin-dependent modulation in neuronal development translates into altered AP/NTS-mediated functions.

  12. Sleep quality, sleep duration and physical activity in obese adolescents: effects of exercise training.

    Science.gov (United States)

    Mendelson, M; Borowik, A; Michallet, A-S; Perrin, C; Monneret, D; Faure, P; Levy, P; Pépin, J-L; Wuyam, B; Flore, P

    2016-02-01

    Decreased sleep duration and altered sleep quality are risk factors for obesity in youth. Structured exercise training has been shown to increase sleep duration and improve sleep quality. This study aimed at evaluating the impact of exercise training for improving sleep duration, sleep quality and physical activity in obese adolescents (OB). Twenty OB (age: 14.5 ± 1.5 years; body mass index: 34.0 ± 4.7 kg m(-2) ) and 20 healthy-weight adolescents (HW) completed an overnight polysomnography and wore an accelerometer (SenseWear Bodymedia) for 7 days. OB participated in a 12-week supervised exercise-training programme consisting of 180 min of exercise weekly. Exercise training was a combination of aerobic exercise and resistance training. Sleep duration was greater in HW compared with OB (P < 0.05). OB presented higher apnoea-hypopnoea index than HW (P < 0.05). Physical activity (average daily metabolic equivalent of tasks [METs]) by accelerometer was lower in OB (P < 0.05). After exercise training, obese adolescents increased their sleep duration (+64.4 min; effect size: 0.88; P = 0.025) and sleep efficiency (+7.6%; effect size: 0.76; P = 0.028). Physical activity levels were increased in OB as evidenced by increased steps per day and average daily METs (P < 0.05). Improved sleep duration was associated with improved average daily METs (r = 0.48, P = 0.04). The present study confirms altered sleep duration and quality in OB. Exercise training improves sleep duration, sleep quality and physical activity. © 2015 World Obesity.

  13. Modeling and characterization of different channels based on human body communication.

    Science.gov (United States)

    Jingzhen Li; Zedong Nie; Yuhang Liu; Lei Wang

    2017-07-01

    Human body communication (HBC), which uses the human body as a transmission medium for electrical signals, provides a prospective communication solution for body sensor networks (BSNs). In this paper, an inhomogeneous model which includes the tissue layers of skin, fat, and muscle is proposed to study the propagation characteristics of different HBC channels. Specifically, the HBC channels, namely, the on-body to on-body (OB-OB)channel, on-body to in-body (OB-IB) channel, in-body to on-body (IB-OB) channel, and in-body to in-body (IB-IB)channel, are studied over different frequencies (from 1MHz to 100MHz) through numerical simulations with finite-difference time-domain (FDTD) method. The results show that the gain of OB-IB channel and IB-OB channel is almost the same. The gain of IB-IB channel is greater than other channels in the frequency range 1MHz to 70MHz. In addition, the gain of all channels is associated with the channel length and communication frequency. The simulations are verified by experimental measurements in a porcine tissue sample. The results show that the simulations are in agreement with the measurements.

  14. Organizational Behavior: A Brief Overview and Safety Orientation.

    Science.gov (United States)

    Waller, Mary J

    2015-12-01

    Organizational Behavior (OB) is a discipline of social science that seeks explanations for human behavior in organizations. OB draws on core disciplines such as psychology, sociology, anthropology, economics, communication, and law to create and investigate multilevel explanations of why people engage in particular behaviors, and which behaviors under which circumstances lead to better outcomes in organizations. Created using an applied or pragmatic lens and tested with a wide range of both quantitative and qualitative methodologies, most OB theories and research have direct implications for managers and for other organizational participants. Not surprisingly, one focal area of OB research concerns safety in organizations, and a growing body of safety-oriented literature in OB is based on data collected during simulation training across a variety of organizations such as hospitals, airlines, nuclear power plants, and other high reliability organizations. Copyright © 2015 Mosby, Inc. All rights reserved.

  15. Increased lipids in non-lipogenic tissues are indicators of the severity of type 2 diabetes in mice

    DEFF Research Database (Denmark)

    Campbell-Tofte, J.; Hansen, H.S.; Mu, Huiling

    2007-01-01

    We hypothesised that the molecular changes triggered in type 2 diabetes might cause phenotypic changes in the lipid fraction of tissues. We compared tissue lipid profiles of inbred lean B6-Bom with those of the obese B6-ob/ob and diabetic BKS-db/db mice and found that genetically diabetic mice...... significantly accumulate fat (especially monounsaturated fatty acids, MUFA) in non-lipogenic tissues such as the eye (MUFA, 2-fold), skeletal muscle (MUFA, 13-fold) and pancreas (MUFA, 16-fold). In contrast, the B6-ob/ob mice which manifest a milder form of type 2 diabetes use the liver as their predominant...

  16. Lining bunker walls with oxygen barrier film reduces nutrient losses in corn silages.

    Science.gov (United States)

    Lima, L M; Dos Santos, J P; Casagrande, D R; Ávila, C L S; Lara, M S; Bernardes, T F

    2017-06-01

    The objective of this study was to evaluate 2 systems for covering corn silage in bunker silos. The first system consisted of a sheet of 45-μm-thick oxygen barrier film (OB, polyethylene + ethylene-vinyl alcohol) placed along the length of the sidewall before filling. After filling, the excess film was pulled over the wall on top of the silage, and a sheet of polyethylene was placed on top. The second system involved using a standard sheet (ST) of 180-μm-thick polyethylene film. Eight commercial bunker silos were divided into 2 parts lengthwise so that one-half of the silo was covered with OB and the other half with a ST system. During the filling, 3 net bags with chopped corn were buried in the central part (halfway between the top and bottom of the silo) of the bunkers (CCOR) in 3 sections 10 m apart. After filling, 18 net bags (9 per covering system) were buried 40 cm below the top surface of the 3 sections. These bags were placed at 3 distances from the bunker walls (0 to 50 cm, 51 to 100 cm, and 101 to 150 cm). During unloading, the bags were removed from the silos to determine the dry matter (DM) losses, fermentation end products, and nutritive value. The Milk2006 spreadsheet was used to estimate milk per tonne of DM. The model included the fixed effect of treatment (7 different locations in the bunker) and the random effect of the silo. Two contrasts were tested to compare silages in the top laterals (shoulders) with that in the CCOR (CCOR vs. OB and CCOR vs. ST). Three contrasts compared the corresponding distances of the silage covered by the 2 systems (OB50 vs. ST50, OB100 vs. ST100 and OB150 vs. ST150). Variables were analyzed with the PROC MIXED procedure of the SAS at the 5% level. The OB method produced well-fermented silages, which were similar to CCOR, whereas the OB system showed less lactic acid and greater pH and mold counts compared with CCOR. The ST method had 116.2 kg of milk/t less than the CCOR, as the OB system and the CCOR were similar

  17. Kempe's Linkages and the Universality Theorem

    Indian Academy of Sciences (India)

    sriranga

    that between BO and OA (i.e., \\BOA). Let these two angles be denoted by µ. Thus, if link OA makes an angle. µ with link OB, OE makes the same angle on the other side of OB. Kempe therefore referred to this linkage as the (angle) reversor. This is true irrespective of how OA and OB are placed relative to each other. Also ...

  18. A subset of osteoblasts expressing high endogenous levels of PPARgamma switches fate to adipocytes in the rat calvaria cell culture model.

    Directory of Open Access Journals (Sweden)

    Yuji Yoshiko

    2010-07-01

    Full Text Available Understanding fate choice and fate switching between the osteoblast lineage (ObL and adipocyte lineage (AdL is important to understand both the developmental inter-relationships between osteoblasts and adipocytes and the impact of changes in fate allocation between the two lineages in normal aging and certain diseases. The goal of this study was to determine when during lineage progression ObL cells are susceptible to an AdL fate switch by activation of endogenous peroxisome proliferator-activated receptor (PPARgamma.Multiple rat calvaria cells within the ObL developmental hierarchy were isolated by either fractionation on the basis of expression of alkaline phosphatase or retrospective identification of single cell-derived colonies, and treated with BRL-49653 (BRL, a synthetic ligand for PPARgamma. About 30% of the total single cell-derived colonies expressed adipogenic potential (defined cytochemically when BRL was present. Profiling of ObL and AdL markers by qRT-PCR on amplified cRNA from over 160 colonies revealed that BRL-dependent adipogenic potential correlated with endogenous PPARgamma mRNA levels. Unexpectedly, a significant subset of relatively mature ObL cells exhibited osteo-adipogenic bipotentiality. Western blotting and immunocytochemistry confirmed that ObL cells co-expressed multiple mesenchymal lineage determinants (runt-related transcription factor 2 (Runx2, PPARgamma, Sox9 and MyoD which localized in the cytoplasm initially, and only Runx2 translocated to the nucleus during ObL progression. Notably, however, some cells exhibited both PPARgamma and Runx2 nuclear labeling with concomitant upregulation of expression of their target genes with BRL treatment.We conclude that not only immature but a subset of relatively mature ObL cells characterized by relatively high levels of endogenous PPARgamma expression can be switched to the AdL. The fact that some ObL cells maintain capacity for adipogenic fate selection even at relatively

  19. Bariatric surgery in hypothalamic obesity

    Directory of Open Access Journals (Sweden)

    Nathan eBingham

    2012-02-01

    Full Text Available Craniopharyngiomas (CP are epithelial neoplasms generally found in the area of the pituitary and hypothalamus. Despite benign histology, these tumors and/or their treatment often result in significant, debilitating disorders of endocrine, neurological, behavioral, and metabolic systems. Severe obesity is observed in a high percentage of patients with CP resulting in significant comorbidities and negatively impacting quality of life. Obesity occurs as a result of hypothalamic damage and disruption of normal homeostatic mechanisms regulating energy balance. Such pathological weight gain, termed hypothalamic obesity (HyOb, is often severe and refractory to therapy.Unfortunately, neither lifestyle intervention nor pharmacotherapy has proven truly effective in the treatment of CP-HyOb. Given the limited choices and poor results of these treatments, several groups have examined bariatric surgery as a treatment alternative for patients with CP-HyOb. While a large body of evidence exists supporting the use of bariatric surgery in the treatment of exogenous obesity and its comorbidities, its role in the treatment of HyOb has yet to be well defined. To date, the existing literature on bariatric surgery in CP-HyOb is largely limited to case reports and series with short term follow-up. Here we review the current reports on the use of bariatric surgery in the treatment of CP-HyOb. We also compare these results to those reported for other populations of HyOb, including Prader-Willi Syndrome and patients with melanocortin signaling defects. While initial reports of bariatric surgery in CP-HyOb are promising, their limited scope makes it difficult to draw any substantial conclusions as to the long term safety and efficacy of bariatric surgery in CP-HyOb. There continues to be a need for more robust, controlled, prospective trials with long term follow-up in order to better define the role of bariatric surgery in the treatment of all types of hypothalamic

  20. Influence of Term of Exposure to High-Fat Diet-Induced Obesity on Myocardial Collagen Type I and III

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Danielle Cristina Tomaz da [Departamento de Clínica Médica, Faculdade de Medicina de Botucatu, Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil); Lima-Leopoldo, Ana Paula; Leopoldo, André Soares [Departamento de Esportes, Centro de Educação Física e Desportos da Universidade Federal do Espírito Santo (UFES), Vitória, ES (Brazil); Campos, Dijon Henrique Salomé de; Nascimento, André Ferreira do [Departamento de Clínica Médica, Faculdade de Medicina de Botucatu, Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil); Oliveira, Sílvio Assis Junior de [Escola de Fisioterapia da Universidade Federal de Mato Grosso do Sul (UFMS), Campo Grande, MS (Brazil); Padovani, Carlos Roberto [Departamento de Bioestatística do Instituto de Ciências Biológicas da Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil); Cicogna, Antonio Carlos, E-mail: dany.tomaz@gmail.com [Departamento de Clínica Médica, Faculdade de Medicina de Botucatu, Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil)

    2014-02-15

    Obesity is a risk factor for many medical complications; medical research has shown that hemodynamic, morphological and functional abnormalities are correlated with the duration and severity of obesity. Present study determined the influence of term of exposure to high-fat diet-induced obesity on myocardial collagen type I and III. Thirty-day-old male Wistar rats were randomly distributed into two groups: a control (C) group fed a standard rat chow and an obese (Ob) group alternately fed one of four palatable high-fat diets. Each diet was changed daily, and the rats were maintained on their respective diets for 15 (C{sub 15} and Ob{sub 15}) and 30 (C{sub 30} and Ob{sub 30}) consecutive weeks. Obesity was determined by adiposity index. The Ob{sub 15} group was similar to the C{sub 15} group regarding the expression of myocardial collagen type I; however, expression in the Ob{sub 30} group was less than C{sub 30} group. The time of exposure to obesity was associated with a reduction in collagen type I in Ob{sub 30} when compared with Ob{sub 15}. Obesity did not affect collagen type III expression. This study showed that the time of exposure to obesity for 30 weeks induced by unsaturated high-fat diet caused a reduction in myocardial collagen type I expression in the obese rats. However, no effect was seen on myocardial collagen type III expression.

  1. The Approach of General Surgeons to Oncoplastic and Reconstructive Breast Surgery in Turkey: A Survey of Practice Patterns

    Directory of Open Access Journals (Sweden)

    Mustafa Emiroğlu

    2014-12-01

    Full Text Available Background: Oncoplastic Breast Surgery (OBS, which is a combination of oncological procedures and plastic surgery techniques, has recently gained widespread use. Aims: To assess the experiences, practice patterns and preferred approaches to Oncoplastic and Reconstructive Breast Surgery (ORBS undertaken by general surgeons specializing in breast surgery in Turkey. Study Design: Cross-sectional study. Methods: Between December 2013 and February 2014, an eleven-question survey was distributed among 208 general surgeons specializing in breast surgery. The questions focused on the attitudes of general surgeons toward performing oncoplastic breast surgery (OBS, the role of the general surgeon in OBS and their training for it as well as their approaches to evaluating cosmetic outcomes in Breast Conserving Surgery (BCS and informing patients about ORBS preoperatively. Results: Responses from all 208 surgeons indicated that 79.8% evaluated the cosmetic outcomes of BCS, while 94.2% informed their patients preoperatively about ORBS. 52.5% performed BCS (31.3% themselves, 21.1% together with a plastic surgeon. 53.8% emphasized that general surgeons should carry out OBS themselves. 36.1% of respondents suggested that OBS training should be included within mainstream surgical training, whereas 27.4% believed this training should be conducted by specialised centres. Conclusion: Although OBS procedure rates are low in Turkey, it is encouraging to see general surgeons practicing ORBS themselves. The survey demonstrates that our general surgeons aspire to learn and utilize OBS techniques.

  2. Hardness properties and microscopic investigation of crack- crystal interaction in SiO(2)-MgO-Al(2)O(3)-K(2)O-B(2)O(3)-F glass ceramic system.

    Science.gov (United States)

    Roy, Shibayan; Basu, Bikramjit

    2010-01-01

    In view of the potential engineering applications requiring machinability and wear resistance, the present work focuses to evaluate hardness property and to understand the damage behavior of some selected glass-ceramics having different crystal morphologies with SiO(2)-MgO-Al(2)O(3)-K(2)O-B(2)O(3)-F composition, using static micro-indentation tests as well as dynamic scratch tests, respectively. Vickers hardness of up to 5.5 GPa has been measured in glass-ceramics containing plate like mica crystals. Scratch tests at a high load of 50 Nin artificial saliva were carried out in order to simulate the crack-microstructure interaction during real-time abrasion wear and machining operation. The experimental observations indicate that the novel "spherulitic-dendritic shaped "crystals, similar to the plate like crystals, have the potential to hinder the scratching induced crack propagation. In particular, such potential of the 'spherulitic-dendritic' crystals become more effective due to the larger interfacial area with the glass matrix as well as the dendritic structure of each mica plate, which helps in crack deflection and crack blunting, to a larger extent.While modest damage tolerant behavior is observed in case of 'spherulitic-dendritic' crystal containing material, severe brittle fracture of plate like crystals were noted, when both were scratched at 50 N load.

  3. Wirkungen eines Bifidojoghurts mit Laktulose und eines konventionellen Joghurts auf Darmphysiologie und bakterielle Metaboliten als Risikomodulatoren der Kolonkarzinogenese sowie Darmflora und Blutlipide bei gesunden Erwachsenen

    OpenAIRE

    Gerlach, Stefanie

    2007-01-01

    Hintergrund: Probiotische und synbiotische Milchprodukte zählen zu den "funktionellen Lebensmitteln", denen im Vergleich zu herkömmlichen Produkten ein gesundheitsfördernder Zusatznutzen zugeschrieben wird. Dabei wird diskutiert, ob die Gesundheit bereits gesunder Personen noch optimierbar ist, ob und in welcher Weise die Darmflora gezielt "günstig" modifiziert werden kann und/oder ob diese Manipulation zu messbaren gesundheitsfördernden Veränderungen metabolischer und systemischer Biomarker ...

  4. Markers of Oxidative Stress in Human Milk do not Differ by Maternal BMI But are Related to Infant Growth Trajectories.

    Science.gov (United States)

    Young, Bridget E; Patinkin, Zachary W; Pyle, Laura; de la Houssaye, Becky; Davidson, Barbara S; Geraghty, Sheela; Morrow, Ardythe L; Krebs, Nancy

    2017-06-01

    Objective Obesity in adults is associated with inflammation and oxidative stress. Whether or not this phenotype is reflected in human milk (HM) composition, or may impact infant growth remains unknown. We investigated whether HM from overweight/obese (OW/Ob) mothers exhibited higher concentrations of inflammatory cytokines and markers of oxidative stress. We also correlated these bioactive components with infant growth patterns. Methods This was an observational cohort of 56 breastfeeding mothers and their infants [33 normal weight (NW) and 23 OW/Ob]. Infants were followed until 6 months of age and HM collected at 2-weeks and 4-months. Results Markers of oxidative stress, 8-hydroxy-deoxyguanosine (8OHdG) and 4-hydroxynonenol (HNE), decreased in HM over time (p < 0.001) and did not differ between NW and OW/Ob women. Concentrations of inflammatory cytokines, IL-6, IL-8, and TNF-α, were all inter-correlated (p < 0.001) but did not differ between NW and OW/Ob women. HM fat, protein, lactose, and total calories did not differ between NW and OW/Ob women. Infant growth patterns did not differ by group. In a model of infant weight-for-length-Z score trajectory, there was a significant interaction between both lactose and 8OHdG with maternal group: HM lactose and 8OHdG concentrations were both positively associated with increases in WLZ trajectory only among infants breastfed by OW/Ob mothers. Conclusions for Practice HM composition was relatively stable between NW and OW/Ob women. In exclusively breastfed infants, HM concentrations of lactose and 8OHdG, a marker of oxidative stress, may contribute to regulation of infant weight gain, especially among infants of OW/Ob women.

  5. Trajectories of body mass index among Canadian seniors and associated mortality risk.

    Science.gov (United States)

    Wang, Meng; Yi, Yanqing; Roebothan, Barbara; Colbourne, Jennifer; Maddalena, Victor; Sun, Guang; Wang, Peizhong Peter

    2017-12-04

    This study aims to characterize the heterogeneity in BMI trajectories and evaluate how different BMI trajectories predict mortality risk in Canadian seniors. Data came from the Canadian National Population Health Survey (NPHS, 1994-2011) and 1480 individuals aged 65-79 years with at least four BMI records were included in this study. Group-based trajectory model was used to identify distinct subgroups of longitudinal trajectories of BMI measured over 19 years for men and women. Cox proportional hazards models were used to examine the association between BMI trajectories and mortality risks. Distinct trajectory patterns were found for men and women: 'Normal Weight-Down'(N-D), 'Overweight-Normal weight' (OV-N), 'Obese I-Down' (OB I-D), and 'Obese II- Down' (OB II-D) for women; and 'Normal Weight-Down' (N-D), 'Overweight-Normal weight' (OV-N), 'Overweight-Stable' (OV-S), and 'Obese-Stable' (OB-S) for men. Comparing with OV-N, men in the OV-S group had the lowest mortality risk followed by the N-D (HR = 1.66) and OB-S (HR = 1.98) groups, after adjusting for covariates. Compared with OV-N, women in the OB II-D group with three or more chronic health conditions had higher mortality risk (HR = 1.61); however, women in OB II-D had lower risk (HR = 0.56) if they had less than three conditions. The course of BMI over time in Canadian seniors appears to follow one of four different patterns depending on gender. The findings suggest that men who were overweight at age 65 and lost weight over time had the lowest mortality risk. Interestingly, obese women with decreasing BMI have different mortality risks, depending on their chronic health conditions. The findings provide new insights concerning the associations between BMI and mortality risk.

  6. Hepatic Transporter Expression in Metabolic Syndrome: Phenotype, Serum Metabolic Hormones, and Transcription Factor Expression.

    Science.gov (United States)

    Donepudi, Ajay C; Cheng, Qiuqiong; Lu, Zhenqiang James; Cherrington, Nathan J; Slitt, Angela L

    2016-04-01

    Metabolic syndrome is a multifactorial disease associated with obesity, insulin resistance, diabetes, and the alteration of multiple metabolic hormones. Obesity rates have been rising worldwide, which increases our need to understand how this population will respond to drugs and exposure to other chemicals. The purpose of this study was to determine in lean and obese mice the ontogeny of clinical biomarkers such as serum hormone and blood glucose levels as well as the physiologic markers that correlate with nuclear receptor- and transporter-related pathways. Livers from male and female wild-type (WT) (C57BL/6) and ob/ob mice littermates were collected before, during, and after the onset of obesity. Serum hormone and mRNA levels were analyzed. Physiologic changes and gene expression during maturation and progression to obesity were performed and correlation analysis was performed using canonical correlations. Significant ontogenic changes in both WT and ob/ob mice were observed and these ontogenic changes differ in ob/ob mice with the development of obesity. In males and females, the ontogenic pattern of the expression of genes such as Abcc3, 4, Abcg2, Cyp2b10, and 4a14 started to differ from week 3, and became significant at weeks 4 and 8 in ob/ob mice compared with WT mice. In obese males, serum resistin, glucagon, and glucose levels correlated with the expression of most hepatic ATP-binding cassette (Abc) transporters, whereas in obese females, serum glucagon-like peptide 1 levels were correlated with most hepatic uptake transporters and P450 enzymes. Overall, the correlation between physiologic changes and gene expression indicate that metabolism-related hormones may play a role in regulating the genes involved in drug metabolism and transport. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

  7. Neural correlates of behavioural olfactory sensitivity changes seasonally in European starlings.

    Directory of Open Access Journals (Sweden)

    Geert De Groof

    2010-12-01

    Full Text Available Possibly due to the small size of the olfactory bulb (OB as compared to rodents, it was generally believed that songbirds lack a well-developed sense of smell. This belief was recently revised by several studies showing that various bird species, including passerines, use olfaction in many respects of life. During courtship and nest building, male European starlings (Sturnus vulgaris incorporate aromatic herbs that are rich in volatile compounds (e.g., milfoil, Achillea millefolium into the nests and they use olfactory cues to identify these plants. Interestingly, European starlings show seasonal differences in their ability to respond to odour cues: odour sensitivity peaks during nest-building in the spring, but is almost non-existent during the non-breeding season.This study used repeated in vivo Manganese-enhanced MRI to quantify for the first time possible seasonal changes in the anatomy and activity of the OB in starling brains. We demonstrated that the OB of the starling exhibits a functional seasonal plasticity of certain plant odour specificity and that the OB is only able to detect milfoil odour during the breeding season. Volumetric analysis showed that this seasonal change in activity is not linked to a change in OB volume. By subsequently experimentally elevating testosterone (T in half of the males during the non-breeding season we showed that the OB volume was increased compared to controls.By investigating the neural substrate of seasonal olfactory sensitivity changes we show that the starlings' OB loses its ability during the non-breeding season to detect a natural odour of a plant preferred as green nest material by male starlings. We found that testosterone, applied during the non-breeding season, does not restore the discriminatory ability of the OB but has an influence on its size.

  8. Correlates of Overweight and Obesity Among Adolescents With Bipolar Disorder in the National Comorbidity Survey-Adolescent Supplement (NCS-A).

    Science.gov (United States)

    Goldstein, Benjamin I; Blanco, Carlos; He, Jian-Ping; Merikangas, Kathleen

    2016-12-01

    Despite substantial evidence on the prevalence and correlates of overweight and obesity (OW/OB) in adults with bipolar disorder (BD), little is known about this topic in adolescents with BD. The method consisted of the National Comorbidity Survey-Adolescent Supplement, a face-to-face survey of mental disorders from 2001 through 2004, using a modified version of the fully structured World Health Organization Composite International Diagnostic Interview. Participants were adolescents 13 to 17 years of age, with bipolar disorder I or II (n = 295), major depressive disorder (n = 1,112), or controls with neither mood disorder (n = 8,716). Analyses examined for group differences in the prevalence of OW/OB and for correlates of OW/OB in the group with BD. There were no significant differences in weight categories across groups. OW and OB in adolescents with BD were associated with significantly higher lifetime rates of suicide attempt (odds ratio 3.02, 95% CI 1.11-8.24), physical or sexual abuse (2.82, 1.20-6.60), binge eating or bulimia (2.66, 1.13-6.26), and conduct disorder (2.60, 1.10-6.13) in covariate-adjusted analyses. OW and OB also were significantly associated with seeing a professional for depression, being hospitalized overnight for depression, and receiving general medical treatment. The similar prevalence of OW/OB in adolescents with and without BD suggests that this potent association in adults likely comprises a consequence of BD or its correlates. In contrast, the strong association of OW/OB with proxies for depression severity, including suicide attempts and hospitalization, is already evident even in this young, nonclinical sample. Studies are warranted to determine whether early intervention of OW/OB in BD might optimize physical and mental health. Copyright © 2016 American Academy of Child and Adolescent Psychiatry. All rights reserved.

  9. Heterotypic contact reveals a COX-2-mediated suppression of osteoblast differentiation by endothelial cells: A negative modulatory role for prostanoids in VEGF-mediated cell: cell communication?

    International Nuclear Information System (INIS)

    Clarkin, Claire E.; Garonna, Elena; Pitsillides, Andrew A.; Wheeler-Jones, Caroline P.D.

    2008-01-01

    In bone, angiogenesis must be initiated appropriately, but limited once remodelling or repair is complete. Our recent findings have supported a role for prostaglandins (PG), known modulators of osteoblast (OB) and endothelial cell (EC) behaviour, in facilitating VEGF-mediated paracrine communication from OBs to 'remotely located' ECs, but the mechanism(s) regulating OB:EC crosstalk when these cells are closely opposed are undefined. In this study we have examined: (i) the effects of exogenous PGE 2 on VEGF-driven events in ECs, and (ii) the role of endogenous COX-2-derived prostanoids in mediating communication between intimately opposed OBs and ECs in direct contact. Exposure of ECs to PGE 2 increased ERK1/2 phosphorylation, COX-2 induction, 6-keto-PGF 1α release and EC proliferation. In contrast, PGE 2 attenuated VEGF 165 -induced VEGFR2/Flk1 phosphorylation, ERK1/2 activation and proliferation of ECs, suggesting that exogenous PGE 2 restricts the actions of VEGF. However, the COX-2-selective inhibitor, NS398, also attenuated VEGF-induced proliferation, implying a distinct role for endogenous COX-2 activity in regulating EC behaviour. To examine the effect of OB:EC proximity and the role of COX-2 products further, we used a confrontational co-culture model. These studies showed that COX-2 blockade with NS398 enhanced EC-dependent increases in OB differentiation, that this effect was reversed by exogenous PGH 2 (immediate COX-2 product), and that exogenous VEGF did not influence EC-dependent OB differentiation under these conditions. Our findings indicate that locally produced prostanoids may serve distinct roles depending on OB:EC proximity and negatively modulate VEGF-mediated changes in EC behaviour when these cells are closely opposed to control angiogenesis during bone (re)modelling

  10. UDP-glucuronosyltransferase expression in mouse liver is increased in obesity- and fasting-induced steatosis.

    Science.gov (United States)

    Xu, Jialin; Kulkarni, Supriya R; Li, Liya; Slitt, Angela L

    2012-02-01

    UDP-glucuronosyltransferases (Ugt) catalyze phase II conjugation reactions with glucuronic acid, which enhances chemical polarity and the elimination from the body. Few studies have addressed whether Ugt expression and activity are affected by liver disease, such as steatosis. The purpose of this study was to determine whether steatosis induced by obesity or fasting could affect liver Ugt mRNA expression and activity. Male C57BL/6J and Lep(ob/ob) (ob/ob) mice were fed ad libitum or food was withheld for 24 h. In steatotic livers of ob/ob mice, Ugt1a1, -1a6, -1a9, -2a3, -3a1, and -3a2 mRNA expression increased. Fasting, which also induced steatosis, increased hepatic Ugt1a1, -1a6, -1a7, -1a9, -2b1, -2b5, -2a3, -3a1, and -3a2 mRNA expression in mouse liver. Likewise, acetaminophen glucuronidation increased by 47% in hepatic microsomes from ob/ob mice compared with that in C57BL/6J mice, but not after fasting. In both steatosis models, Ugt induction was accompanied by increased aryl hydrocarbon receptor, constitutive androstane receptor (CAR), peroxisome proliferator-activated receptor (PPAR)-α, pregnane X receptor, nuclear factor (erythroid-derived 2)-like 2 (Nrf2), and peroxisome proliferator-activated receptor-γ coactivator-1α mRNA expression. In addition, fasting increased CAR, PPAR, and Nrf2 binding activity. The work points to hepatic triglyceride concentrations corresponding with nuclear receptor and Ugt expression. The findings indicate that steatosis significantly alters hepatic Ugt expression and activity, which could have a significant impact on determining circulating hormone levels, drug efficacy, and environmental chemical clearance.

  11. A comparative genotoxicity study of a supraphysiological dose of triiodothyronine (T₃) in obese rats subjected to either calorie-restricted diet or hyperthyroidism.

    Science.gov (United States)

    De Sibio, Maria Teresa; Luvizotto, Renata Azevedo Melo; Olimpio, Regiane Marques Castro; Corrêa, Camila Renata; Marino, Juliana; de Oliveira, Miriane; Conde, Sandro José; Ferreira, Ana Lúcia dos Anjos; Padovani, Carlos Roberto; Nogueira, Célia Regina

    2013-01-01

    This study was designed to determine the genotoxicity of a supraphysiological dose of triiodothyronine (T3) in both obese and calorie-restricted obese animals. Fifty male Wistar rats were randomly assigned to one of the two following groups: control (C; n = 10) and obese (OB; n = 40). The C group received standard food, whereas the OB group was fed a hypercaloric diet for 20 weeks. After this period, half of the OB animals (n = 20) were subjected to a 25%-calorie restriction of standard diet for 8 weeks forming thus a new group (OR), whereas the remaining OB animals were kept on the initial hypercaloric diet. During the following two weeks, 10 OR animals continued on the calorie restriction diet, whereas the remaining 10 rats of this group formed a new group (ORS) given a supraphysiological dose of T3 (25 µg/100 g body weight) along with the calorie restriction diet. Similarly, the remaining OB animals were divided into two groups, one that continued on the hypercaloric diet (OB, n = 10), and one that received the supraphysiological dose of T3 (25 µg/100 g body weight) along with the hypercaloric diet (OS, n = 10) for two weeks. The OB group showed weight gain, increased adiposity, insulin resistance, increased leptin levels and genotoxicity; T3 administration in OS animals led to an increase in genotoxicity and oxidative stress when compared with the OB group. The OR group showed weight loss and normalized levels of adiposity, insulin resistance, serum leptin and genotoxicity, thus having features similar to those of the C group. On the other hand, the ORS group, compared to OR animals, showed higher genotoxicity. Our results indicate that regardless of diet, a supraphysiological dose of T3 causes genotoxicity and potentiates oxidative stress.

  12. A Comparative Genotoxicity Study of a Supraphysiological Dose of Triiodothyronine (T3) in Obese Rats Subjected to Either Calorie-Restricted Diet or Hyperthyroidism

    Science.gov (United States)

    De Sibio, Maria Teresa; Luvizotto, Renata Azevedo Melo; Olimpio, Regiane Marques Castro; Corrêa, Camila Renata; Marino, Juliana; de Oliveira, Miriane; Conde, Sandro José; Ferreira, Ana Lúcia dos Anjos; Padovani, Carlos Roberto; Nogueira, Célia Regina

    2013-01-01

    This study was designed to determine the genotoxicity of a supraphysiological dose of triiodothyronine (T3) in both obese and calorie-restricted obese animals. Fifty male Wistar rats were randomly assigned to one of the two following groups: control (C; n = 10) and obese (OB; n = 40). The C group received standard food, whereas the OB group was fed a hypercaloric diet for 20 weeks. After this period, half of the OB animals (n = 20) were subjected to a 25%-calorie restriction of standard diet for 8 weeks forming thus a new group (OR), whereas the remaining OB animals were kept on the initial hypercaloric diet. During the following two weeks, 10 OR animals continued on the calorie restriction diet, whereas the remaining 10 rats of this group formed a new group (ORS) given a supraphysiological dose of T3 (25 µg/100 g body weight) along with the calorie restriction diet. Similarly, the remaining OB animals were divided into two groups, one that continued on the hypercaloric diet (OB, n = 10), and one that received the supraphysiological dose of T3 (25 µg/100 g body weight) along with the hypercaloric diet (OS, n = 10) for two weeks. The OB group showed weight gain, increased adiposity, insulin resistance, increased leptin levels and genotoxicity; T3 administration in OS animals led to an increase in genotoxicity and oxidative stress when compared with the OB group. The OR group showed weight loss and normalized levels of adiposity, insulin resistance, serum leptin and genotoxicity, thus having features similar to those of the C group. On the other hand, the ORS group, compared to OR animals, showed higher genotoxicity. Our results indicate that regardless of diet, a supraphysiological dose of T3 causes genotoxicity and potentiates oxidative stress. PMID:23468891

  13. Inhibition of intestinal bile acid transporter Slc10a2 improves triglyceride metabolism and normalizes elevated plasma glucose levels in mice.

    Directory of Open Access Journals (Sweden)

    Thomas Lundåsen

    Full Text Available Interruption of the enterohepatic circulation of bile acids increases cholesterol catabolism, thereby stimulating hepatic cholesterol synthesis from acetate. We hypothesized that such treatment should lower the hepatic acetate pool which may alter triglyceride and glucose metabolism. We explored this using mice deficient of the ileal sodium-dependent BA transporter (Slc10a2 and ob/ob mice treated with a specific inhibitor of Slc10a2. Plasma TG levels were reduced in Slc10a2-deficient mice, and when challenged with a sucrose-rich diet, they displayed a reduced response in hepatic TG production as observed from the mRNA levels of several key enzymes in fatty acid synthesis. This effect was paralleled by a diminished induction of mature sterol regulatory element-binding protein 1c (Srebp1c. Unexpectedly, the SR-diet induced intestinal fibroblast growth factor (FGF 15 mRNA and normalized bile acid synthesis in Slc10a2-/- mice. Pharmacologic inhibition of Slc10a2 in diabetic ob/ob mice reduced serum glucose, insulin and TGs, as well as hepatic mRNA levels of Srebp1c and its target genes. These responses are contrary to those reported following treatment of mice with a bile acid binding resin. Moreover, when key metabolic signal transduction pathways in the liver were investigated, those of Mek1/2-Erk1/2 and Akt were blunted after treatment of ob/ob mice with the Slc10a2 inhibitor. It is concluded that abrogation of Slc10a2 reduces hepatic Srebp1c activity and serum TGs, and in the diabetic ob/ob model it also reduces glucose and insulin levels. Hence, targeting of Slc10a2 may be a promising strategy to treat hypertriglyceridemia and diabetes.

  14. Anti-inflammatory drugs suppress proliferation and induce apoptosis through altering expressions of cell cycle regulators and pro-apoptotic factors in cultured human osteoblasts

    International Nuclear Information System (INIS)

    Chang, J.-K.; Li, C.-J.; Liao, H.-J.; Wang, C.-K.; Wang, G.-J.; Ho, M.-L.

    2009-01-01

    It has been reported that anti-inflammatory drugs (AIDs) inhibited bone repair in animal studies, and suppressed proliferation and induced cell death in rat osteoblast cultures. In this study, we further investigated the molecular mechanisms of AID effects on proliferation and cell death in human osteoblasts (hOBs). We examined the effects of dexamethasone (10 -7 and 10 -6 M), non-selective non-steroidal anti-inflammatory drugs (NSAIDs): indomethacin, ketorolac, piroxicam and diclofenac (10 -5 and 10 -4 M), and COX-2 inhibitor: celecoxib (10 -6 and 10 -5 M) on proliferation, cytotoxicity, cell death, and mRNA and protein levels of cell cycle and apoptosis-related regulators in hOBs. All the tested AIDs significantly inhibited proliferation and arrested cell cycle at G0/G1 phase in hOBs. Celecoxib and dexamethasone, but not non-selective NSAIDs, were found to have cytotoxic effects on hOB, and further demonstrated to induce apoptosis and necrosis (at higher concentration) in hOBs. We further found that indomethacin, celecoxib and dexamethasone increased the mRNA and protein expressions of p27 kip1 and decreased those of cyclin D2 and p-cdk2 in hOBs. Bak expression was increased by celecoxib and dexamethasone, while Bcl-XL level was declined only by dexamethasone. Furthermore, the replenishment of PGE1, PGE2 or PGF2α did not reverse the effects of AIDs on proliferation and expressions of p27 kip1 and cyclin D2 in hOBs. We conclude that the changes in expressions of regulators of cell cycle (p27 kip1 and cyclin D2) and/or apoptosis (Bak and Bcl-XL) by AIDs may contribute to AIDs caused proliferation suppression and apoptosis in hOBs. This effect might not relate to the blockage of prostaglandin synthesis by AIDs

  15. A comparative genotoxicity study of a supraphysiological dose of triiodothyronine (T₃ in obese rats subjected to either calorie-restricted diet or hyperthyroidism.

    Directory of Open Access Journals (Sweden)

    Maria Teresa De Sibio

    Full Text Available This study was designed to determine the genotoxicity of a supraphysiological dose of triiodothyronine (T3 in both obese and calorie-restricted obese animals. Fifty male Wistar rats were randomly assigned to one of the two following groups: control (C; n = 10 and obese (OB; n = 40. The C group received standard food, whereas the OB group was fed a hypercaloric diet for 20 weeks. After this period, half of the OB animals (n = 20 were subjected to a 25%-calorie restriction of standard diet for 8 weeks forming thus a new group (OR, whereas the remaining OB animals were kept on the initial hypercaloric diet. During the following two weeks, 10 OR animals continued on the calorie restriction diet, whereas the remaining 10 rats of this group formed a new group (ORS given a supraphysiological dose of T3 (25 µg/100 g body weight along with the calorie restriction diet. Similarly, the remaining OB animals were divided into two groups, one that continued on the hypercaloric diet (OB, n = 10, and one that received the supraphysiological dose of T3 (25 µg/100 g body weight along with the hypercaloric diet (OS, n = 10 for two weeks. The OB group showed weight gain, increased adiposity, insulin resistance, increased leptin levels and genotoxicity; T3 administration in OS animals led to an increase in genotoxicity and oxidative stress when compared with the OB group. The OR group showed weight loss and normalized levels of adiposity, insulin resistance, serum leptin and genotoxicity, thus having features similar to those of the C group. On the other hand, the ORS group, compared to OR animals, showed higher genotoxicity. Our results indicate that regardless of diet, a supraphysiological dose of T3 causes genotoxicity and potentiates oxidative stress.

  16. Not all sharks are "swimming noses": variation in olfactory bulb size in cartilaginous fishes.

    Science.gov (United States)

    Yopak, Kara E; Lisney, Thomas J; Collin, Shaun P

    2015-03-01

    Olfaction is a universal modality by which all animals sample chemical stimuli from their environment. In cartilaginous fishes, olfaction is critical for various survival tasks including localizing prey, avoiding predators, and chemosensory communication with conspecifics. Little is known, however, about interspecific variation in olfactory capability in these fishes, or whether the relative importance of olfaction in relation to other sensory systems varies with regard to ecological factors, such as habitat and lifestyle. In this study, we have addressed these questions by directly examining interspecific variation in the size of the olfactory bulbs (OB), the region of the brain that receives the primary sensory projections from the olfactory nerve, in 58 species of cartilaginous fishes. Relative OB size was compared among species occupying different ecological niches. Our results show that the OBs maintain a substantial level of allometric independence from the rest of the brain across cartilaginous fishes and that OB size is highly variable among species. These findings are supported by phylogenetic generalized least-squares models, which show that this variability is correlated with ecological niche, particularly habitat. The relatively largest OBs were found in pelagic-coastal/oceanic sharks, especially migratory species such as Carcharodon carcharias and Galeocerdo cuvier. Deep-sea species also possess large OBs, suggesting a greater reliance on olfaction in habitats where vision may be compromised. In contrast, the smallest OBs were found in the majority of reef-associated species, including sharks from the families Carcharhinidae and Hemiscyllidae and dasyatid batoids. These results suggest that there is great variability in the degree to which these fishes rely on olfactory cues. The OBs have been widely used as a neuroanatomical proxy for olfactory capability in vertebrates, and we speculate that differences in olfactory capabilities may be the result of

  17. Hodnotové orientace a ctnosti ve světle pozitivní psychologie

    Directory of Open Access Journals (Sweden)

    Vladimír Smékal

    2017-08-01

    Full Text Available Cílem tohoto sdělení je poukázat na význam hodnot v kontextu občanských ctností, a na jejich souvislost s rozvíjením občanské kultury osobnosti. Studie naznačuje, jak je důležité vytvářet formační projekty spojené s evaluací jejich efektivity, aby se prokázalo, které vývojové a formativní vlivy jsou rozhodující pro utváření občanských ctností jako základu politické a občanské kultury.

  18. The Role of Adult-Born Neurons in the Constantly Changing Olfactory Bulb Network

    Directory of Open Access Journals (Sweden)

    Sarah Malvaut

    2016-01-01

    Full Text Available The adult mammalian brain is remarkably plastic and constantly undergoes structurofunctional modifications in response to environmental stimuli. In many regions plasticity is manifested by modifications in the efficacy of existing synaptic connections or synapse formation and elimination. In a few regions, however, plasticity is brought by the addition of new neurons that integrate into established neuronal networks. This type of neuronal plasticity is particularly prominent in the olfactory bulb (OB where thousands of neuronal progenitors are produced on a daily basis in the subventricular zone (SVZ and migrate along the rostral migratory stream (RMS towards the OB. In the OB, these neuronal precursors differentiate into local interneurons, mature, and functionally integrate into the bulbar network by establishing output synapses with principal neurons. Despite continuous progress, it is still not well understood how normal functioning of the OB is preserved in the constantly remodelling bulbar network and what role adult-born neurons play in odor behaviour. In this review we will discuss different levels of morphofunctional plasticity effected by adult-born neurons and their functional role in the adult OB and also highlight the possibility that different subpopulations of adult-born cells may fulfill distinct functions in the OB neuronal network and odor behaviour.

  19. The Role of Adult-Born Neurons in the Constantly Changing Olfactory Bulb Network

    Science.gov (United States)

    Malvaut, Sarah; Saghatelyan, Armen

    2016-01-01

    The adult mammalian brain is remarkably plastic and constantly undergoes structurofunctional modifications in response to environmental stimuli. In many regions plasticity is manifested by modifications in the efficacy of existing synaptic connections or synapse formation and elimination. In a few regions, however, plasticity is brought by the addition of new neurons that integrate into established neuronal networks. This type of neuronal plasticity is particularly prominent in the olfactory bulb (OB) where thousands of neuronal progenitors are produced on a daily basis in the subventricular zone (SVZ) and migrate along the rostral migratory stream (RMS) towards the OB. In the OB, these neuronal precursors differentiate into local interneurons, mature, and functionally integrate into the bulbar network by establishing output synapses with principal neurons. Despite continuous progress, it is still not well understood how normal functioning of the OB is preserved in the constantly remodelling bulbar network and what role adult-born neurons play in odor behaviour. In this review we will discuss different levels of morphofunctional plasticity effected by adult-born neurons and their functional role in the adult OB and also highlight the possibility that different subpopulations of adult-born cells may fulfill distinct functions in the OB neuronal network and odor behaviour. PMID:26839709

  20. Salivary habituation to food stimuli in successful weight loss maintainers, obese and normal-weight adults

    Science.gov (United States)

    Bond, DS; Raynor, HA; McCaffery, JM; Wing, RR

    2017-01-01

    Objective Research shows that slower habituation of salivary responses to food stimuli is related to greater energy intake and that obese (Ob) individuals habituate slower than those of normal weight (NW). No study has examined habituation rates in weight loss maintainers (WLMs) who have reduced from obese to normal weight, relative to those who are Ob or NW. Design Salivation to two baseline water trials and 10 lemon-flavored lollipop trials were studied in 14 WLMs, 15 Ob and 18 NW individuals comparable in age, gender and ethnicity. Linear mixed models were used to compare WLMs with Ob and NW groups. Results Salivation in the WLM and NW groups decreased significantly (for both P <0.005) across trials, indicative of habituation. Salivary responses in the Ob group did not habituate (P=0.46). When compared with Ob group, WLMs showed a quicker reduction in salivation (P<0.05). WLM and NW groups did not differ in habituation rate (P=0.49). Conclusions WLMs have habituation rates that are comparable to NW individuals without previous history of obesity, and show quicker habituation than those who are currently obese. These results suggest that physiological responses to food may ‘normalize’ with successful weight loss maintenance. PMID:20010900

  1. Association between -308 G/A TNF-α polymorphism and appendicular skeletal muscle mass index as a marker of sarcopenia in normal weight obese syndrome.

    Science.gov (United States)

    Di Renzo, L; Sarlo, F; Petramala, L; Iacopino, L; Monteleone, G; Colica, C; De Lorenzo, A

    2013-01-01

    Normal weight obese (NWO) syndrome is characterized by normal body mass index (BMI), but high amount of fat mass and reduced lean mass. We evaluated allelic frequency of the G/A -308 TNF-α polymorphism and prevalence of sarcopenia in NWO. We enrolled 120 Italian healthy women, distinguished into 3 groups: normal weight (NW); NWO, and preobese-obese (PreOB/OB) and evaluated anthropometric parameters, body composition by dual X-ray absorptiometry, blood tests, and genotyping of G/A -308 TNF-α polymorphism. We found a positive association between sarcopenic obesity and -308 TNF-α polymorphism. All obese women were sarcopenic and were no carrier of mutation (G/G). Among all G/G, NWO showed significant differences in lean mass and total body lean mass (TBLean) with respect to NW and PreOB/OB (P skeletal muscle mass index values, 4.21% of NW were sarcopenic (50% G/G and 50% G/A); the same percentage was observed in NWO subjects (100% G/G). Moreover, 2.10% of PreOB/OB were sarcopenic and all were G/G. Our study suggests that TNF-α polymorphism contributes to sarcopenic obesity susceptibility, in association with body composition. This is the first study that shows the importance of TNF-α polymorphism to determine TBLean variation in NWO syndrome.

  2. Olfactory Bulb Field Potentials and Respiration in Sleep-Wake States of Mice.

    Science.gov (United States)

    Jessberger, Jakob; Zhong, Weiwei; Brankačk, Jurij; Draguhn, Andreas

    2016-01-01

    It is well established that local field potentials (LFP) in the rodent olfactory bulb (OB) follow respiration. This respiration-related rhythm (RR) in OB depends on nasal air flow, indicating that it is conveyed by sensory inputs from the nasal epithelium. Recently RR was found outside the olfactory system, suggesting that it plays a role in organizing distributed network activity. It is therefore important to measure RR and to delineate it from endogenous electrical rhythms like theta which cover similar frequency bands in small rodents. In order to validate such measurements in freely behaving mice, we compared rhythmic LFP in the OB with two respiration-related biophysical parameters: whole-body plethysmography (PG) and nasal temperature (thermocouple; TC). During waking, all three signals reflected respiration with similar reliability. Peak power of RR in OB decreased with increasing respiration rate whereas power of PG increased. During NREM sleep, respiration-related TC signals disappeared and large amplitude slow waves frequently concealed RR in OB. In this situation, PG provided a reliable signal while breathing-related rhythms in TC and OB returned only during microarousals. In summary, local field potentials in the olfactory bulb do reliably reflect respiratory rhythm during wakefulness and REM sleep but not during NREM sleep.

  3. Olfactory Bulb Field Potentials and Respiration in Sleep-Wake States of Mice

    Directory of Open Access Journals (Sweden)

    Jakob Jessberger

    2016-01-01

    Full Text Available It is well established that local field potentials (LFP in the rodent olfactory bulb (OB follow respiration. This respiration-related rhythm (RR in OB depends on nasal air flow, indicating that it is conveyed by sensory inputs from the nasal epithelium. Recently RR was found outside the olfactory system, suggesting that it plays a role in organizing distributed network activity. It is therefore important to measure RR and to delineate it from endogenous electrical rhythms like theta which cover similar frequency bands in small rodents. In order to validate such measurements in freely behaving mice, we compared rhythmic LFP in the OB with two respiration-related biophysical parameters: whole-body plethysmography (PG and nasal temperature (thermocouple; TC. During waking, all three signals reflected respiration with similar reliability. Peak power of RR in OB decreased with increasing respiration rate whereas power of PG increased. During NREM sleep, respiration-related TC signals disappeared and large amplitude slow waves frequently concealed RR in OB. In this situation, PG provided a reliable signal while breathing-related rhythms in TC and OB returned only during microarousals. In summary, local field potentials in the olfactory bulb do reliably reflect respiratory rhythm during wakefulness and REM sleep but not during NREM sleep.

  4. The integral and extrinsic bioactive proteins in the aqueous extracted soybean oil bodies.

    Science.gov (United States)

    Zhao, Luping; Chen, Yeming; Cao, Yanyun; Kong, Xiangzhen; Hua, Yufei

    2013-10-09

    Soybean oil bodies (OBs), naturally pre-emulsified soybean oil, have been examined by many researchers owing to their great potential utilizations in food, cosmetics, pharmaceutical, and other applications requiring stable oil-in-water emulsions. This study was the first time to confirm that lectin, Gly m Bd 28K (Bd 28K, one soybean allergenic protein), Kunitz trypsin inhibitor (KTI), and Bowman-Birk inhibitor (BBI) were not contained in the extracted soybean OBs even by neutral pH aqueous extraction. It was clarified that the well-known Gly m Bd 30K (Bd 30K), another soybean allergenic protein, was strongly bound to soybean OBs through a disulfide bond with 24 kDa oleosin. One steroleosin isoform (41 kDa) and two caleosin isoforms (27 kDa, 29 kDa), the integral bioactive proteins, were confirmed for the first time in soybean OBs, and a considerable amount of calcium, necessary for the biological activities of caleosin, was strongly bound to OBs. Unexpectedly, it was found that 24 kDa and 18 kDa oleosins could be hydrolyzed by an unknown soybean endoprotease in the extracted soybean OBs, which might give some hints for improving the enzyme-assisted aqueous extraction processing of soybean free oil.

  5. [Caloric intake and distribution of the main nutrients in a population of obese children].

    Science.gov (United States)

    Greco, M; Croci, M; Tufano, A; Sassano, G; Panigoni, G; Costa, M; Morricone, L; Longari, V; Mazzocchi, M; Caviezel, F

    1990-01-01

    Calorie intake and the main nutrient contents were assessed in a population of 152 obese (OB) children (86 M; 66 F; age 7-11) and 153 normal weight (NW) peers (87 M; 66 F). The following method was used: a) an interview using a food dictionary to assess food intake during the 2 days prior to the study and on one holiday: and b) a weekly questionnaire. The mean food intake of OB did not exceed that of NW, but on the contrary was lower (OB: 1812.9 +/- 39.6 kcal/die; NW: 1928.5 +/- 39.4 kcal/die; p less than 0.05). The population studied consumed approximately 50% of calories as carbohydrates (CHO), 35% as fats (F) and 15% as protein (P), and no difference was noted between OB and NW. The percentage of CHO was lower than that recommended by LARN, whereas the percentages of F and P were higher. A significant increase with age was noted in F and P intake as was a significant reduction of CO. 70% of OB and 80% of NW matched or exceeded the calorie intake recommended by LARN. 30% of OB and 24% of NW consumed 30% less than the daily calorie intake recommended by LARN.

  6. Olecranon Bursitis in a Military Population: Epidemiology and Evidence for Prolonged Morbidity in Combat Recruits.

    Science.gov (United States)

    Schermann, Haggai; Karakis, Isabella; Dolkart, Oleg; Maman, Eran; Kadar, Assaf; Chechik, Ofir

    2017-09-01

    Olecranon bursitis (OB) is a benign but disturbing condition that may adversely affect a military recruit's combat preparedness. This study was designed to assess incidence, risk factors, and associated medical burden of OB in the Israel Defense Forces. This is a retrospective study drawing on medical records of all Israel Defense Forces soldiers diagnosed as having OB between 2005 and 2015. OB was classified as septic and noninfectious. Crude incidence rates and duty-specific incidence rates were calculated. Medical burden was defined by the number of physician visits, referrals to orthopedic specialist consultations, duration of symptoms, and duration of pharmaceutical treatment. Demographic and occupational information (age, sex, height, weight, socioeconomic status, country of origin, type of military service, time of presentation to medical services) was used to identify risk factors for septic bursitis and longer duration of symptoms. Statistical analysis was performed in R statistical software. Risk factors were evaluated using the Chi-square test for categorical variables and Pearson correlation coefficients were used for continuous variables. The study was approved by the Israeli Defense Force IRB. A total of 2,692 soldiers were diagnosed with OB during the study period. The crude annual incidence rate of OB was 29/100,000 person-years (PY). Combat duty had an incidence of 97/100,000 PY, and noncombat duties had an incidence of 12/10,000 PY (p Origin from the former USSR was associated with a higher duration of symptoms (p = 0.012). Type of military service was the principal risk factor for OB, as indicated by a higher incidence of the disorder among combat compared to noncombat units, possibly the result of field training without protective gear and repetitive trauma to elbows. The greater number of diagnoses of OB during summer and autumn, when training is more intensive, support that explanation. Sex did not affect incidence of OB in administrative

  7. Burst switched optical networks supporting legacy and future service types

    DEFF Research Database (Denmark)

    Franzl, Gerald; Hayat, Faisal; Holynski, Tomasz

    2011-01-01

    Focusing on the principles and the paradigm of OBS an overview addressing expectable performance and application issues is presented. Proposals on OBS were published over a decade and the presented techniques spread into many directions. The paper comprises discussions of several challenges that ...... and found capable to overcome shortcomings of recent proposals. In conclusion, an OBS that offers different connection types may support most client demands within a sole optical network layer....

  8. Comportamento alimentar, compulsão alimentar, história de peso e estilo de vida: diferenças entre pessoas com obesidade e com uma perda de peso bem-sucedida

    OpenAIRE

    Mafalda LEITÃO; Filipa PIMENTA; Teresa de HERÉDIA; Isabel LEAL

    2013-01-01

    Obesity (OB) and successful weight loss (SWL) are associated, among other factors, with eating behaviour. The aim of this study was to explore whether eating behaviour, binge eating, weight history and lifestyle diverge between people with OB and SWL, Methods: In all, 77 participants with OB and 105 who had achieved a SWL filled in the Dutch Eating Behaviour Questionnaire, the Binge Eating Scale and a questionnaire to assess sociodemographic characteristics, weight his...

  9. Leptin as well as Free Leptin Receptor Is Associated with Polycystic Ovary Syndrome in Young Women

    Science.gov (United States)

    Rizk, Nasser M.; Sharif, Elham

    2015-01-01

    Background and Aim. Leptin has two forms in the circulation: free and bound forms. The soluble leptin receptor (sOB-R) circulates in the blood and can bind to leptin. The aim of this study is to assess the concentrations of the leptin and the sOB-R in PCOS and its relation to adiposity, insulin resistance, and androgens. Methods. A cross-sectional study included 78 female students aged 17–25 years. Fasting serum leptin and sOB-R concentrations were measured. The anthropometric variables and the hormonal profile such as insulin, female and male sex hormones, and prolactin were assessed. Results. In PCOS, leptin level (ng/ml) and free leptin index (FLI) increased significantly while sOB-R (ng/ml) significantly decreased compared to control subjects. In age-matched subjects, obese PCOS had increased leptin level in ng/ml (median level with interquartile levels) of 45.67 (41.98–48.04) and decreased sOB-R in ng/ml 11.47 (7.59–16.44) compared to lean PCOS 16.97 (10.60–45.55) for leptin and 16.62 (11.61–17.96) for sOB-R with p values 0.013 and 0.042, respectively. However, body mass index (BMI) is significantly correlated with leptin and s-OBR, while no significant correlations with parameters of insulin resistance were detected. Conclusion. PCOS is associated with hyperleptinemia and increased free leptin index. Decreased sOB-R could be a compensatory mechanism for the defective action of leptin. PMID:26180527

  10. Leptin as well as Free Leptin Receptor Is Associated with Polycystic Ovary Syndrome in Young Women

    Directory of Open Access Journals (Sweden)

    Nasser M. Rizk

    2015-01-01

    Full Text Available Background and Aim. Leptin has two forms in the circulation: free and bound forms. The soluble leptin receptor (sOB-R circulates in the blood and can bind to leptin. The aim of this study is to assess the concentrations of the leptin and the sOB-R in PCOS and its relation to adiposity, insulin resistance, and androgens. Methods. A cross-sectional study included 78 female students aged 17–25 years. Fasting serum leptin and sOB-R concentrations were measured. The anthropometric variables and the hormonal profile such as insulin, female and male sex hormones, and prolactin were assessed. Results. In PCOS, leptin level (ng/ml and free leptin index (FLI increased significantly while sOB-R (ng/ml significantly decreased compared to control subjects. In age-matched subjects, obese PCOS had increased leptin level in ng/ml (median level with interquartile levels of 45.67 (41.98–48.04 and decreased sOB-R in ng/ml 11.47 (7.59–16.44 compared to lean PCOS 16.97 (10.60–45.55 for leptin and 16.62 (11.61–17.96 for sOB-R with p values 0.013 and 0.042, respectively. However, body mass index (BMI is significantly correlated with leptin and s-OBR, while no significant correlations with parameters of insulin resistance were detected. Conclusion. PCOS is associated with hyperleptinemia and increased free leptin index. Decreased sOB-R could be a compensatory mechanism for the defective action of leptin.

  11. Overweight and obesity: overrepresentation in the pediatric reconstructive burn population.

    Science.gov (United States)

    Mayes, Theresa; Gottschlich, Michele M; Allgeier, Chris; Khoury, Jane; Kagan, Richard J

    2010-01-01

    Pediatric burn patients are predisposed to excessive weight gain in the reconstructive period, but the cause is unclear. An overweight (OW) or obese (OB) condition is associated with numerous health risks, decreased physical function, and increased morbidity. The purpose of this study was to compare the frequency of OW status in reconstructive, pediatric burn patients with the prevalence in the US population. The authors reviewed the records of 1533 pediatric patients, >1 year from acute burn, admitted for an elective reconstructive procedure. Body mass index between 85th and 95th percentile, according to the National Center for Health Statistics for 2000 growth charts, was classified as OW, and body mass index >95th percentile was classified as OB. Frequency of OW and OB and racial disparity was calculated as a percentage of total patients and compared with pediatric data from National Health and Nutrition Examination Survey for 1999 to 2006, a nationally representative sample. The rate of OW and OB was 16.3 and 24.1%, respectively, in the authors' pediatric burn population. White patients had OW and OB rates of 15.9 and 23.6%, respectively, compared with 18.2 and 30.2%, respectively, in black patients. All OW and OB rates were outside the 95% confidence interval of the nationally representative National Health and Nutrition Examination Survey population. The rates of OW and OB in pediatric reconstructive burn patients exceed the US population standard across age and race stratifications. The prevention and treatment of excessive weight gain should be a component of rehabilitation in pediatric burns.

  12. Mobile Application Use Among Obstetrics and Gynecology Residents.

    Science.gov (United States)

    Perry, Rachel; Burns, Roshan M; Simon, Rebecca; Youm, Julie

    2017-10-01

    Mobile applications (apps) are increasingly used in clinical settings, particularly among resident physicians. Apps available to patients and physicians are rapidly expanding. We aimed to describe obstetrics and gynecology (ob-gyn) residents' use of and attitudes toward ob-gyn-related mobile apps. We conducted a cross-sectional survey of residents at all 19 California ob-gyn programs using a web-based questionnaire. Responses were analyzed using descriptive and chi-square statistics. Of 386 residents contacted, 197 (51%) completed the survey. All respondents owned mobile devices (100% smartphone, 74% tablet), and 93% used apps in the clinical setting. Commonly used ob-gyn-related apps were pregnancy wheels (84%), cervical cancer screening algorithms (68%), and contraceptive eligibility guidelines (47%). Only 53% of respondents recommended apps to patients, with many reporting not being aware of appropriate apps. Sixty-two percent of respondents used apps for learning, but only 3 ob-gyn-specific apps were mentioned. Most chose apps based on recommendations from other residents. Residents viewed mobile technology as an important clinical tool (92%) that improves efficiency (89%). App use did not differ by gender, age, or postgraduate year. Mobile technology and ob-gyn-related app use are widely used among California ob-gyn residents, who feel that apps enhance their ability to care for patients. Context of app use varies, with most residents using apps during clinical care, but only half recommending apps to patients. Recommendations from other residents are the common resource for discovering new apps, suggesting a need for more formal guidance on finding and evaluating apps.

  13. Prohibitin-induced obesity leads to anovulation and polycystic ovary in mice

    Directory of Open Access Journals (Sweden)

    Sudharsana Rao Ande

    2017-06-01

    Full Text Available Polycystic ovary syndrome (PCOS is a prevalent endocrine disorder and the most common cause of female infertility. However, its etiology and underlying mechanisms remain unclear. Here we report that a transgenic obese mouse (Mito-Ob developed by overexpressing prohibitin in adipocytes develops polycystic ovaries. Initially, the female Mito-Ob mice were equally fertile to their wild-type littermates. The Mito-Ob mice began to gain weight after puberty, became significantly obese between 3-6 months of age, and ∼25% of them had become infertile by 9 months of age. Despite obesity, female Mito-Ob mice maintained glucose homeostasis and insulin sensitivity similar to their wild-type littermates. Mito-Ob mice showed morphologically distinct polycystic ovaries and elevated estradiol, but normal testosterone and insulin levels. Histological analysis of the ovaries showed signs of impaired follicular dynamics, such as preantral follicular arrest and reduced number, or absence, of corpus luteum. The ovaries of the infertile Mito-Ob mice were closely surrounded by periovarian adipose tissue, suggesting a potential role in anovulation. Collectively, these data suggest that elevated estradiol and obesity per se might lead to anovulation and polycystic ovaries independent of hyperinsulinemia and hyperandrogenism. As obesity often coexists with other abnormalities known to be involved in the development of PCOS such as insulin resistance, compensatory hyperinsulinemia and hyperandrogenism, the precise role of these factors in PCOS remains unclear. Mito-Ob mice provide an opportunity to study the effects of obesity on anovulation and ovarian cyst formation independent of the major drivers of obesity-linked PCOS.

  14. Temporal changes in hematologic markers after splenectomy, splenic embolization, and observation for trauma.

    Science.gov (United States)

    Wernick, B; Cipriano, A; Odom, S R; MacBean, U; Mubang, R N; Wojda, T R; Liu, S; Serres, S; Evans, D C; Thomas, P G; Cook, C H; Stawicki, S P

    2017-06-01

    The spleen is one of the most commonly injured abdominal solid organs during blunt trauma. Modern management of splenic trauma has evolved to include non-operative therapies, including observation and angioembolization to preclude splenectomy in most cases of blunt splenic injury. Despite the shift in management strategies, relatively little is known about the hematologic changes associated with these various modalities. The aim of this study was to determine if there are significant differences in hematologic characteristics over time based on the treatment modality employed following splenic trauma. We hypothesized that alterations seen in hematologic parameters would vary between observation (OBS), embolization (EMB), and splenectomy (SPL) in the setting of splenic injury. An institutional review board-approved, retrospective study of routine hematologic indices examined data between March 2000 and December 2014 at three academic trauma centers. A convenience sample of patients with splenic trauma and admission lengths of stay >96 h was selected for inclusion, resulting in a representative sample of each sub-group (OBS, EMB, and SPL). Basic demographics and injury severity data (ISS) were abstracted. Platelet count, red blood cell (RBC) count and RBC indices, and white blood cell (WBC) count with differential were analyzed between the time of admission and a maximum of 1080 h (45 days) post-injury. Comparisons between OBS, EMB, and SPL groups were then performed using non-parametric statistical testing, with statistical significance set at p splenic injury grade varied by interventional modality (grade 4 for SPL, 3 for EMB, and 2 for OBS, p splenic injuries managed with SPL, EMB, or OBS. As expected, observed WBC counts were highest following SPL, then EMB, and finally OBS. No differences were noted in RBC count between the three groups, but RDW was significantly greater following SPL compared to EMB and OBS. We also found that MCV was highest following OBS

  15. Ethical issues identified by obstetrics and gynecology learners through a novel ethics curriculum.

    Science.gov (United States)

    Mejia, Rachel B; Shinkunas, Laura A; Ryan, Ginny L

    2015-12-01

    Obstetrics and gynecology (ob/gyn) is fraught with bioethical issues, the professional significance of which may vary based on clinical experience. Our objective was to utilize our novel ethics curriculum to identify ethics and professionalism issues highlighted by ob/gyn learners and to compare responses between learner levels to further inform curricular development. We introduced an integrated and dynamic ob/gyn ethics and professionalism curriculum and mixed methods analysis of 181 resulting written reflections (case observation and assessments) from third-year medical students and from first- to fourth-year ob/gyn residents. Content was compared by learner level using basic thematic analysis and summary statistics. Within the 7 major ethics and professionalism domains, learners wrote most frequently about miscellaneous ob/gyn issues such as periviability and abortion (22% of students, 20% of residents) and problematic treatment decisions (20% of students, 19% of residents) rather than professional duty, communication, justice, student-/resident-specific issues, or quality of care. The most commonly discussed ob/gyn area by both learner groups was obstetrics rather than gynecology, gynecologic oncology, or reproductive endocrinology and infertility, although residents were more likely to discuss obstetrics-related concerns than students (65% vs 48%; P = .04) and students wrote about gynecologic oncology-related concerns more frequently than residents (25% vs 6%; P = .002). In their reflections, sources of ethical value (eg, the 4 classic ethics principles, professional guidelines, and consequentialism) were cited more frequently and in greater number by students than by residents (82% of students cited at least 1 source of ethical value vs 65% of residents; P = .01). Residents disagreed more frequently with the ethical propriety of clinical management than did students (67% vs 43%; P = .005). Our study introduces an innovative and dynamic approach to an ob

  16. Glucose, insulin and C-peptide secretion in obese and non obese women with polycystic ovarian disease.

    Science.gov (United States)

    Mahabeer, S; Naidoo, C; Joubert, S M

    1990-06-01

    Plasma glucose, immunoreactive insulin (IRI) and C-peptide responses during oral glucose tolerance testing (OGTT) were evaluated in 10 non obese women with polycystic ovarian disease (NOB-PCOD) and 10 obese women with polycystic ovarian disease (OB-PCOD). Mean plasma glucose response at 120 minutes in OB-PCOD showed impaired glucose tolerance. Also in this group, 1 patient had frank diabetes mellitus, whilst 3 other patients had impaired glucose tolerance 1 NOB-PCOD patient had impaired glucose tolerance. Mean plasma glucose levels and mean incremental glucose areas were higher in the OB-PCOD at all time intervals and reached statistical significance at 60 and 90 minutes. Mean plasma IRI levels were also higher in OB-PCOD at all time intervals, and reached statistically significant higher levels at 0, 60 and 90 minutes. Mean serum C-peptide valves were also higher at all time intervals in OB-PCOD. The relationship between acanthosis nigricans, obesity and PCOD was also analysed. It is evident from this study that obesity has a significant negative impact on the overall carbohydrate status in women with PCOD.

  17. Risk factors for mortality caused by hypothalamic obesity in children with hypothalamic tumours.

    Science.gov (United States)

    Haliloglu, B; Atay, Z; Guran, T; Abalı, S; Bas, S; Turan, S; Bereket, A

    2016-10-01

    Hypothalamic obesity (HyOb) is a common complication of childhood hypothalamic tumours. Patients with HyOb probably have a higher mortality rate than those with other types of obesity due in many cases to obstructive sleep apnoea/hypoventilation. To identify predictive factors for mortality caused by HyOb in children. Twenty children with HyOb secondary to hypothalamic tumours that were followed-up for ≥3 years and aged 6 years at diagnosis (3.71 ± 1.96 vs. 0.83 ± 0.73, P  1 SDS after 6 months of therapy (RR: 8.4, P obesity-related mortality rates were higher in the patients aged  0.05). The mortality rate was also 3.7-fold higher in the patients with a maximum BMI SDS ≥ 3 at any time during the first 3 years after therapy(P > 0.05). An increase in BMI SDS after 6 months of therapy was observed to be a risk factor for mortality caused by HyOb. In addition, age obesity is required. © 2015 World Obesity.

  18. The Impact of Oxidative Stress Factors on the Viability, Senescence, and Methylation Status of Olfactory Bulb-Derived Glial Cells Isolated from Human Cadaver Donors.

    Science.gov (United States)

    Marycz, Krzysztof; Kornicka, Katarzyna; Grzesiak, Jakub; Tomaszewski, Krzysztof A; Szarek, Dariusz; Kopacz, Paweł

    2017-01-01

    The olfactory bulb (OB) is a unique structure in the central nervous system that retains the ability to create new neuronal connections. Glial cells isolated from the OB have been recently considered as a novel and promising tool to establish an effective therapy for central nervous system injuries. Due to the hindered access to autologous tissue for cell isolation, an allogeneic source of tissues obtained postmortem has been proposed. In this study, we focused on the morphological and molecular characteristics of human OB-derived glial cells isolated postmortem, at different time points after a donor's death. We evaluated the proliferative activity of the isolated cells, and investigated the ultrastructure of the mitochondria, the accumulation of intracellular reactive oxygen species, and the activity of superoxide dismutase. The data obtained clearly indicate that the duration of ischemia is crucial for the viability/senescence rate of OB-derived glial cells. The OB can be isolated during autopsy and still stand as a source of viable glial cells, but ischemia duration is a major factor limiting its potential usefulness in therapies. © 2017 S. Karger AG, Basel.

  19. Major Pathophysiology in Prediabetes and Type 2 Diabetes: Decreased Insulin in Lean and Insulin Resistance in Obese.

    Science.gov (United States)

    Kabadi, Udaya M

    2017-06-01

    Lowering of body mass index (BMI) to ≥25 kg/m 2 as obesity by ADA suggests insulin resistance as a major mechanism of impaired glucose metabolism (IGM) in Asians. However, glimepiride, an insulin secretagogue, delayed onset of type 2 diabetes (DM2) from prediabetes (PreDM), indicating decreased insulin secretion (IS) as a major factor in lean (L; BMI DM2. Seventy-five men and 45 women ages 36 to 75 years were divided into six groups: LN, LPreDM, LDM2, ObN, ObPreDM, and ObDM2. Determination of IS by insulinogenic indices (I/G) at fasting (FI/FG), first phase (∆I/∆G), and cumulative responses over 2 hours of OGTT (CRI/CRG), and IR by FIXFG, ∆IX∆G, and CRIXCRG. Changes in IS and IR for PreDM and DM2 were calculated as % fall and % rise, respectively, from levels in N. All indices of IS and IR were lower ( P DM2 ( P < 0.05) in both groups. However, the declines in IS were greater ( P < 0.05) than rises in IR in LPreDM and LDM2. Whereas, the rises in IR were higher ( P < 0.05) than declines in IS in ObPreDM and ObDM2. In L, major mechanism of IGM is declining IS and not rising IR documented among Ob.

  20. Predictors of obesity and overweight in preschoolers: The role of parenting styles and feeding practices.

    Science.gov (United States)

    Melis Yavuz, H; Selcuk, Bilge

    2018-01-01

    Childhood obesity/overweight (OB/OW) displayed a rapid increase and high prevalence in the last few decades in preschool-aged children, which raised health concerns across the world and motivated researchers to investigate the factors that underlie childhood obesity. The current study examined parenting styles and child-feeding practices as potential predictors for OB/OW in preschool children, controlling for child's temperament, which has been shown to be linked with OB/OW. The sample included 61 normal weight (NW) and 61 obese/overweight (OB/OW) Turkish pre-schoolers (M age = 62.2 months; SD = 7.64, range = 45-80 months). Parenting styles (authoritarian, authoritative), child-feeding practices (restriction, pressure to eat, monitoring), and child's temperament (negative affectivity) were measured with mothers' reports. Results showed that authoritarian parenting and maternal pressure to eat were the two parenting variables that significantly predicted child's weight status; the odds of being OB/OW was 4.71 times higher in children whose mothers used higher authoritarian parenting style, and was 0.44 times lower when mothers pressured their child to eat. These findings suggest that understanding the unique role of different aspects of parenting in the risk of early OB/OW status of children would be important in developing more effective interventions from early years in life. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Prohibitin-induced, obesity-associated insulin resistance and accompanying low-grade inflammation causes NASH and HCC.

    Science.gov (United States)

    Ande, Sudharsana R; Nguyen, K Hoa; Grégoire Nyomba, B L; Mishra, Suresh

    2016-03-23

    Obesity increases the risk for nonalcoholic steatohepatitis (NASH) and hepatocarcinogenesis. However, the underlying mechanisms involved in the disease process remain unclear. Recently, we have developed a transgenic obese mouse model (Mito-Ob) by prohibitin mediated mitochondrial remodeling in adipocytes. The Mito-Ob mice develop obesity in a sex-neutral manner, but obesity-associated adipose inflammation and metabolic dysregulation in a male sex-specific manner. Here we report that with aging, the male Mito-Ob mice spontaneously develop obesity-linked NASH and hepatocellular carcinoma (HCC). In contrast, the female Mito-Ob mice maintained normal glucose and insulin levels and did not develop NASH and HCC. The anti-inflammatory peptide ghrelin was significantly upregulated in the female mice and down regulated in the male mice compared with respective control mice. In addition, a reduction in the markers of mitochondrial content and function was found in the liver of male Mito-Ob mice with NASH/HCC development. We found that ERK1/2 signaling was significantly upregulated whereas STAT3 signaling was significantly down regulated in the tumors from Mito-Ob mice. These data provide a proof-of-concept that the metabolic and inflammatory status of the adipose tissue and their interplay at the systemic and hepatic level play a central role in the pathogenesis of obesity-linked NASH and HCC.

  2. Association between −308 G/A TNF-α Polymorphism and Appendicular Skeletal Muscle Mass Index as a Marker of Sarcopenia in Normal Weight Obese Syndrome

    Directory of Open Access Journals (Sweden)

    L. Di Renzo

    2013-01-01

    Full Text Available Background and Aim. Normal weight obese (NWO syndrome is characterized by normal body mass index (BMI, but high amount of fat mass and reduced lean mass. We evaluated allelic frequency of the G/A −308 TNF-α polymorphism and prevalence of sarcopenia in NWO. Methods. We enrolled 120 Italian healthy women, distinguished into 3 groups: normal weight (NW; NWO, and preobese-obese (PreOB/OB and evaluated anthropometric parameters, body composition by dual X-ray absorptiometry, blood tests, and genotyping of G/A −308 TNF-α polymorphism. Results. We found a positive association between sarcopenic obesity and −308 TNF-α polymorphism. All obese women were sarcopenic and were no carrier of mutation (G/G. Among all G/G, NWO showed significant differences in lean mass and total body lean mass (TBLean with respect to NW and PreOB/OB (P<0.001. Regarding appendicular skeletal muscle mass index values, 4.21% of NW were sarcopenic (50% G/G and 50% G/A; the same percentage was observed in NWO subjects (100% G/G. Moreover, 2.10% of PreOB/OB were sarcopenic and all were G/G. Conclusion. Our study suggests that TNF-α polymorphism contributes to sarcopenic obesity susceptibility, in association with body composition. This is the first study that shows the importance of TNF-α polymorphism to determine TBLean variation in NWO syndrome.

  3. Effects of body fat on the associations of high-molecular-weight adiponectin, leptin and soluble leptin receptor with metabolic syndrome in Chinese.

    Directory of Open Access Journals (Sweden)

    Danxia Yu

    Full Text Available BACKGROUND: Little is known regarding the associations between high-molecular-weight (HMW- adiponectin, leptin and soluble leptin receptor (sOB-R and metabolic syndrome (MetS in Chinese. Also few studies elucidate the effects of inflammation and body fat mass on the relations. METHODS: Plasma HMW-adiponectin, leptin and sOB-R were measured among 1055 Chinese men and women (35∼54 yrs. Whole body and trunk fat mass were determined by Dual-energy X-ray absorptiometry. MetS was defined by the updated NCEP/ATPIII criterion for Asian-Americans. RESULTS: HMW-adiponectin was inversely associated with MetS in multivariate model including fat mass index (FMI, inflammatory markers, leptin and sOB-R (OR in the highest quartile= 0.30, 95%CI 0.18∼0.50, P<.0001. Plasma sOB-R was also inversely associated with MetS independent of body fatness and inflammatory markers, whereas the association was somewhat attenuated after adjusting HMW-adiponectin (OR for the highest quartile = 0.78, 95%CI 0.47∼1.32, P = 0.15. In contrast, leptin was associated with increased odds of MetS independent of inflammatory markers, HMW-adiponectin, and sOB-R (OR for the highest quartile= 2.64, 95%CI 1.35∼5.18, P = 0.006, although further adjustment for FMI abolished this association. CONCLUSIONS: HMW-adiponectin exhibited strong inverse associations with MetS independent of body composition, inflammation, leptin and sOB-R; while the associations of leptin and sOB-R were largely explained by fat mass or HMW-adiponectin, respectively.

  4. Leptin Is Required for Glucose Homeostasis after Roux-en-Y Gastric Bypass in Mice.

    Directory of Open Access Journals (Sweden)

    Mohamad Mokadem

    Full Text Available Leptin, the protein product of the ob gene, increases energy expenditure and reduces food intake, thereby promoting weight reduction. Leptin also regulates glucose homeostasis and hepatic insulin sensitivity via hypothalamic proopiomelanocortin neurons in mice. Roux-en-Y gastric bypass (RYGB induces weight loss that is substantial and sustained despite reducing plasma leptin levels. In addition, patients who fail to undergo diabetes remission after RYGB are hypoletinemic compared to those who do and to lean controls. We have previously demonstrated that the beneficial effects of RYGB in mice require the melanocortin-4 receptor, a downstream effector of leptin action. Based on these observations, we hypothesized that leptin is required for sustained weight reduction and improved glucose homeostasis observed after RYGB.To investigate this hypothesis, we performed RYGB or sham operations on leptin-deficient ob/ob mice maintained on regular chow. To investigate whether leptin is involved in post-RYGB weight maintenance, we challenged post-surgical mice with high fat diet.RYGB reduced total body weight, fat and lean mass and caused reduction in calorie intake in ob/ob mice. However, it failed to improve glucose tolerance, glucose-stimulated plasma insulin, insulin tolerance, and fasting plasma insulin. High fat diet eliminated the reduction in calorie intake observed after RYGB in ob/ob mice and promoted weight regain, although not to the same extent as in sham-operated mice. We conclude that leptin is required for the effects of RYGB on glucose homeostasis but not body weight or composition in mice. Our data also suggest that leptin may play a role in post-RYGB weight maintenance.

  5. Temporal Profiling and Pulsed SILAC Labeling Identify Novel Secreted Proteins During Ex Vivo Osteoblast Differentiation of Human Stromal Stem Cells*

    Science.gov (United States)

    Kristensen, Lars P.; Chen, Li; Nielsen, Maria Overbeck; Qanie, Diyako W.; Kratchmarova, Irina; Kassem, Moustapha; Andersen, Jens S.

    2012-01-01

    It is well established that bone forming cells (osteoblasts) secrete proteins with autocrine, paracrine, and endocrine function. However, the identity and functional role for the majority of these secreted and differentially expressed proteins during the osteoblast (OB) differentiation process, is not fully established. To address these questions, we quantified the temporal dynamics of the human stromal (mesenchymal, skeletal) stem cell (hMSC) secretome during ex vivo OB differentiation using stable isotope labeling by amino acids in cell culture (SILAC). In addition, we employed pulsed SILAC labeling to distinguish genuine secreted proteins from intracellular contaminants. We identified 466 potentially secreted proteins that were quantified at 5 time-points during 14-days ex vivo OB differentiation including 41 proteins known to be involved in OB functions. Among these, 315 proteins exhibited more than 2-fold up or down-regulation. The pulsed SILAC method revealed a strong correlation between the fraction of isotope labeling and the subset of proteins known to be secreted and involved in OB differentiation. We verified SILAC data using qRT-PCR analysis of 9 identified potential novel regulators of OB differentiation. Furthermore, we studied the biological effects of one of these proteins, the hormone stanniocalcin 2 (STC2) and demonstrated its autocrine effects in enhancing osteoblastic differentiation of hMSC. In conclusion, combining complete and pulsed SILAC labeling facilitated the identification of novel factors produced by hMSC with potential role in OB differentiation. Our study demonstrates that the secretome of osteoblastic cells is more complex than previously reported and supports the emerging evidence that osteoblastic cells secrete proteins with endocrine functions and regulate cellular processes beyond bone formation. PMID:22801418

  6. Fine and gross motor skills differ between healthy-weight and obese children.

    Science.gov (United States)

    Gentier, Ilse; D'Hondt, Eva; Shultz, Sarah; Deforche, Benedicte; Augustijn, Mireille; Hoorne, Sofie; Verlaecke, Katja; De Bourdeaudhuij, Ilse; Lenoir, Matthieu

    2013-11-01

    Within the obesity literature, focus is put on the link between weight status and gross motor skills. However, research on fine motor skills in the obese (OB) childhood population is limited. Therefore, the present study focused on possible weight related differences in gross as well as fine motor skill tasks. Thirty-four OB children (12 ♀ and 22 ♂, aged 7-13 years) were recruited prior to participating in a multidisciplinary treatment program at the Zeepreventorium (De Haan, Belgium). Additionally, a control group of 34 age and gender-matched healthy-weight (HW) children was included in the study. Anthropometric measures were recorded and gross and fine motor skills were assessed using the Bruininks-Oseretsky Test of Motor Proficiency, second edition (BOT-2). Results were analyzed by independent samples t-tests, multivariate analysis of variance, and a chi-squared test. Being OB was detrimental for all subtests evaluating gross motor skill performance (i.e., upper-limb coordination, bilateral coordination, balance, running speed and agility, and strength). Furthermore, OB children performed worse in fine motor precision and a manual dexterity task, when compared to their HW peers. No group differences existed for the fine motor integration task. Our study provides evidence that lower motor competence in OB children is not limited to gross motor skills alone; OB children are also affected by fine motor skill problems. Further investigation is warranted to provide possible explanations for these differences. It is tentatively suggested that OB children experience difficulties with the integration and processing of sensory information. Future research is needed to explore whether this assumption is correct and what the underlying mechanism(s) could be. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. Children of parents with BED have more eating behavior disturbance than children of parents with obesity or healthy weight.

    Science.gov (United States)

    Lydecker, Janet A; Grilo, Carlos M

    2017-06-01

    A limited literature suggests an association between parental eating disorders and child eating-disorder behaviors although this research has focused primarily on restrictive-type eating disorders and very little is known about families with binge-eating disorder (BED). The current study focused on parents (N = 331; 103 fathers and 226 mothers), comparing parents with core features of BED (n = 63) to parents with obesity and no eating disorder (OB; n = 85) and parents with healthy-weight and no eating disorder (HW; n = 183). Parents with BED were significantly more likely than OB and HW parents to report child binge eating, and more likely than HW parents to report child overeating. Parents with BED felt greater responsibility for child feeding than OB parents, and felt more concern about their child's weight than OB and HW parents. Dietary restriction of the child by the parents was related to child binge eating, overeating, and child overweight, and parental group was related to child binge eating (parental BED), overeating (parental BED), and child weight (parental OB). Parents with BED report greater disturbance in their children's eating than OB and HW parents, and OB parents report higher child weight than HW parents. This suggests that it is important to consider both eating-disorder psychopathology and obesity in clinical interventions and research. Our cross-sectional findings, which require experimental and prospective confirmations, provide preliminary evidence suggesting potential factors in families with parental BED and obesity to address in treatment and prevention efforts for pediatric eating disorders and obesity. © 2016 Wiley Periodicals, Inc.(Int J Eat Disord 2017; 50:648-656). © 2016 Wiley Periodicals, Inc.

  8. Obesity-associated insulin resistance is correlated to adipose tissue vascular endothelial growth factors and metalloproteinase levels

    Directory of Open Access Journals (Sweden)

    Tinahones Francisco

    2012-04-01

    Full Text Available Abstract Background The expansion of adipose tissue is linked to the development of its vasculature, which appears to have the potential to regulate the onset of obesity. However, at present, there are no studies highlighting the relationship between human adipose tissue angiogenesis and obesity-associated insulin resistance (IR. Results Our aim was to analyze and compare angiogenic factor expression levels in both subcutaneous (SC and omentum (OM adipose tissues from morbidly obese patients (n = 26 with low (OB/L-IR (healthy obese and high (OB/H-IR degrees of IR, and lean controls (n = 17. Another objective was to examine angiogenic factor correlations with obesity and IR. Here we found that VEGF-A was the isoform with higher expression in both OM and SC adipose tissues, and was up-regulated 3-fold, together with MMP9 in OB/L-IR as compared to leans. This up-regulation decreased by 23% in OB/-H-IR compared to OB/L-IR. On the contrary, VEGF-B, VEGF-C and VEGF-D, together with MMP15 was down-regulated in both OB/H-IR and OB/L-IR compared to lean patients. Moreover, MMP9 correlated positively and VEGF-C, VEGF-D and MMP15 correlated negatively with HOMA-IR, in both SC and OM. Conclusion We hereby propose that the alteration in MMP15, VEGF-B, VEGF-C and VEGF-D gene expression may be caused by one of the relevant adipose tissue processes related to the development of IR, and the up-regulation of VEGF-A in adipose tissue could have a relationship with the prevention of this pathology.

  9. [Prevalence of obesity and arterial hypertension and their relationship with age and gender in the city of Resistencia, Argentina, in the years 2008-2014].

    Science.gov (United States)

    Bianchi, M E V; Cusumano, A M; Torres, C; Rojas, N G; Velasco, G A

    2018-05-17

    Obesity (OB) is a global pandemic, which is associated with arterial hypertension (AH). The differences in this relationship according to gender and age remain unclear. The objectives of this study were to establish the prevalence of OB and AH in an adult population, and to determine the risk of AH associated with OB in relationship to gender and age. A cross-sectional study was performed using the database of successive cross-sectional studies carried out in 5 city squares in Resistencia (Argentina) during the years 2008-2014. The sample was randomised according to gender and age, according to the distribution of the last National Argentine Census. A total of 7,898 passers-by (46.8% males) with a mean age 42.74 ± 16.70 years were included. OB in men increased from 21.3% to 26.9%, and in women from 15.2% to 23%, the former having the highest prevalence between 40-49 years, and the latter between 50-59 years, and thereafter it was always higher in women. AH increased in men from 39.9% to 42.7%, and in women from 25.8% to 29.2%, the former having the highest prevalence between 60-69 years, the latter between 70-79 years. In the 7 years of the study, OB and AH prevalence increased. It was higher in men, although the risk of developing AH associated with OB was greater in older women. The highest prevalence of OB and AH appears a decade earlier in men. Copyright © 2018 SEH-LELHA. Publicado por Elsevier España, S.L.U. All rights reserved.

  10. Demonstration and Validation of a Portable Raman Sensor for In-Situ Detection and Monitoring of Perchlorate (ClO4 )

    Science.gov (United States)

    2017-03-01

    Huntsville in Madison County (Fig. 4.3). The current Redstone Arsenal originated as the Huntsville Arsenal in 1941, a facility built to produce chemical...topographically high ground surrounded by wetlands on three sides. The far northern boundary of the OB/OD Area is adjacent to a creek and wetland area. The...far western boundary of the OB/OD Area is adjacent to wetlands and is approximately 250 feet from a lake located farther to the west. The OB/OD Area

  11. Volksmoeders in die kollig : histories–teoretiese verkenning van die rol van vroue in die Ossewa–Brandwag, 1938 tot 1954 / Blignaut, C

    OpenAIRE

    Blignaut, Charl

    2012-01-01

    The Ossewa–Brandwag (OB) was a unique Afrikaner organisation, swept along by the current ideologies of the late thirties and forties of the twentieth century. Although the history of this organisation was thoroughly recorded there is hardly any material available on the role of women in the OB. The aim of this dissertation is to break the silence surrounding OB women by a historical–theoretical exploration of the agency of Afrikaner women.In this exploration use is made of gender as a categor...

  12. Non-alcoholic fatty pancreas disease pathogenesis: a role for developmental programming and altered circadian rhythms.

    Directory of Open Access Journals (Sweden)

    Rebeca Carter

    Full Text Available OBJECTIVES: Emerging evidence suggests that maternal obesity (MO predisposes offspring to obesity and the recently described non-alcoholic fatty pancreas disease (NAFPD but involved mechanisms remain unclear. Using a pathophysiologically relevant murine model, we here investigated a role for the biological clock--molecular core circadian genes (CCG in the generation of NAFPD. DESIGN: Female C57BL6 mice were fed an obesogenic diet (OD or standard chow (SC for 6 weeks, prior to pregnancy and throughout gestation and lactation: resulting offspring were subsequently weaned onto either OD (Ob_Ob and Con_Ob or standard chow (Ob_Con and Con_Con for 6 months. Biochemical, pro-inflammatory and pro-fibrogenic markers associated with NAFPD were then evaluated and CCG mRNA expression in the pancreas determined. RESULTS: Offspring of obese dams weaned on to OD (Ob_Ob had significantly increased (p≤0.05: bodyweight, pancreatic triglycerides, macrovesicular pancreatic fatty-infiltration, and pancreatic mRNA expression of TNF-α, IL-6, α-SMA, TGF-β and increased collagen compared to offspring of control dams weaned on to control chow (Con_Con. Analyses of CCG expression demonstrated a phase shift in CLOCK (-4.818, p<0.01, REV-ERB-α (-1.4,p<0.05 and Per2 (3.27,p<0.05 in association with decreased amplitude in BMAL-1 (-0.914,p<0.05 and PER2 (1.18,p<0.005 in Ob_Ob compared to Con_Con. 2-way ANOVA revealed significant interaction between MO and post-weaning OD in expression of CLOCK (p<0.005, PER1 (p<0.005 and PER2 (p<0.05 whilst MO alone influenced the observed rhythmic variance in expression of all 5 measured CCG. CONCLUSIONS: Fetal and neonatal exposure to a maternal obesogenic environment interacts with a post-natal hyper-calorific environment to induce offspring NAFPD through mechanisms involving perturbations in CCG expression.

  13. Reorganization of neuronal circuits of the central olfactory system during postprandial sleep

    Directory of Open Access Journals (Sweden)

    Masahiro eYamaguchi

    2013-08-01

    Full Text Available Plastic changes in neuronal circuits often occur in association with specific behavioral states. In this review, we focus on an emerging view that neuronal circuits in the olfactory system are reorganized along the wake-sleep cycle. Olfaction is crucial to sustaining the animals’ life, and odor-guided behaviors have to be newly acquired or updated to successfully cope with a changing odor world. It is therefore likely that neuronal circuits in the olfactory system are highly plastic and undergo repeated reorganization in daily life. A remarkably plastic feature of the olfactory system is that newly generated neurons are continually integrated into neuronal circuits of the olfactory bulb (OB throughout life. New neurons in the OB undergo an extensive selection process, during which many are eliminated by apoptosis for the fine tuning of neuronal circuits. The life and death decision of new neurons occurs extensively during a short time window of sleep after food consumption (postprandial sleep, a typical daily olfactory behavior. We review recent studies that explain how olfactory information is transferred between the OB and the olfactory cortex (OC along the course of the wake-sleep cycle. Olfactory sensory input is effectively transferred from the OB to the OC during waking, while synchronized top-down inputs from the OC to the OB are promoted during the slow-wave sleep. We discuss possible neuronal circuit mechanisms for the selection of new neurons in the OB, which involves the encoding of olfactory sensory inputs and memory trace formation during waking and internally generated activities in the OC and OB during subsequent sleep. The plastic changes in the OB and OC are well coordinated along the course of olfactory behavior during wakefulness and postbehavioral rest and sleep. We therefore propose that the olfactory system provides an excellent model in which to understand behavioral state-dependent plastic mechanisms of the neuronal

  14. Long-term expression of glomerular genes in diabetic nephropathy.

    Science.gov (United States)

    Chittka, Dominik; Banas, Bernhard; Lennartz, Laura; Putz, Franz Josef; Eidenschink, Kathrin; Beck, Sebastian; Stempfl, Thomas; Moehle, Christoph; Reichelt-Wurm, Simone; Banas, Miriam C

    2018-01-11

    Although diabetic nephropathy (DN) is the most common cause for end-stage renal disease in western societies, its pathogenesis still remains largely unclear. A different gene pattern of diabetic and healthy kidney cells is one of the probable explanations. Numerous signalling pathways have emerged as important pathophysiological mechanisms for diabetes-induced renal injury. Glomerular cells, as podocytes or mesangial cells, are predominantly involved in the development of diabetic renal lesions. While many gene assays concerning DN are performed with whole kidney or renal cortex tissue, we isolated glomeruli from black and tan, brachyuric (BTBR) obese/obese (ob/ob) and wildtype mice at four different timepoints (4, 8, 16 and 24 weeks) and performed an mRNA microarray to identify differentially expressed genes (DEGs). In contrast to many other diabetic mouse models, these homozygous ob/ob leptin-deficient mice develop not only a severe type 2 diabetes, but also diabetic kidney injury with all the clinical and especially histologic features defining human DN. By functional enrichment analysis we were able to investigate biological processes and pathways enriched by the DEGs at different disease stages. Altered expression of nine randomly selected genes was confirmed by quantitative polymerase chain reaction from glomerular RNA. Ob/ob type 2 diabetic mice showed up- and downregulation of genes primarily involved in metabolic processes and pathways, including glucose, lipid, fatty acid, retinol and amino acid metabolism. Members of the CYP4A and ApoB family were found among the top abundant genes. But more interestingly, altered gene loci showed enrichment for processes and pathways linked to angioneogenesis, complement cascades, semaphorin pathways, oxidation and reduction processes and renin secretion. The gene profile of BTBR ob/ob type 2 diabetic mice we conducted in this study can help to identify new key players in molecular pathogenesis of diabetic kidney

  15. Modulation of olfactory sensitivity and glucose sensing by the feeding state in obese Zucker rats.

    Directory of Open Access Journals (Sweden)

    Pascaline eAimé

    2014-09-01

    Full Text Available The Zucker fa/fa rat has been widely used as an animal model to study obesity, since it recapitulates most of its behavioral and metabolic dysfunctions, such as hyperphagia, hyperglycemia and insulin resistance. Although it is well established that olfaction is under nutritional and hormonal influences, little is known about the impact of metabolic dysfunctions on olfactory performances and glucose-sensing in the olfactory system of the obese Zucker rat. In the present study, using a behavioral paradigm based on a conditioned olfactory aversion, we have shown that both obese and lean Zucker rats have a better olfactory sensitivity when they are fasted than when they are satiated. Interestingly, the obese Zucker rats displayed a higher olfactory sensitivity than their lean controls. By investigating the molecular mechanisms involved in glucose-sensing in the olfactory system, we demonstrated that sodium-coupled glucose transporters 1 (SGLT1 and insulin dependent glucose transporters 4 (GLUT4 are both expressed in the olfactory bulb (OB. By comparing the expression of GLUT4 and SGLT1 in OB of obese and lean Zucker rats, we found that only SGLT1 is regulated in genotype-dependent manner. Next, we used glucose oxidase biosensors to simultaneously measure in vivo the extracellular fluid glucose concentrations ([Gluc]ECF in the OB and the cortex. Under metabolic steady state, we have determined that the OB contained twice the amount of glucose found in the cortex. In both regions, the [Gluc]ECF was 2 fold higher in obese rats compared to their lean controls. Under induced dynamic glycemia conditions, insulin injection produced a greater decrease of [Gluc]ECF in the OB than in the cortex. Glucose injection did not affect OB [Gluc]ECF in Zucker fa/fa rats. In conclusion, these results emphasize the importance of glucose for the OB network function and provide strong arguments towards establishing the OB glucose-sensing as a key factor for sensory

  16. Vegetation death and rapid loss of surface elevation in two contrasting Mississippi delta salt marshes: The role of sedimentation, autocompaction and sea-level rise

    Science.gov (United States)

    Day, J.W.; Kemp, G.P.; Reed, D.J.; Cahoon, D.R.; Boumans, R.M.; Suhayda, J.M.; Gambrell, R.

    2011-01-01

    From 1990 to 2004, we carried out a study on accretionary dynamics and wetland loss in salt marshes surrounding two small ponds in the Mississippi delta; Old Oyster Bayou (OB), a sediment-rich area near the mouth of the Atchafalaya River and Bayou Chitigue (BC), a sediment-poor area about 70. km to the east. The OB site was stable, while most of the marsh at BC disappeared within a few years. Measurements were made of short-term sedimentation, vertical accretion, change in marsh surface elevation, pond wave activity, and marsh soil characteristics. The OB marsh was about 10. cm higher than BC; the extremes of the elevation range for Spartina alterniflora in Louisiana. Vertical accretion and short-term sedimentation were about twice as high at BC than at OB, but the OB marsh captured nearly all sediments deposited, while the BC marsh captured <30%. The OB and BC sites flooded about 15% and 85% of the time, respectively. Marsh loss at BC was not due to wave erosion. The mineral content of deposited sediments was higher at OB. Exposure and desiccation of the marsh surface at OB increased the efficiency that deposited sediments were incorporated into the marsh soil, and displaced the marsh surface upward by biological processes like root growth, while also reducing shallow compaction. Once vegetation dies, there is a loss of soil volume due to loss of root turgor and oxidation of root organic matter, which leads to elevation collapse. Revegetation cannot occur because of the low elevation and weak soil strength. The changes in elevation at both marsh sites are punctuated, occurring in steps that can either increase or decrease elevation. When a marsh is low as at BC, a step down can result in an irreversible change. At this point, the option is not restoration but creating a new marsh with massive sediment input either from the river or via dredging. ?? 2010 Elsevier B.V.

  17. Who is more likely to be obese or overweight among siblings? A nationally representative study in rural China.

    Directory of Open Access Journals (Sweden)

    Jiajin Hu

    Full Text Available The aims of this study were to determine the association between sibling rank and childhood obesity among children ≤ 5 years of age in rural China, and to investigate the effect of child gender and the obesity status of other siblings on this association.Data from the China Family Panel Studies, a nationally representative survey, was used for the analysis. Sibling rank was defined as the birth order of all children with the same biological mother. A total of 1116 children ≤ 5 years of age were divided into four groups: children without siblings, first-born children, second-born children, and third-born or younger children. For each child, the body mass index and standard deviation (BMI z score was calculated according to WHO standards; children with BMI z scores > 2 were classified as obese or overweight (ObOw. Logistic regression models were used to estimate the association between sibling rank and ObOw status, and the possible influence of gender and ObOw status among other siblings.The second and third-born or younger children had a significantly higher risk of becoming ObOw than children without siblings (odds ratio [OR]: 1.32, 95% confidence interval [CI]: 1.07-1.63 and OR:1.38, 95% CI: 1.17-1.63, respectively. Specifically, female second-born children and male third-born or younger children had a significantly higher risk of ObOw (OR: 1.50, 95% CI: 1.11-2.01 and OR: 1.57, 95% CI: 1.07-2.32, respectively. Having an ObOw sibling increased the probability of being ObOw and the magnitude of the effect was larger if siblings were younger.Sibling rank was shown to be associated with ObOw status among children 0-5 years of age in rural China. Our findings can help healthcare practitioners and authorities to identify children at risk of obesity. Future studies should focus on the mechanisms of this association.

  18. Outcomes Definitions and Statistical Tests in Oncology Studies: A Systematic Review of the Reporting Consistency.

    Science.gov (United States)

    Rivoirard, Romain; Duplay, Vianney; Oriol, Mathieu; Tinquaut, Fabien; Chauvin, Franck; Magne, Nicolas; Bourmaud, Aurelie

    2016-01-01

    Quality of reporting for Randomized Clinical Trials (RCTs) in oncology was analyzed in several systematic reviews, but, in this setting, there is paucity of data for the outcomes definitions and consistency of reporting for statistical tests in RCTs and Observational Studies (OBS). The objective of this review was to describe those two reporting aspects, for OBS and RCTs in oncology. From a list of 19 medical journals, three were retained for analysis, after a random selection: British Medical Journal (BMJ), Annals of Oncology (AoO) and British Journal of Cancer (BJC). All original articles published between March 2009 and March 2014 were screened. Only studies whose main outcome was accompanied by a corresponding statistical test were included in the analysis. Studies based on censored data were excluded. Primary outcome was to assess quality of reporting for description of primary outcome measure in RCTs and of variables of interest in OBS. A logistic regression was performed to identify covariates of studies potentially associated with concordance of tests between Methods and Results parts. 826 studies were included in the review, and 698 were OBS. Variables were described in Methods section for all OBS studies and primary endpoint was clearly detailed in Methods section for 109 RCTs (85.2%). 295 OBS (42.2%) and 43 RCTs (33.6%) had perfect agreement for reported statistical test between Methods and Results parts. In multivariable analysis, variable "number of included patients in study" was associated with test consistency: aOR (adjusted Odds Ratio) for third group compared to first group was equal to: aOR Grp3 = 0.52 [0.31-0.89] (P value = 0.009). Variables in OBS and primary endpoint in RCTs are reported and described with a high frequency. However, statistical tests consistency between methods and Results sections of OBS is not always noted. Therefore, we encourage authors and peer reviewers to verify consistency of statistical tests in oncology studies.

  19. Effect of protocatechuic acid on insulin responsiveness and inflammation in visceral adipose tissue from obese individuals: possible role for PTP1B.

    Science.gov (United States)

    Ormazabal, Paulina; Scazzocchio, Beatrice; Varì, Rosaria; Santangelo, Carmela; D'Archivio, Massimo; Silecchia, Gianfranco; Iacovelli, Annunziata; Giovannini, Claudio; Masella, Roberta

    2018-05-16

    The occurrence of chronic inflammation in visceral adipose tissue (VAT) in obese subjects precipitates the development of insulin resistance and type 2 diabetes (T2D). Anthocyanins and their main metabolite protocatechuic acid (PCA) have been demonstrated to stimulate insulin signaling in human adipocytes. The aim of this study was to investigate whether PCA is able to modulate insulin responsiveness and inflammation in VAT from obese (OB) and normal weight (NW) subjects. VATs obtained from NW and OB subjects were incubated or not (control) with 100 μM PCA for 24 h. After incubation, tissues untreated and treated with PCA were acutely stimulated with insulin (20 nM, 20 min). PTP1B, p65 NF-κB, phospho-p65 NF-κB, IRS-1, IRβ, Akt, GLUT4 as well as basal and insulin-stimulated Tyr-IRS-1 and Ser-Akt phosphorylations were assessed by Western blotting in NW- and OB-VAT. Samples were assessed for PTP1B activity and adipocytokine secretion. PCA restored insulin-induced phosphorylation in OB-VAT by increasing phospho-Tyr-IRS-1 and phospho-Ser-Akt after insulin stimulation as observed in NW-VAT (p < 0.05). PTP1B activity was lower in OB-VAT treated with PCA with respect to untreated (p < 0.05). Compared to non-treated tissues, PCA reduced phospho-p65 NF-κB and IL-6 in OB-VAT, and IL-1β in NW-VAT (p < 0.05); and increased adiponectin secretion in NW-VAT (p < 0.05). PCA restores the insulin responsiveness of OB-VAT by increasing IRS-1 and Akt phosphorylation which could be related with the lower PTP1B activity found in PCA-treated OB-VAT. Furthermore, PCA diminishes inflammation in VAT. These results support the beneficial role of an anthocyanin-rich diet against inflammation and insulin resistance in obesity.

  20. Glucose cycling is markedly enhanced in pancreatic islets of obese hyperglycemic mice

    International Nuclear Information System (INIS)

    Khan, A.; Chandramouli, V.; Ostenson, C.G.; Berggren, P.O.; Loew, H.L.; Landau, B.R.; Efendic, S.

    1990-01-01

    Pancreatic islets from fed 7-month old lean and obese hyperglycemic mice (ob/ob) were incubated with 3H2O and 5.5 mM or 16.7 mM glucose. Incorporation of 3H into the medium glucose was taken as the measure of glucose-6-P hydrolysis to glucose. Glucose utilization was measured from the yield of 3H2O from [5-3H]glucose. Only 3-4% of the glucose phosphorylated was dephosphorylated by the lean mouse islets irrespective of the glucose concentration. In contrast, the ob/ob mouse islets at 5.5 mM glucose dephosphorylated 18% of the glucose phosphorylated and 30% at 16.7 mM. Thus, the islets of hyperglycemic mice demonstrate increased glucose cycling as compared to the islets of normoglycemic lean mice

  1. Optical bistability via quantum interference from incoherent pumping and spontaneous emission

    International Nuclear Information System (INIS)

    Sahrai, M.; Asadpour, S.H.; Sadighi-Bonabi, R.

    2011-01-01

    We theoretically investigate the optical bistability (OB) in a V-type three-level atomic system confined in a unidirectional ring cavity via incoherent pumping field. It is shown that the threshold of optical bistability can be controlled by the rate of an incoherent pumping field and by interference mechanism arising from the spontaneous emission and incoherent pumping field. We demonstrate that the optical bistability converts to optical multi-stability (OM) by the quantum interference mechanism. - Highlights: → We modulate the optical bistability (OB) in a four-level N-type atomic system. → The threshold of optical bistability can be controlled by the quantum interferences. → OB converts to optical multi-stability (OM) by the quantum interferences. → We discuss the effect of an incoherent pumping field on reduction of OB threshold.

  2. Promise(s of mesenchymal stem cells as an in vitro model system to depict pre-diabetic/diabetic milieu in WNIN/GR-Ob mutant rats.

    Directory of Open Access Journals (Sweden)

    Soundarya L Madhira

    Full Text Available BACKGROUND: Development of model systems have helped to a large extent, in bridging gap to understand the mechanism(s of disease including diabetes. Interestingly, WNIN/GR-Ob rats (Mutants, established at National Centre for Laboratory Animals (NCLAS of National Institute of Nutrition (NIN, form a suitable model system to study obesity with Type 2 diabetes (T2D demonstrating several secondary complications (cataract, cardiovascular complications, infertility, nephropathy etc. The present study has been carried out to explore the potent application(s of multipotent stem cells such as bone marrow mesenchymal stem cells (BM-MSCs, to portray features of pre-diabetic/T2D vis-à-vis featuring obesity, with impaired glucose tolerance (IGT, hyperinsulinemia (HI and insulin resistance (IR seen with Mutant rats akin to human situation. METHODOLOGY/PRINCIPAL FINDINGS: Primary cultures of BM-MSCs (third passage from Mutants, its lean littermate (Lean and parental control (Control were characterized for: proliferation markers, disease memory to mark obesity/T2D/HI/IR which included phased gene expression studies for adipogenic/pancreatic lineages, inflammatory markers and differentiation ability to form mature adipocytes/Insulin-like cellular aggregates (ILCAs. The data showed that BM-MSCs from Mutant demonstrated a state of disease memory, depicted by an upregulated expression of inflammatory markers (IL-6, TNFα; increased stem cell recruitment (Oct-4, Sox-2 and proliferation rates (CD90+/CD29+, PDA, 'S' phase of cell cycle by FACS and BrdU incorporation; accelerated preadipocyte induction (Dact-1, PPARγ2 with a quantitative increase in mature adipocyte formation (Leptin; ILCAs, which were non-responsive to high glucose did confer the Obese/T2D memory in Mutants. Further, these observations were in compliance with the anthropometric data. CONCLUSIONS: Given the ease of accessibility and availability of MSCs, the present study form the basis to report for

  3. Obesity and overweight in IMSS female workers in Mexico City Obesidad y sobrepeso en mujeres trabajadoras del IMSS, en la Ciudad de México

    Directory of Open Access Journals (Sweden)

    José Luis Vázquez-Martínez

    2005-07-01

    Full Text Available OBJECTIVE: To estimate the prevalence and risk factors for overweight (OW and obesity (OB in women working at the Mexican Social Security Institute (IMSS, per its abbreviation in Spanish in Mexico City, using two different classification criteria. MATERIAL AND METHODS: A cross-sectional study was performed from July 1999 to September 2000. It included 588 women 20 to 65 years of age and who were working at the IMSS. The criteria used to estimate the prevalence of OW and OB were the WHO criteria and the Mexican Official Norm (NOM for the integrated management of obesity in Mexico. RESULTS: The frequency of OB, according to WHO criteria, was 27.6% (26% adjusted and for OW 43.2% (40.2% adjusted. According to the NOM, the levels of OB in those with short height (1.50 m. Comparison of BMI between the two height groups showed no differences. The risk factor associated with OB and OW was age. Education and exercise were protective factors. CONCLUSIONS: The high prevalences detected in this particular working group highlight the importance of prevention and control of OB in health personnel because it can result in a high number of disability and premature retirement due to disease. The use of the NOM criteria for the identification of women at risk may be useful for early detection of high-risk groups.OBJETIVO: Estimar la prevalencia de obesidad (OB y sobrepeso (SP en mujeres trabajadoras del IMSS en la Ciudad de México, aplicando dos criterios de clasificación y su asociación con algunos factores de riesgo. MATERIAL Y MÉTODOS: Estudio transversal realizado entre julio de 1999 y septiembre de 2000 que incluyó a 588 mujeres trabajadoras en el IMSS entre 20 y 65 años. Los criterios utilizados para medir la prevalencia de OB y SP fueron los propuestos por la OMS y la Norma Oficial Mexicana para el manejo integral de la obesidad (NOM. RESULTADOS: La frecuencia de OB fue 27.6% (26% ajustada y de SP de 43.2% (40.2% ajustada al aplicar los criterios de

  4. Association between A59V polymorphism in exon 3 of leptin gene ...

    African Journals Online (AJOL)

    ONOS

    2010-09-06

    Sep 6, 2010 ... pregnancy (P < 0.01). Animals with the AA genotype had higher length of pregnancy than other ... resistance (Dubuc, 1976). Treatments of the ob/ob ... species, as leptin dose-dependently attenuated insulin- induced steroid ...

  5. RESONANCE--IO--ct-ob-er

    Indian Academy of Sciences (India)

    (masonry or RC) of partial height built to fit a window over the remaining height. The adjacent columns behave as short columns due to presence of these walls. In many cases, other columns in the same storey are of regular height, as there are no walls adjoining them. When the floor slab moves horizontally during an.

  6. Rozum občanství

    Czech Academy of Sciences Publication Activity Database

    Kuneš, Jan

    2004-01-01

    Roč. 15, č. 26 (2004), 1a-3 ISSN 1210-0021 Institutional research plan: CEZ:AV0Z9009908 Keywords : Jean Jacques Rousseau * Immanuel Kant * Georg Wilhelm Friedrich Subject RIV: AA - Philosophy ; Religion

  7. SRXRF analysis of elemental distribution in the olfactory bulbs of rat after intranaris application of manganese chloride

    International Nuclear Information System (INIS)

    He Rui; Wang Xuxia; Lei Hao; Liu Nianqing; Huang Yuying; He Wei

    2005-01-01

    Manganese is a calcium analog, and it can enter activated neurons through voltage-gated calcium channel. Overexposure to manganese often result in its accumulation in the brain, causing symptoms similar to Parkinson's disease One of the routes by which manganese enters brain is the olfactory pathway. In this work, elementary distribution in the olfactory bulbs (OB) of rats after intranaris application of MnCl 2 solution was measured by SRXRF, and the effect of exogenous Mn on the distribution of other elements, particularly calcium, in the OB was also investigated. Four SD male rats were decapitated 9 hrs after intranaris application of MnCl 2 solution (5 μl, 400 mmol/L) in the right nasal cavity. The OB were removed, frozen by liquid nitrogen, cut into 100 m-thick sections with a microtome, and put onto polycarbonate films specially designed for SRXRF examination. It has been shown that unilateral intranaris application of MnCl 2 only results in manganese deposition in the ipsilateral hemisphere of the OB. The left hemisphere of the OB was therefore used as the control. All SRXRF spectra collected with a beam spot size of 60 m x 80 m were normalized to the acquisition time and the counting of the ion chambers, and the contribution from the supporting polycarbonate film was subtracted. The X-ray peak area for each element (A) and the Compton scattering intensity (B) for the whole OB section were obtained. The relative content for each element was taken as the ratio of A to B and analyzed by the SPSS software. The average Mn and Ca contents were found significantly higher in the ipsilateral hemisphere than in the contralateral hemisphere. The Mn content was found to be the highest in the glomerular layer (GL) of the ipsilateral OB hemisphere, consistent with previous findings obtained by magnetic resonance imaging detection. Bivariate correlation analysis showed that the distribution of Mn and Ca in the ipsilateral hemisphere had higher degree of correlation

  8. UDP-Glucuronosyltransferase Expression in Mouse Liver Is Increased in Obesity- and Fasting-Induced Steatosis

    Science.gov (United States)

    Xu, Jialin; Kulkarni, Supriya R.; Li, Liya

    2012-01-01

    UDP-glucuronosyltransferases (Ugt) catalyze phase II conjugation reactions with glucuronic acid, which enhances chemical polarity and the elimination from the body. Few studies have addressed whether Ugt expression and activity are affected by liver disease, such as steatosis. The purpose of this study was to determine whether steatosis induced by obesity or fasting could affect liver Ugt mRNA expression and activity. Male C57BL/6J and Lepob/ob (ob/ob) mice were fed ad libitum or food was withheld for 24 h. In steatotic livers of ob/ob mice, Ugt1a1, -1a6, -1a9, -2a3, -3a1, and -3a2 mRNA expression increased. Fasting, which also induced steatosis, increased hepatic Ugt1a1, -1a6, -1a7, -1a9, -2b1, -2b5, -2a3, -3a1, and -3a2 mRNA expression in mouse liver. Likewise, acetaminophen glucuronidation increased by 47% in hepatic microsomes from ob/ob mice compared with that in C57BL/6J mice, but not after fasting. In both steatosis models, Ugt induction was accompanied by increased aryl hydrocarbon receptor, constitutive androstane receptor (CAR), peroxisome proliferator-activated receptor (PPAR)-α, pregnane X receptor, nuclear factor (erythroid-derived 2)-like 2 (Nrf2), and peroxisome proliferator-activated receptor-γ coactivator-1α mRNA expression. In addition, fasting increased CAR, PPAR, and Nrf2 binding activity. The work points to hepatic triglyceride concentrations corresponding with nuclear receptor and Ugt expression. The findings indicate that steatosis significantly alters hepatic Ugt expression and activity, which could have a significant impact on determining circulating hormone levels, drug efficacy, and environmental chemical clearance. PMID:22031624

  9. Entry into Midgut Epithelial Cells is a Key Step in the Selection of Genotypes in a Nucleopolyhedrovirus

    Institute of Scientific and Technical Information of China (English)

    Gabriel Clavijo; Trevor Williams; Delia Mu(n)oz; Miguel L(o)pez-Ferber; Primitivo Caballero

    2009-01-01

    An isolate of the Spodoptera frugiperda multiple nucleopolyhedrovirus comprises a stable proportion of deletion genotypes (e.g., SfNIC-C), that lack pif1 and pif2 rendering them noninfectious per os, and that survive by complementation with a complete genotype (SfNIC-B) in coinfected cells. To determine whether selection for particular ratios of complete and deletion genotypes occurs mainly during the establishment of the primary infection in insect midgut cells or during subsequent systemic infection, we examined genotype frequencies in insects that fed on OBs comprising different co-occluded mixtures of genotypes. Dramatic changes in genotype frequencies were observed between the OB inoculum and budded virus (BV) samples taken from larvae inoculated with OBs comprising 10% SfNIC-B + 90% SfNIC-C indicating that a marked reduction of SfNIC-C genotype had occurred in the insect midgut due to the immediate elimination of all OBs that originated from cells that had been infected only by SfNIC-C. In contrast, immediate changes were not observed in OBs comprising mixtures of 50% SfNIC-B + 50% SfNIC-C or those comprising 10% SfNIC-B + 90% SfNIC-C as most of the OBs in these mixtures originated from cells that had been infected by both genotypes. Subsequent changes in genotypic frequencies during five days of systemic infection were fairly small in magnitude for all genotypic mixtures. We conclude that the prevalence of defective genotypes in the SfNIC population is likely determined by a balance between host selection against OBs produced in cells infected by SfNIC-C alone and within-host selection for fast-replicating deletion genotypes. The strength of intra-host selection is likely modulated by changes in MOI during the infection period.

  10. Telencephalic organization of the olfactory system in homing pigeons (Columba livia).

    Science.gov (United States)

    Patzke, N; Manns, M; Güntürkün, O

    2011-10-27

    Pigeons use olfactory cues to navigate over unfamiliar areas, and any impairment of the olfactory system generates remarkable reduction of homing performance. Lesion and deprivation studies suggest a critical involvement of the right nostril and thus, the right olfactory bulb (OB) and the left piriform cortex (CPi) for initial orientation. This functional pattern suggests that OB and CPi are asymmetrically connected with a stronger projection from the right OB to the left CPi. However, the structural organization of the olfactory system is not unequivocally clarified yet. Thus, we re-analyzed the system by antero- and retrograde tract tracing with biotinylated dextran amine and choleratoxin subunit B, and we especially evaluated quantitative differences in the number of cells in the OB innervating the left and right CPi. Our anterograde tracing data verified a strong bilateral input to the CPi, and the prepiriform cortex (CPP), as well as small projections to the ipsilateral medial septum and the dorsolateral corticoid area and the nucleus taeniae of the amygdala in both hemispheres. Apart from the bilateral bulbar afferents, CPi in turn receives unequivocal input from the ipsilateral CPP, hyperpallium densocellulare, dorsal arcopallium, and from a cluster of cells located within the frontolateral nidopallium. Thus, an indirect connection between OB and CPi is only mediated by the CPP. For quantitative analysis of bulbar input to the CPi, we counted the number of ipsi- and contralaterally projecting neurons located in the OB after injections into the left or right CPi. Retrogradely labeled cells were found bilaterally in the OB with a higher number of ipsilaterally located cells. The bilaterality index did not differ after left- or right-sided CPi injections indicating that the functional lateralization of the olfactory system is not simply based on differences in the number of projecting axons of the major processing stream. Copyright © 2011 IBRO. Published by

  11. The influence of bisphosphonates on human osteoblast migration and integrin aVb3/tenascin C gene expression in vitro

    Directory of Open Access Journals (Sweden)

    Said Yekta Sareh

    2011-02-01

    Full Text Available Abstract Background Bisphosphonates are therapeutics of bone diseases, such as Paget's disease, multiple myeloma or osteoclastic metastases. As a severe side effect the bisphosphonate induced osteonecrosis of the jaw (BONJ often requires surgical treatment and is accompanied with a disturbed wound healing. Therefore, the influence on adhesion and migration of human osteoblasts (hOB after bisphosphonate therapy has been investigated by morphologic as well as gene expression methods. Methods By a scratch wound experiment, which measures the reduction of defined cell layer gap, the morphology and migration ability of hOB was evaluated. A test group of hOB, which was stimulated by zoledronate 5 × 10-5M, and a control group of unstimulated hOB were applied. Furthermore the gene expression of integrin aVb3 and tenascin C was quantified by Real-Time rtPCR at 5data points over an experimental period of 14 days. The bisphosphonates zoledronate, ibandronate and clodronate have been compared with an unstimulated hOB control. Results After initially identical migration and adhesion characteristics, zoledronate inhibited hOB migration after 50 h of stimulation. The integrinavb3 and tenascin C gene expression was effected by bisphosphonates in a cell line dependent manner with decreased, respectively inconsistent gene expression levels over time. The non-nitrogen containing bisphosphonates clodronate led to decreased gene expression levels. Conclusion Bisphosphonates seem to inhibit hOB adhesion and migration. The integrin aVb3 and tenascin C gene expression seem to be dependent on the cell line. BONJ could be enhanced by an inhibition of osteoblast adhesion and migration. The gene expression results, however, suggest a cell line dependent effect of bisphosphonates, which could explain the interindividual differences of BONJ incidences.

  12. Biofabrication of Zinc Oxide Nanoparticle from Ochradenus baccatus Leaves: Broad-Spectrum Antibiofilm Activity, Protein Binding Studies, and In Vivo Toxicity and Stress Studies

    Directory of Open Access Journals (Sweden)

    Nasser A. Al-Shabib

    2018-01-01

    Full Text Available Biofilms are complex aggregation of cells that are embedded in EPS matrix. These microcolonies are highly resistant to drugs and are associated with various diseases. Biofilms have greatly affected the food safety by causing severe losses due to food contamination and spoilage. Therefore, novel antibiofilm agents are needed. This study investigates the antibiofilm and protein binding activity of zinc nanoparticles (ZnNPs synthesized from leaf extract of Ochradenus baccatus. Standard physical techniques, including UV-visible spectroscopy Fourier transform infrared spectroscopy and X-ray diffraction and transmission electron microscopy, were used to characterize the synthesized OB-ZnNPs. Synthesized OB-ZnNPs demonstrated significant biofilm inhibition in human and food-borne pathogens (Chromobacterium violaceum, Escherichia coli, P. aeruginosa, Klebsiella pneumoniae, Serratia marcescens, and Listeria monocytogenes at subinhibitory concentrations. OB-ZnNPs significantly reduced the virulence factors like violacein, prodigiosin, and alginate and impaired swarming migration and EPS production. OB-ZnNPs demonstrated efficient binding with HSA protein and no change in their structure or stability was observed. In addition, in vivo toxicity evaluation confirmed that OB-ZnNPs possessed no serious toxic effect even at higher doses. Moreover, they were found to have excellent antioxidant properties that can be employed in the fields of food safety and medicine. Hence, it is envisaged that the OB-ZnNPs can be used as potential nanomaterials to combat drug resistant bacterial infections and prevent contamination/spoilage of food.

  13. Inducible Activation of ERK5 MAP Kinase Enhances Adult Neurogenesis in the Olfactory Bulb and Improves Olfactory Function

    Science.gov (United States)

    Wang, Wenbin; Lu, Song; Li, Tan; Pan, Yung-Wei; Zou, Junhui; Abel, Glen M.; Xu, Lihong; Storm, Daniel R.

    2015-01-01

    Recent discoveries have suggested that adult neurogenesis in the subventricular zone (SVZ) and olfactory bulb (OB) may be required for at least some forms of olfactory behavior in mice. However, it is unclear whether conditional and selective enhancement of adult neurogenesis by genetic approaches is sufficient to improve olfactory function under physiological conditions or after injury. Furthermore, specific signaling mechanisms regulating adult neurogenesis in the SVZ/OB are not fully defined. We previously reported that ERK5, a MAP kinase selectively expressed in the neurogenic regions of the adult brain, plays a critical role in adult neurogenesis in the SVZ/OB. Using a site-specific knock-in mouse model, we report here that inducible and targeted activation of the endogenous ERK5 in adult neural stem/progenitor cells enhances adult neurogenesis in the OB by increasing cell survival and neuronal differentiation. This conditional ERK5 activation also improves short-term olfactory memory and odor-cued associative olfactory learning under normal physiological conditions. Furthermore, these mice show enhanced recovery of olfactory function and have more adult-born neurons after a zinc sulfate-induced lesion of the main olfactory epithelium. We conclude that ERK5 MAP kinase is an important endogenous signaling pathway regulating adult neurogenesis in the SVZ/OB, and that conditional activation of endogenous ERK5 is sufficient to enhance adult neurogenesis in the OB thereby improving olfactory function both under normal conditions and after injury. PMID:25995470

  14. The Improvement of Atomita-4 Rice Variety Through Gamma Rays Irradiation of F1 Seeds from Atomita-4/Ir-64 Crossing

    International Nuclear Information System (INIS)

    Lilik Harsanti; Mugiono

    2004-01-01

    Atom ita-4 rice variety was crossed with IR-64 variety in the greenhouse at the Center for Application of Isotopes and Radiation-Batan, Pasar jumat in the wet season of 1994/1995. F 1 Seeds derived from Atomita-4/IR-64 crossing were irradiated by gamma rays at of 0.2 kGy dose. F 1 seeds were grown to obtain F 2 M 2 seed, and then selection of pedigree were carried out at F 2 generation. Six mutants lines were obtained purified and screened on biotypes 1, 2 and 3 brown plant hopper and bacterial leaf blight resistance by IRRI standard screening methods. The six mutant lines were tested for their potential yield at Pusakanegara and then continued tested in yield multi location test at several locations in Indonesia. Results of the screening test to brown plant hopper showed that two mutant lines Obs-1653/PsJ and Obs-1656/PsJ were resistant to biotype 1, biotype 2 and medium resistant to biotype 3. Obs-1653/PsJ and Obs-1656/PsJ also showed resistance to bacterial leaf blight strain 3 and medium resistance to strain 4. Results in the yield multi location test showed that Obs-1653/PsJ and Obs-1656/PsJ have highest yielding potential compared to IR-64 and Memberamo varieties. Those two mutant lines were released as new varieties under the name Merauke and Kahayan in 2001 and 2003 respectively. (author)

  15. Cinnamon extract improves insulin sensitivity in the brain and lowers liver fat in mouse models of obesity.

    Science.gov (United States)

    Sartorius, Tina; Peter, Andreas; Schulz, Nadja; Drescher, Andrea; Bergheim, Ina; Machann, Jürgen; Schick, Fritz; Siegel-Axel, Dorothea; Schürmann, Annette; Weigert, Cora; Häring, Hans-Ulrich; Hennige, Anita M

    2014-01-01

    Treatment of diabetic subjects with cinnamon demonstrated an improvement in blood glucose concentrations and insulin sensitivity but the underlying mechanisms remained unclear. This work intends to elucidate the impact of cinnamon effects on the brain by using isolated astrocytes, and an obese and diabetic mouse model. Cinnamon components (eugenol, cinnamaldehyde) were added to astrocytes and liver cells to measure insulin signaling and glycogen synthesis. Ob/ob mice were supplemented with extract from cinnamomum zeylanicum for 6 weeks and cortical brain activity, locomotion and energy expenditure were evaluated. Insulin action was determined in brain and liver tissues. Treatment of primary astrocytes with eugenol promoted glycogen synthesis, whereas the effect of cinnamaldehyde was attenuated. In terms of brain function in vivo, cinnamon extract improved insulin sensitivity and brain activity in ob/ob mice, and the insulin-stimulated locomotor activity was improved. In addition, fasting blood glucose levels and glucose tolerance were greatly improved in ob/ob mice due to cinnamon extracts, while insulin secretion was unaltered. This corresponded with lower triglyceride and increased liver glycogen content and improved insulin action in liver tissues. In vitro, Fao cells exposed to cinnamon exhibited no change in insulin action. Together, cinnamon extract improved insulin action in the brain as well as brain activity and locomotion. This specific effect may represent an important central feature of cinnamon in improving insulin action in the brain, and mediates metabolic alterations in the periphery to decrease liver fat and improve glucose homeostasis.

  16. Physical Activity and Obesity: Biomechanical and Physiological Key Concepts

    Directory of Open Access Journals (Sweden)

    Julie Nantel

    2011-01-01

    Full Text Available Overweight (OW and obesity (OB are often associated with low levels of physical activity. Physical activity is recommended to reduce excess body weight, prevent body weight regain, and decrease the subsequent risks of developing metabolic and orthopedic conditions. However, the impact of OW and OB on motor function and daily living activities must be taken into account. OW and OB are associated with musculoskeletal structure changes, decreased mobility, modification of the gait pattern, and changes in the absolute and relative energy expenditures for a given activity. While changes in the gait pattern have been reported at the ankle, knee, and hip, modifications at the knee level might be the most challenging for articular integrity. This review of the literature combines concepts and aims to provide insights into the prescription of physical activity for this population. Topics covered include the repercussions of OW and OB on biomechanical and physiological responses associated with the musculoskeletal system and daily physical activity. Special attention is given to the effect of OW and OB in youth during postural (standing and various locomotor (walking, running, and cycling activities.

  17. Low Leptin Availability as a Risk Factor for Dementia in Chilean Older People

    Directory of Open Access Journals (Sweden)

    Cecilia Albala

    2016-07-01

    Full Text Available Objective: The aim was to study the role of leptin in the development of dementia. Methods: Follow-up of the ALEXANDROS cohorts, with baseline measurements in 2000. From 1,136 available subjects free of dementia at baseline, 667 subjects had frozen baseline blood samples for measuring leptin and soluble leptin receptor (sOB-R. The free leptin index (FLI was calculated as the ratio of leptin to sOB-R. Dementia was defined as an MMSE score 5 in the Pfeffer Activities Questionnaire. Results: After 15 years of follow-up, 42 incident cases of dementia were identified. No difference in serum leptin was observed between people with and without dementia, but sOB-R was higher in demented than in nondemented subjects (sOB-R: 44.94 ± 23.97 vs. 33.73 ± 21.13 ng/ml. The adjusted risk for dementia increased, the higher the log sOB (hazard ratio = 3.58; 95% CI 1.72-7.45, p = 0.001. Conclusion: Lower availability of free leptin was found in demented than in nondemented people, suggesting a role of leptin in cognition.

  18. Isoenzymes performance of some rice varieties and their mutants

    International Nuclear Information System (INIS)

    Winarno, Ermin; Suliwarno, Ambyah; Ismachin, M.

    1992-01-01

    Isoenzymes performance of some rice varieties and their mutants. Genetics studies on alcohol dehydrogenase, malic enzyme, peroxidase, acid phosphase, and aminopeptidase isoenzymes were carried out on several groups of rice varieties and their mutant lines. The first groups consisted of Atomita I, Pelita I/1, A227/5, Mudgo, TN-1, and IR-26. The second group was Cisadane variety and its five mutants, namely OBS 18, OBS 208, OBS 297, OBS 306, and OBS 330. The third group was mutants line 627-10-3 and its mutants, namely 1063, 1066, 1067, 1076, and 1090. Isoenzymes extracts of the rice leaves were fractionated using polyacrylamide gel disc electrophoresis. The pattern of acid phosphate isoenzyme shows the specific character of rice mutants susceptible to brown plant hopper biotype 1. The gene(s) controlling malic enzyme in Cisadane's mutants is (are) estimated more resistant toward gamma irradiation than gene(s) responsible for controlling the other enzymes. Generally, the isoenzymes zymograms show that gene(s) controlling the mutants enzyme have undergone mutation. This case is shown by the changes of Rm value, as well as the amount and intensity of mutants bands. (authors). 7 refs., 7 figs

  19. Altered insulin response to an acute bout of exercise in pediatric obesity.

    Science.gov (United States)

    Tran, Brian D; Leu, Szu-Yun; Oliver, Stacy; Graf, Scott; Vigil, Diana; Galassetti, Pietro

    2014-11-01

    Pediatric obesity typically induces insulin resistance, often later evolving into type 2 diabetes. While exercise, enhancing insulin sensitivity, is broadly used to prevent this transition, it is unknown whether alterations in the exercise insulin response pattern occur in obese children. Therefore, we measured exercise insulin responses in 57 healthy weight (NW), 20 overweight (OW), and 56 obese (Ob) children. Blood samples were drawn before and after 30 min of intermittent (2 min on, 1 min off) cycling at ~80% VO2max. In a smaller group (14 NW, 6 OW, 15 Ob), a high-fat meal was ingested 45 min preexercise. Baseline glycemia was similar and increased slightly and similarly in all groups during exercise. Basal insulin (pmol/L) was significantly higher in Ob vs. other groups; postexercise, insulin increased in NW (+7± 3) and OW (+5 ± 8), but decreased in Ob (-15±5, p feeding caused a rapid rise in insulin, promptly corrected by exercise. In Ob, however, insulin rose again 30 min postexercise. Our data indicates a distinct pattern of exercise-induced insulin modulation in pediatric obesity, possibly modulated by basal insulin concentrations.

  20. Gene Expression of Leptin and Long Leptin Receptor Isoform in Endometriosis: A Case-Control Study

    Directory of Open Access Journals (Sweden)

    Andrea Prestes Nácul

    2013-01-01

    Full Text Available In this study, leptin/BMI ratio in serum and peritoneal fluid and gene expression of leptin and long form leptin receptor (OB-RL were assessed in eutopic and ectopic endometria of women with endometriosis and controls. Increased serum leptin/BMI ratio was found in endometriosis patients. Leptin and OB-RL gene expression was significantly higher in ectopic versus eutopic endometrium of patients and controls. A positive, significant correlation was observed between leptin and OB-RL transcripts in ectopic endometria and also in eutopic endometria in endometriosis and control groups. A negative and significant correlation was found between OB-RL mRNA expression and peritoneal fluid leptin/BMI ratio only in endometriosis. These data suggest that, through a modulatory interaction with its active receptor, leptin might play a role in the development of endometrial implants.

  1. Distribution of α-aminoisobutyric acid in tissues of lean and genetically obese mice

    International Nuclear Information System (INIS)

    Tews, J.K.; Harper, A.E.

    1989-01-01

    Distribution of tracer amounts of the nonmetabolizable neutral amino acid α-[1- 14 C]aminoisobutyric acid (AIB) between blood and several tissues was measured in lean and ob/ob mice over an 8-hr period. As AIB was injected on the basis of body weight and as ob/ob mice have a relatively low blood volume, absolute concentrations of AIB in blood and tissues were almost always higher in the obese than the lean mice. However, the ratio of AIB concentration in the tissues to that in the blood was clearly higher in skeletal muscle, diaphragm, and brain, and possibly higher in liver of the lean than of the obese animals. Ratios in heart were similar. The results suggest that lean and genetically obese mice differ in their capacity to transport amino acids between blood and various tissues

  2. Inhibition of Glycosphingolipid Synthesis Induces a Profound Reduction of Plasma Cholesterol and Inhibits Atherosclerosis Development in APOE*3 Leiden and Low-Density Lipoprotein Receptor-/- Mice

    NARCIS (Netherlands)

    Bietrix, Florence; Lombardo, Elisa; van Roomen, Cindy P. A. A.; Ottenhoff, Roelof; Vos, Mariska; Rensen, Patrick C. N.; Verhoeven, Arthur J.; Aerts, Johannes M.; Groen, Albert K.

    Objective-The iminosugar N-(5'-adamantane-1'-yl-methoxy)-pentyl-1-deoxynoijirimycin (AMP-DNM), an inhibitor of the enzyme glucosylceramide synthase catalyzing glycosphingolipid (GSL) biosynthesis, ameliorates diabetes and reduces liver steatosis in ob/ob mice. Because an accumulation of

  3. NCBI nr-aa BLAST: CBRC-LAFR-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0637 ref|ZP_00998487.1| hypothetical protein OB2597_09774 [Oceanicola bats...ensis HTCC2597] gb|EAQ04423.1| hypothetical protein OB2597_09774 [Oceanicola batsensis HTCC2597] ZP_00998487.1 3.3 30% ...

  4. NCBI nr-aa BLAST: CBRC-OANA-01-2186 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2186 ref|ZP_00999244.1| hypothetical protein OB2597_02702 [Oceanicola bats...ensis HTCC2597] gb|EAQ03494.1| hypothetical protein OB2597_02702 [Oceanicola batsensis HTCC2597] ZP_00999244.1 3.9 40% ...

  5. Kharlamova, N. F. Climate Changes over the 20th and 21st Centuries in the Upper Basin of the Ob and Irtysh Rivers (Altai Region)

    Science.gov (United States)

    Fedorovna, K. N., II

    2015-12-01

    The Russian climate is more sensitive to global warming than the climate in many other parts of the world. According to the Second Climate Change National Assessment, since the mid-1970s, the average temperature has been rising with rate of 0.43 ° C / 10 years, which is more than two times higher than the rate of global warming. In the Altai region, the rate of temperature change is higher than the average for Russia with an annual surface air temperature increase equal to 1.8°C the 20th century. The maximum value of this increase the past 50 years (1963-2013) was found in the intermountain basins of Altai (+ 2.6°C) mainly due to the winter and spring warming with changes in the summer season being considerably smaller. This warming is accompanied with negative tendencies in annual precipitation over the entire Altai Krai. The mountain ranges of Altai are called the "water tower" of Northern Eurasia. The northward flow of numerous rivers streaming down from these ranges in the Basin of the Ob and the Irtysh Rivers is formed by melting of Altai glaciers and snowfields. Since the middle of the 19th century the largest glaciers in the Altai have retreated by 1.5-2 km and the thickness of their tails decreased by 50-70 m. The reduction of mountain glaciers poses a threat of depletion of water flow to major agricultural regions downstream affecting human activity and even the drinking water availability. Permafrost in the Altai Mountains is actively degraded (thawing), which represents a danger for infrastructure (first of all for roads and pipelines) and increases risk of catastrophic events (landslides, mudflows). Continued warming could contribute to a significant reduction of water resources, biodiversity and other negative processes in the region.The reported study was partially supported by the Russian Foundation for Baseline Research (project No. 15-45-04450).

  6. Unsustainability of Obesity: Metabolic Food Waste

    Science.gov (United States)

    Serafini, Mauro; Toti, Elisabetta

    2016-01-01

    The obesity burden, with 1.5 billion overweight (OW) and 500 million obese (OB) worldwide, significantly increased the risk of degenerative diseases. Excessive consumption of foods that are energy dense lead to obesity, which represents a titanic cost for not only the world’s health systems but also a substantial ecological cost to the environment. The waste of resources and the unnecessary green house gas emissions (GHGs) emission, due to “obesigen” consumption of foods, have been ignored so far in practical assessments of ecological impacts. Our position is that food eaten above physiological needs, manifesting as obesity, should be considered waste. In this study, we developed a new indicator, metabolic food waste [MFW(kg of food)], corresponding to the amount of food leading to excess body fat and its impact on environment expressed as carbon [MFW(kgCO2eq)], water [MFW(×10 L)], and land footprint [MFW(×10m2)]. Results shows that the average amount of MFW(kg of food) was of 63.1 and 127.2 kg/capita in a observational study on 60 OW and OB subjects. Animal products contributed mostly to MFW(kg of food) in both OW (24.3 kg) and OB (46.5 kg), followed by cereals, legumes and starchy roots (19.4 kg OW; 38.9 kg OB), sugar and sweets (9.0 kg OW; 16.4 kg OB), and alcoholic beverages (7.5 kg OW; 20.1 kg OB). When dietary intake corresponding to MFW was transformed in ecological indexes, animal products displayed the highest values for carbon emissions, water consumption, and land use in both OW and OB followed by cereals, legumes, and starchy roots. The estimated MFW(kg of food) of the Italian population resulted to be 2.081 million kilograms of food for OB and OW. Reducing obesity will make a contribution toward achieving sustainable and functional diets, preserving and re-allocating natural resources for fighting hunger and malnutrition, and reducing GHGs emissions. Although further evidences in epidemiological studies are needed, MFW

  7. Effects of obesity on weight-bearing versus weight-supported exercise testing in patients with COPD.

    Science.gov (United States)

    Maatman, Robbert C; Spruit, Martijn A; van Melick, Paula P; Peeters, Jos P I; Rutten, Erica P A; Vanfleteren, Lowie E G W; Wouters, Emiel F M; Franssen, Frits M E

    2016-04-01

    Obesity is associated with increased dyspnoea and reduced health status in patients with chronic obstructive pulmonary disease (COPD). Studies on the effects of obesity on exercise capacity showed divergent results. The objective of this study is to investigate the impact of obesity on weight-bearing versus weight-supported exercise tolerance in obese and normal weight patients, matched for age, gender and degree of airflow limitation. Retrospective analyses of data obtained during pre-pulmonary rehabilitation assessment in 108 obese COPD patients (OB) (age: 61.2 ± 5.3y, FEV1 : 43.2 ± 7.4%, BMI: 34.1 ± 3.9 kg/m(2) ,) and 108 age and FEV1 -matched normal weight COPD patients (NW) (age: 61.7 ± 3.6y, FEV1 : 41.5 ± 8.4%, BMI: 22.9 ± 1.2 kg/m(2) ,). Cardiopulmonary exercise test (CPET) and 6 min walk test (6MWT) were performed, Borg scores for dyspnoea and leg fatigue were recorded, before and after the tests. Six-minute walk distance differed between OB (398 ± 107 m) and NW patients (446 ± 109 m, P exercise load was comparable (OB: 75 ± 29 W, NW: 70 ± 25 W, ns). Dyspnoea (OB 3.2 ± 2.0 vs NW 3.1 ± 1.7, ns) and leg fatigue (OB 2.4 ± 2.3 vs NW 1.9 ± 1.7, ns) were not significantly different in OB compared with NW after 6MWT, or after CPET (dyspnoea: OB 5.1 ± 2.4 vs NW 5.4 ± 2.2, ns; leg fatigue: OB 4.0 ± 2.3 vs NW 4.0 ± 2.7, ns). In contrast to weight-supported exercise, obesity has a negative impact on weight-bearing exercise capacity, despite comparable exercise-related symptoms. The results of this study enhance the understanding of the impact of obesity on physical performance in COPD. © 2015 Asian Pacific Society of Respirology.

  8. Myocutaneous revascularization following graded ischemia in lean and obese mice

    Directory of Open Access Journals (Sweden)

    Clark RM

    2016-09-01

    Full Text Available Ross M Clark,1 Brittany Coffman,2 Paul G McGuire,3 Thomas R Howdieshell1,3 1Department of Surgery, 2Department of Pathology, 3Department of Cell Biology and Vascular Physiology, University of New Mexico Health Sciences Center, Albuquerque, NM, USA Background: Murine models of diabetes and obesity have provided insight into the pathogenesis of impaired epithelialization of excisional skin wounds. However, knowledge of postischemic myocutaneous revascularization in these models is limited. Materials and methods: A myocutaneous flap was created on the dorsum of wild type (C57BL/6, genetically obese and diabetic (ob/ob, db/db, complementary heterozygous (ob+/ob− , db+/db−, and diet-induced obese (DIO mice (n=48 total; five operative mice per strain and three unoperated mice per strain as controls. Flap perfusion was documented by laser speckle contrast imaging. Local gene expression in control and postoperative flap tissue specimens was determined by quantitative reverse transcription polymerase chain reaction (RT-PCR. Image analysis of immunochemically stained histologic sections confirmed microvascular density and macrophage presence. Results: Day 10 planimetric analysis revealed mean flap surface area necrosis values of 10.8%, 12.9%, 9.9%, 0.4%, 1.4%, and 23.0% for wild type, db+/db−, ob+/ob−, db/db, ob/ob, and DIO flaps, respectively. Over 10 days, laser speckle imaging documented increased perfusion at all time points with revascularization to supranormal perfusion in db/db and ob/ob flaps. In contrast, wild type, heterozygous, and DIO flaps displayed expected graded ischemia with failure of perfusion to return to baseline values. RT-PCR demonstrated statistically significant differences in angiogenic gene expression between lean and obese mice at baseline (unoperated and at day 10. Conclusion: Unexpected increased baseline skin perfusion and augmented myocutaneous revascularization accompanied by a control proangiogenic transcriptional

  9. Annual State of Connecticut Obstetrics and Gynecology Resident Research Day.

    Science.gov (United States)

    Seagle, Brandon-Luke L; Ballard, Jennifer; Kakar, Freshta; Panarelli, Erin; Samuelson, Robert; Shahabi, Shohreh

    2015-01-01

    To increase opportunities for Obstetrics and Gynecology(Ob/Gyn) residents to present their research, an Annual State of Connecticut Ob/Gyn Resident Research Day (RRD) was created. At the first annual RRD, 33 residents, representing five of six Connecticut Ob/Gyn residency programs, presented 39 poster and eight oral presentations. RRD evaluators rated the overall symposium and the quality of resident oral and poster presentations as either "excellent" or "above average." Residency program directors reported that the symposium was "very helpful" for evidencing resident scholarship as required by the Accreditation Council for Graduate Medical Education (ACGME). Surveyed residents reported that the symposium promoted their research and was a valuable investment of their time. An annual specialty-specific, statewide RRD was created, experienced good participation, and was well evaluated. The annual, statewide Ob/Gyn RRD may serve as a model for development of other specialty-specific, statewide RRD events.

  10. Hyperleptinemia Exacerbates High-Fat Diet-Mediated Atrial Fibrosis and Fibrillation.

    Science.gov (United States)

    Fukui, Akira; Ikebe-Ebata, Yuki; Kondo, Hidekazu; Saito, Shotaro; Aoki, Kohei; Fukunaga, Naoya; Shinohara, Tetsuji; Masaki, Takayuki; Teshima, Yasushi; Takahashi, Naohiko

    2017-06-01

    Obesity including metabolic syndrome is an independent risk factor of atrial fibrillation (AF). Although hyperleptinemia is usually a characteristic of obese subjects, the relationship with atrial fibrosis and AF is unknown. We tested the hypothesis that high-fat diet (HFD)-induced hyperleptinemia exacerbates atrial fibrosis and AF. Eight-week-old male C57BL/6 (WT) and leptin-deficient ob/ob (Ob) mice were treated with a normal-fat diet (NFD) or 60% HFD. After 8 weeks, transesophageal burst pacing and electrophysiological study using isolated perfused hearts were performed and left atrial (LA) tissues were collected for histological analysis, hydroxyproline assay, and reverse transcription-polymerase chain reaction. HFD treatment increased body weight in both WT and Ob mice compared with NFD (both P atrial fibrosis and AF. Inhibition of leptin signaling may become a novel therapeutic target to prevent obesity-related AF. © 2017 Wiley Periodicals, Inc.

  11. Metabolic and hepatic effects of liraglutide, obeticholic acid and elafibranor in diet-induced obese mouse models of biopsy-confirmed nonalcoholic steatohepatitis

    DEFF Research Database (Denmark)

    Tølbøl, Kirstine S; Kristiansen, Maria Nb; Hansen, Henrik H

    2018-01-01

    AIM: To evaluate the pharmacodynamics of compounds in clinical development for nonalcoholic steatohepatitis (NASH) in obese mouse models of biopsy-confirmed NASH. METHODS: Male wild-type C57BL/6J mice (DIO-NASH) and Lep ob/ob (ob/ob-NASH) mice were fed a diet high in trans-fat (40%), fructose (20......%) and cholesterol (2%) for 30 and 21 wk, respectively. Prior to treatment, all mice underwent liver biopsy for confirmation and stratification of liver steatosis and fibrosis, using the nonalcoholic fatty liver disease activity score (NAS) and fibrosis staging system. The mice were kept on the diet and received...... by quantitative liver histology, including percent fractional area of liver fat, galectin-3, and collagen 1a1. RESULTS: Liraglutide and elafibranor, but not OCA, reduced body weight in both models. Liraglutide improved steatosis scores in DIO-NASH mice only. Elafibranor and OCA reduced histopathological scores...

  12. Oil bodies as a potential microencapsulation carrier for astaxanthin stabilisation and safe delivery.

    Science.gov (United States)

    Acevedo, Francisca; Rubilar, Mónica; Jofré, Ignacio; Villarroel, Mario; Navarrete, Patricia; Esparza, Magdalena; Romero, Fernando; Vilches, Elías Alberto; Acevedo, Valentina; Shene, Carolina

    2014-01-01

    Astaxanthin (AST) is a valued molecule because of its high antioxidant properties. However, AST is extremely sensitive to oxidation, causing the loss of its bioactive properties. The purposes of this study were to define conditions for microencapsulating AST in oil bodies (OB) from Brassica napus to enhance its oxidative stability, and to test the bioactivity of the microencapsulated AST (AST-M) in cells. Conditions for maximising microencapsulation efficiency (ME) were determined using the Response Surface Methodology, obtaining a high ME (>99%). OB loaded with AST showed a strong electrostatic repulsion in a wide range of pH and ionic strengths. It was found that AST-M exposed to air and light was more stable than free AST. In addition, the protective effect of AST against intracellular ROS production was positively influenced by microencapsulation in OB. These results suggest that OB offer a novel option for stabilising and delivering AST.

  13. Hepatic overexpression of steroid sulfatase ameliorates mouse models of obesity and type 2 diabetes through sex-specific mechanisms.

    Science.gov (United States)

    Jiang, Mengxi; He, Jinhan; Kucera, Heidi; Gaikwad, Nilesh W; Zhang, Bin; Xu, Meishu; O'Doherty, Robert M; Selcer, Kyle W; Xie, Wen

    2014-03-21

    The steroid sulfatase (STS)-mediated desulfation is a critical metabolic mechanism that regulates the chemical and functional homeostasis of endogenous and exogenous molecules. In this report, we first showed that the liver expression of Sts was induced in both the high fat diet (HFD) and ob/ob models of obesity and type 2 diabetes and during the fed to fasting transition. In defining the functional relevance of STS induction in metabolic disease, we showed that overexpression of STS in the liver of transgenic mice alleviated HFD and ob/ob models of obesity and type 2 diabetes, including reduced body weight, improved insulin sensitivity, and decreased hepatic steatosis and inflammation. Interestingly, STS exerted its metabolic benefit through sex-specific mechanisms. In female mice, STS may have increased hepatic estrogen activity by converting biologically inactive estrogen sulfates to active estrogens and consequently improved the metabolic functions, whereas ovariectomy abolished this protective effect. In contrast, the metabolic benefit of STS in males may have been accounted for by the male-specific decrease of inflammation in white adipose tissue and skeletal muscle as well as a pattern of skeletal muscle gene expression that favors energy expenditure. The metabolic benefit in male STS transgenic mice was retained after castration. Treatment with the STS substrate estrone sulfate also improved metabolic functions in both the HFD and ob/ob models. Our results have uncovered a novel function of STS in energy metabolism and type 2 diabetes. Liver-specific STS induction or estrogen/estrogen sulfate delivery may represent a novel approach to manage metabolic syndrome.

  14. Learning, memory and hippocampal LTP in genetically obese rodents

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    We have found that leptin, at physiological concentrations of 10-12 mol/L, facilitates learning and memory and LTP maintenance in Wistar rats. To explore the role of leptin recepors in learning, memory and synaptic plasticity, experiments were carried out using Zucker rats (Z), db/db mice (db), and ob/ob mice(ob). The former two have defects in leptin receptors and the latter cannot produce normal leptin. Unlike the effects observed in normal rats, high or low frequency stimulation of Schaffer collateral-CA1 synapses in hippocampal slices prepared from Z, db and ob animals failed to induce the learning and memory relevant long-term potentiation or depression in CA1 neurons. However, LTP in ob CA1 synapses was facilitated by leptin at 10-12 mol/L concentration. Moreover, the paired-pulse facilitation of CA1 synaptic potentials and intracellularly recorded postsynaptic responses to the neurotransmitters AMPA, NMDA and GABA, applied electrophoretically to the apical dendrites of CA1 neurons, were approximately the same compared to the control lean animals. In addition, unlike the second messenger responses observed in Wistar rats, calmodulin kinase Ⅱ activity in the CA1 area of Z and db animals was not activated after tetanic stimulation of the Schaffer collaterals. It has been shown that all three strains, Z, db and ob display impaired spatial learning and memory when tested in the Morris water maze. The results of these experiments indicate a close relationship between spatial learning and memory, facilitation of LTP, and calmodulin kinase Ⅱ activity.

  15. Modifying Provider Practice To Improve Assessment of Unhealthy Weight and Lifestyle in Young Children: Translating Evidence in a Quality Improvement Initiative for At-Risk Children.

    Science.gov (United States)

    Camp, Nadine L; Robert, Rebecca C; Nash, Jessica E; Lichtenstein, Cara B; Dawes, Candice S; Kelly, Katherine Patterson

    2017-06-01

    We designed a quality improvement (QI) project to address the high prevalence of childhood overweight and obesity (OW/OB) in our patient population and the inconsistencies among primary care providers in recognizing and addressing OW/OB. We used mixed methods data collection approach to evaluate a QI project, the Childhood Healthy Behaviors Intervention (CHBI), to improve provider obesity prevention practice in two low-income, predominantly African American pediatric primary care clinics. Electronic record data were extracted from all 2-9 year well visits pre- and postintervention for frequency of appropriate diagnostic coding of OW/OB. We reviewed a random sample of records for details of health habit assessment and counseling documentation. Focused interviews were conducted to elicit provider responses regarding impressions of the intervention. The preintervention sample of records (n = 267) was extracted from 18 providers and the postsample (n = 253) from 19 providers. Providers showed improvement in the recognition of OW/OB with appropriate diagnostic coding (52% pre, 68% post), improvement in assessment of health habits informed by the habit survey (0% pre, 76% post), improvement in counseling of healthy behaviors (86% pre, 92% post), and improvement in goal setting of healthy behaviors (12% pre, 70% post). Our findings suggest that implementing a time efficient primary care intervention with brief provider training can improve provider recognition of OW/OB, as well as improve provider behavior targeted at childhood obesity prevention. This project contributes needed QI evidence on interventions to prevent and address OW/OB in primary care settings and calls for further work to strengthen implementation in similar contexts.

  16. Inducible activation of ERK5 MAP kinase enhances adult neurogenesis in the olfactory bulb and improves olfactory function.

    Science.gov (United States)

    Wang, Wenbin; Lu, Song; Li, Tan; Pan, Yung-Wei; Zou, Junhui; Abel, Glen M; Xu, Lihong; Storm, Daniel R; Xia, Zhengui

    2015-05-20

    Recent discoveries have suggested that adult neurogenesis in the subventricular zone (SVZ) and olfactory bulb (OB) may be required for at least some forms of olfactory behavior in mice. However, it is unclear whether conditional and selective enhancement of adult neurogenesis by genetic approaches is sufficient to improve olfactory function under physiological conditions or after injury. Furthermore, specific signaling mechanisms regulating adult neurogenesis in the SVZ/OB are not fully defined. We previously reported that ERK5, a MAP kinase selectively expressed in the neurogenic regions of the adult brain, plays a critical role in adult neurogenesis in the SVZ/OB. Using a site-specific knock-in mouse model, we report here that inducible and targeted activation of the endogenous ERK5 in adult neural stem/progenitor cells enhances adult neurogenesis in the OB by increasing cell survival and neuronal differentiation. This conditional ERK5 activation also improves short-term olfactory memory and odor-cued associative olfactory learning under normal physiological conditions. Furthermore, these mice show enhanced recovery of olfactory function and have more adult-born neurons after a zinc sulfate-induced lesion of the main olfactory epithelium. We conclude that ERK5 MAP kinase is an important endogenous signaling pathway regulating adult neurogenesis in the SVZ/OB, and that conditional activation of endogenous ERK5 is sufficient to enhance adult neurogenesis in the OB thereby improving olfactory function both under normal conditions and after injury. Copyright © 2015 the authors 0270-6474/15/357833-17$15.00/0.

  17. Increased risk of cataract development in WNIN-obese rats due to accumulation of intralenticular sorbitol.

    Science.gov (United States)

    Reddy, Paduru Yadagiri; Giridharan, Nappan Veettil; Balakrishna, Nagalla; Validandi, Vakdevi; Pullakhandam, Raghu; Reddy, Geereddy Bhanuprakash

    2013-05-01

    Epidemiological studies have reported an association between obesity and increased incidence of ocular complications including cataract, yet the underlying biochemical and molecular mechanisms remained unclear. Previously we had demonstrated accumulation of sorbitol in the lens of obese rats (WNIN/Ob) and more so in a related strain with impaired glucose tolerance (WNIN/GR-Ob). However, only a few (15-20%) WNIN/Ob and WNIN/GR-Ob rats develop cataracts spontaneously with age. To gain further insights, we investigated the susceptibility of eye lens proteins of these obese rat strains to heat- and UV-induced aggregation in vitro, lens opacification upon glucose-mediated sorbitol accumulation ex vivo, and onset and progression of cataract was followed by galactose feeding and streptozotocin (STZ) injection. The results indicated increased susceptibility toward heat- or UV-induced aggregation of lens proteins in obese animals compared to their littermate lean controls. Further, in organ culture studies glucose-induced sorbitol accumulation was found to be higher and thus the lens opacification was faster in obese animals compared to their lean littermates. Also, the onset and progression of galactose- or STZ-induced cataractogenesis was faster in obese animals compared to lean control. These results together with our previous observations suggest that obesity status could lead to hyperaccumulation of sorbitol in eye lens, predisposing them to cataract, primarily by increasing their susceptibility to environmental and/or physiological factors. Further, intralenticular sorbitol accumulation beyond a threshold level could lead to cataract in WNIN/Ob and WNIN/GR-Ob rats. Copyright © 2013 International Union of Biochemistry and Molecular Biology, Inc.

  18. Chronic Blockade of Brain Endothelin Receptor Type-A (ETA Reduces Blood Pressure and Prevents Catecholaminergic Overactivity in the Right Olfactory Bulb of DOCA-Salt Hypertensive Rats

    Directory of Open Access Journals (Sweden)

    Luis R. Cassinotti

    2018-02-01

    Full Text Available Overactivity of the sympathetic nervous system and central endothelins (ETs are involved in the development of hypertension. Besides the well-known brain structures involved in the regulation of blood pressure like the hypothalamus or locus coeruleus, evidence suggests that the olfactory bulb (OB also modulates cardiovascular function. In the present study, we evaluated the interaction between the endothelinergic and catecholaminergic systems in the OB of deoxycorticosterone acetate (DOCA-salt hypertensive rats. Following brain ET receptor type A (ETA blockade by BQ610 (selective antagonist, transcriptional, traductional, and post-traductional changes in tyrosine hydroxylase (TH were assessed in the OB of normotensive and DOCA-salt hypertensive rats. Time course variations in systolic blood pressure and heart rate were also registered. Results showed that ETA blockade dose dependently reduced blood pressure in hypertensive rats, but it did not change heart rate. It also prevented the increase in TH activity and expression (mRNA and protein in the right OB of hypertensive animals. However, ETA blockade did not affect hemodynamics or TH in normotensive animals. Present results support that brain ETA are not involved in blood pressure regulation in normal rats, but they significantly contribute to chronic blood pressure elevation in hypertensive animals. Changes in TH activity and expression were observed in the right but not in the left OB, supporting functional asymmetry, in line with previous studies regarding cardiovascular regulation. Present findings provide further evidence on the role of ETs in the regulation of catecholaminergic activity and the contribution of the right OB to DOCA-salt hypertension.

  19. Augmented Rac1 Expression and Activity are Associated with Oxidative Stress and Decline of β Cell Function in Obesity.

    Science.gov (United States)

    Zhou, Shutong; Yu, Dongni; Ning, Shangyong; Zhang, Heli; Jiang, Lei; He, Lei; Li, Miao; Sun, Mingxiao

    2015-01-01

    The aim of this study was to clarify the relationship among Rac1 expression and activation, oxidative stress and β cell dysfunction in obesity. In vivo, serum levels of glucose, insulin, oxidative stress markers and Rac1 expression were compared between ob/ob mice and C57BL/6J controls. Then, these variables were rechecked after the administration of the specific Rac1 inhibitor-NSC23766 in ob/ob mice. In vitro, NIT-1 β cells were cultured in a hyperglycemic and/or hyperlipidemic state with or without NSC23766, and the differences of Rac1 expression and translocation, NADPH oxidase(Nox) enzyme activity, reactive oxygen species (ROS) and insulin mRNA were observed. ob/ob mice displayed abnormal glycometabolism, oxidative stress and excessive expression of Rac1 in the pancreas. NSC23766 injection inhibited the expression of Rac1 in the pancreas, along with amelioration of oxidative stress and glycometabolism in obese mice. Under hyperglycemic and/or hyperlipidemic conditions, Rac1 translocated to the cellular membrane, induced activation of the NADPH oxidase enzyme and oxidative stress, and simultaneously reduced the insulin mRNA expression in NIT-1 β cells. Inhibiting Rac1 activity could alleviate oxidative stress and meliorate the decline of insulin mRNA in β cells. Rac1 might contribute to oxidative stress systemically and locally in the pancreas in obesity. The excessive activation and expression of Rac1 in obesity were associated with β cell dysfunction through ROS production. © 2015 S. Karger AG, Basel.

  20. Overweight and obesity in Mexican children and adolescents during the last 25 years.

    Science.gov (United States)

    Hernández-Cordero, S; Cuevas-Nasu, L; Morán-Ruán, M C; Méndez-Gómez Humarán, I; Ávila-Arcos, M A; Rivera-Dommarco, J A

    2017-03-13

    The objective of the study was to provide current estimates of the prevalence and trends of overweight and obesity (OW+OB) in Mexican children and adolescents. Body mass index objectively measured was analyzed for 37 147 children and adolescents aged 0-19 years obtained in 2012 as part of the National Health and Nutrition Survey (ENSANUT-2012), a nationally representative sample of the Mexican population. In addition, data from previous National Nutrition Surveys obtained in 1988, 1999 and 2006 were compared with analyze trends over a 24-year period (1988-2012) for children children. World Health Organization Child Growth Standard was used to define OW+OB. In 2012, 33.5% of children overweight or were overweight (OW); 32% and 36.9% of girls and boys 5-11 years of age were OW+OB, respectively, and 35.8% and 34.1% of female and male adolescents were OW+OB, respectively. Statistically significant trends were documented for all age groups during the study period. Overall change in the combined prevalence in preschool children was 6.3±1.0 percentage points (pp; Pchildren and adolescents in the lowest quintile of the household living condition index. Prevalence of OW+OB among children and adolescents increased significantly during the last 13-24 years. The rate of increase has declined in the last 6 years in all age groups. Changes in prevalence of OW+OB presented here suggest that, in Mexico, the burden of obesity is shifting toward the groups with lower socioeconomic level.