Harvey, E.; Redman, M. P.; Boumis, P.; Akras, S.
2016-10-01
Aims: The shaping mechanisms of old nova remnants are probes for several important and unexplained processes, such as dust formation and the structure of evolved star nebulae. To gain a more complete understanding of the dynamics of the GK Per (1901) remnant, an examination of symmetry of the nova shell is explored, followed by a kinematical analysis of the previously detected jet-like feature in the context of the surrounding fossil planetary nebula. Methods: Faint-object high-resolution echelle spectroscopic observations and imaging were undertaken covering the knots which comprise the nova shell and the surrounding nebulosity. New imaging from the Aristarchos telescope in Greece and long-slit spectra from the Manchester Echelle Spectrometer instrument at the San Pedro Mártir observatory in Mexico were obtained, supplemented with archival observations from several other optical telescopes. Position-velocity arrays are produced of the shell, and also individual knots, and are then used for morpho-kinematic modelling with the shape code. The overall structure of the old knotty nova shell of GK Per and the planetary nebula in which it is embedded is then analysed. Results: Evidence is found for the interaction of knots with each other and with a wind component, most likely the periodic fast wind emanating from the central binary system. We find that a cylindrical shell with a lower velocity polar structure gives the best model fit to the spectroscopy and imaging. We show in this work that the previously seen jet-like feature is of low velocity. Conclusions: The individual knots have irregular tail shapes; we propose here that they emanate from episodic winds from ongoing dwarf nova outbursts by the central system. The nova shell is cylindrical, not spherical, and the symmetry axis relates to the inclination of the central binary system. Furthermore, the cylinder axis is aligned with the long axis of the bipolar planetary nebula in which it is embedded. Thus, the
AT Cnc: A SECOND DWARF NOVA WITH A CLASSICAL NOVA SHELL
International Nuclear Information System (INIS)
Shara, Michael M.; Mizusawa, Trisha; Zurek, David; Wehinger, Peter; Martin, Christopher D.; Neill, James D.; Forster, Karl; Seibert, Mark
2012-01-01
We are systematically surveying all known and suspected Z Cam-type dwarf novae for classical nova shells. This survey is motivated by the discovery of the largest known classical nova shell, which surrounds the archetypal dwarf nova Z Camelopardalis. The Z Cam shell demonstrates that at least some dwarf novae must have undergone classical nova eruptions in the past, and that at least some classical novae become dwarf novae long after their nova thermonuclear outbursts, in accord with the hibernation scenario of cataclysmic binaries. Here we report the detection of a fragmented 'shell', 3 arcmin in diameter, surrounding the dwarf nova AT Cancri. This second discovery demonstrates that nova shells surrounding Z Cam-type dwarf novae cannot be very rare. The shell geometry is suggestive of bipolar, conical ejection seen nearly pole-on. A spectrum of the brightest AT Cnc shell knot is similar to that of the ejecta of the classical nova GK Per, and of Z Cam, dominated by [N II] emission. Galaxy Evolution Explorer FUV imagery reveals a similar-sized, FUV-emitting shell. We determine a distance of 460 pc to AT Cnc, and an upper limit to its ejecta mass of ∼5 × 10 –5 M ☉ , typical of classical novae.
AT Cnc: A SECOND DWARF NOVA WITH A CLASSICAL NOVA SHELL
Energy Technology Data Exchange (ETDEWEB)
Shara, Michael M.; Mizusawa, Trisha; Zurek, David [Department of Astrophysics, American Museum of Natural History, Central Park West at 79th Street, New York, NY 10024-5192 (United States); Wehinger, Peter [Steward Observatory, the University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Martin, Christopher D.; Neill, James D.; Forster, Karl [Department of Physics, Math and Astronomy, California Institute of Technology, 1200 East California Boulevard, Mail Code 405-47, Pasadena, CA 91125 (United States); Seibert, Mark [Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States)
2012-10-20
We are systematically surveying all known and suspected Z Cam-type dwarf novae for classical nova shells. This survey is motivated by the discovery of the largest known classical nova shell, which surrounds the archetypal dwarf nova Z Camelopardalis. The Z Cam shell demonstrates that at least some dwarf novae must have undergone classical nova eruptions in the past, and that at least some classical novae become dwarf novae long after their nova thermonuclear outbursts, in accord with the hibernation scenario of cataclysmic binaries. Here we report the detection of a fragmented 'shell', 3 arcmin in diameter, surrounding the dwarf nova AT Cancri. This second discovery demonstrates that nova shells surrounding Z Cam-type dwarf novae cannot be very rare. The shell geometry is suggestive of bipolar, conical ejection seen nearly pole-on. A spectrum of the brightest AT Cnc shell knot is similar to that of the ejecta of the classical nova GK Per, and of Z Cam, dominated by [N II] emission. Galaxy Evolution Explorer FUV imagery reveals a similar-sized, FUV-emitting shell. We determine a distance of 460 pc to AT Cnc, and an upper limit to its ejecta mass of {approx}5 Multiplication-Sign 10{sup -5} M {sub Sun }, typical of classical novae.
Typical examples of classical novae
Hack, Margherita; Selvelli, Pierluigi; Bianchini, Antonio; Duerbeck, Hilmar W.
1993-09-01
Because of the very complicated individualistic behavior of each nova, we think it necessary to review the observations of a few well-observed individuals. We have selected a few objects of different speed classes, which have been extensively observed. They are: V1500 Cygni 1975, a very fast nova; V603 Aql 1918, fast nova; CP Pup 1942, fast nova; GK Per 1901, fast nova; V 1668 Cyg 1979, moderately fast nova; FH Ser 1970, slow nova; DQ Her 1934, slow nova; T Aur 1891, slow nova; RR Pic 1925, slow nova; and HR Del 1967, very slow nova.
A THREE-DIMENSIONAL VIEW OF THE REMNANT OF NOVA PERSEI 1901 (GK Per)
Energy Technology Data Exchange (ETDEWEB)
Liimets, T.; Verro, K.; Kolka, I. [Tartu Observatory, 61602 Toravere (Estonia); Corradi, R. L. M.; Rodriguez-Gil, P. [Instituto de Astrofisica de Canarias, Via Lactea s/n, E-38205 La Laguna, Santa Cruz de Tenerife (Spain); Santander-Garcia, M. [Observatorio Astronomico Nacional, Ap. de Correos 112, E-28803 Alcala de Henares, Madrid (Spain); Villaver, E. [Departamento de Fisica Teorica, Universidad Autonoma de Madrid, E-28049 Madrid (Spain)
2012-12-10
We present a kinematical study of the optical ejecta of GK Per. It is based on proper-motion measurements of 282 knots from {approx}20 images spanning 25 years. Doppler shifts are also computed for 217 knots. The combination of proper motions and radial velocities allows a unique three-dimensional view of the ejecta to be obtained. The main results are as follows: (1) the outflow is a thick shell in which knots expand with a significant range of velocities, mostly between 600 and 1000 km s{sup -1}, (2) kinematical ages indicate that knots have suffered only a modest deceleration since their ejection a century ago, (3) no evidence for anisotropy in the expansion rate is found, (4) velocity vectors are generally aligned along the radial direction, but a symmetric pattern of non-radial velocities is also observed at specific directions, and (5) the total H{alpha}+[N II] flux has been linearly decreasing at a rate of 2.6% per year in the past decade. The eastern nebular side is fading at a slower rate than the western side. Some of the knots were displayed a rapid change of brightness during the 2004-2011 period. Over a longer timescale, a progressive circularization and homogenization of the nebula are taking place; (6) a kinematic distance of 400 {+-} 30 pc is determined. These results raise some problems with the previous interpretations of the evolution of GK Per. In particular, the idea of a strong interaction of the outflow with the surrounding medium in the southwest quadrant is not supported by our data.
Integrable deformations of the Gk1 ×Gk2 /Gk1+k2 coset CFTs
Sfetsos, Konstantinos; Siampos, Konstantinos
2018-02-01
We study the effective action for the integrable λ-deformation of the Gk1 ×Gk2 /Gk1+k2 coset CFTs. For unequal levels theses models do not fall into the general discussion of λ-deformations of CFTs corresponding to symmetric spaces and have many attractive features. We show that the perturbation is driven by parafermion bilinears and we revisit the derivation of their algebra. We uncover a non-trivial symmetry of these models parametric space, which has not encountered before in the literature. Using field theoretical methods and the effective action we compute the exact in the deformation parameter β-function and explicitly demonstrate the existence of a fixed point in the IR corresponding to the Gk1-k2 ×Gk2 /Gk1 coset CFTs. The same result is verified using gravitational methods for G = SU (2). We examine various limiting cases previously considered in the literature and found agreement.
Integrable deformations of the Gk1×Gk2/Gk1+k2 coset CFTs
Directory of Open Access Journals (Sweden)
Konstantinos Sfetsos
2018-02-01
Full Text Available We study the effective action for the integrable λ-deformation of the Gk1×Gk2/Gk1+k2 coset CFTs. For unequal levels theses models do not fall into the general discussion of λ-deformations of CFTs corresponding to symmetric spaces and have many attractive features. We show that the perturbation is driven by parafermion bilinears and we revisit the derivation of their algebra. We uncover a non-trivial symmetry of these models parametric space, which has not encountered before in the literature. Using field theoretical methods and the effective action we compute the exact in the deformation parameter β-function and explicitly demonstrate the existence of a fixed point in the IR corresponding to the Gk1−k2×Gk2/Gk1 coset CFTs. The same result is verified using gravitational methods for G=SU(2. We examine various limiting cases previously considered in the literature and found agreement.
Ultraviolet spectrophotometry and optical and infrared photometry of the old nova GK Persei
Wu, Chi-Chao; Holm, Albert V.; Panek, Robert J.; Raymond, John C.; Hartmann, Lee W.; Swank, Jean H.
1989-01-01
IUE observations in the 1150-3250-A region were obtained of GK Per during the rise, at the maximum, and during the decline of the 2.5-mag optical outburst in 1981. The results support previous predictions for the interaction of an accretion disk with the magnetic field of an accretion star. The luminosity at minimum is found to be 2.3 solar luminosities, with 1/3 of this being attributed to the cool secondary star.
OGLE ATLAS OF CLASSICAL NOVAE. II. MAGELLANIC CLOUDS
Energy Technology Data Exchange (ETDEWEB)
Mróz, P.; Udalski, A.; Poleski, R.; Soszyński, I.; Szymański, M. K.; Pietrzyński, G.; Wyrzykowski, Ł.; Ulaczyk, K.; Kozłowski, S.; Pietrukowicz, P.; Skowron, J., E-mail: pmroz@astrouw.edu.pl [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland)
2016-01-15
The population of classical novae in the Magellanic Clouds was poorly known because of a lack of systematic studies. There were some suggestions that nova rates per unit mass in the Magellanic Clouds were higher than in any other galaxy. Here, we present an analysis of data collected over 16 years by the OGLE survey with the aim of characterizing the nova population in the Clouds. We found 20 eruptions of novae, half of which are new discoveries. We robustly measure nova rates of 2.4 ± 0.8 yr{sup −1} (LMC) and 0.9 ± 0.4 yr{sup −1} (SMC) and confirm that the K-band luminosity-specific nova rates in both Clouds are 2–3 times higher than in other galaxies. This can be explained by the star formation history in the Magellanic Clouds, specifically the re-ignition of the star formation rate a few Gyr ago. We also present the discovery of the intriguing system OGLE-MBR133.25.1160, which mimics recurrent nova eruptions.
A deep optical imaging study of the nebular remnants of classical novae
Slavin, A. J.; O'Brien, T. J.; Dunlop, J. S.
1995-09-01
An optical imaging study of old nova remnants has revealed previously unobserved features in the shells of 13 classical novae - DQ Her, FH Ser, HR Del, GK Per, V1500 Cyg, T Aur, V533 Her, NQ Vul, V476 Cyg, DK Lac, LV Vul, RW UMi and V450 Cyg. These data indicate a possible correlation between nova speed class and the ellipticity of the resulting remnants - those of faster novae tend to comprise randomly distributed clumps of ejecta superposed on spherically symmetric diffuse material, whilst slower novae produce more structured ellipsoidal remnants with at least one and sometimes several rings of enhanced emission. By measuring the extent of the resolved shells and combining this information with previously published ejection speeds, we use expansion parallax to estimate distances for the 13 novae. Whilst we are able to deduce new information about every nova, it is notable that these observations include the first detections of shells around the old novae V450 Cyg and NQ Vul, and that velocity-resolved images of FH Ser and DQ Her have enabled us to estimate their orbital inclinations. Our observations of DQ Her also show that the main ellipsoidal shell is constricted by three rings and surrounded by a faint halo; this halo contains long tails extending outwards from bright knots, perhaps indicating that during or after outburst a fast inner wind has broken through the fractured principal shell.
ORIGINS OF ABSORPTION SYSTEMS OF CLASSICAL NOVA V2659 CYG (NOVA CYG 2014)
Energy Technology Data Exchange (ETDEWEB)
Arai, A.; Kawakita, H. [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Shinnaka, Y. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Tajitsu, A., E-mail: arai6a@cc.kyoto-su.ac.jp [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, Hawaii 96720 (United States)
2016-10-10
We report on high-dispersion spectroscopy results of a classical nova V2659 Cyg (Nova Cyg 2014) that are taken 33.05 days after the V -band maximum. The spectrum shows two distinct blueshifted absorption systems originating from H i, Fe ii, Ca ii, etc. The radial velocities of the absorption systems are −620 km s{sup −1}, and −1100 to −1500 km s{sup −1}. The higher velocity component corresponds to the P-Cygni absorption features frequently observed in low-resolution spectra. Much larger numbers of absorption lines are identified at the lower velocity. These mainly originate from neutral or singly ionized Fe-peak elements (Fe i, Ti ii, Cr ii, etc.). Based on the results of our spectroscopic observations, we discuss the structure of the ejecta of V2659 Cyg. We conclude that the low- and high-velocity components are likely to be produced by the outflow wind and the ballistic nova ejecta, respectively.
[Protective effect of arctigenin in GK rats combined with hypertension macroangiopathy].
Feng, Qin; Sun, Bao-cun; Xia, Wen-kai
2015-03-01
To study the protective effect of Arctigenin in goto-kakizaki (GK) rats combined with hypertension macroangiopathy. Six-week-old GK rats were divided randomly according to blood glucose level into four groups: the model group and low, middle and high dose arctigenin groups (12.5, 25, 50 mg x kg(-1)), with Wistar rats as the normal group. All of GK rats were given high-glucose and high-fat diet. After 16 weeks, GK rats were orally administrated with 10 mg x kg(-1) x d(-1) N-Ω-nitro-L-arginine methyl ester for eight weeks. During the modeling, all of arctigenin groups were orally administrated with different dose of arctigenin twice a day; The model group and the normal group were given solvents. At the beginning, mid-term and end of the experiment, blood glucose was measured. At the end of the experiment, efforts were made to detect blood pressure, collect abdominal aortic blood after anesthesia, fix thoracic aorta after bloodletting to make paraffin sections, observe morphological characteristics and detect the expression of VEGF by immunohistochemistry. According to the results, the blood glucose rose in all GK rats, with no significant difference between the drug group and the model group. At the end of the experiment, the blood pressure significantly increased in GK rats, indicating that Arctigenin could notably reduce the blood pressure in GK rats in a dose-dependent manner. The blood routine test showed increases in both the total white blood cell count and differential blood count, MPV and PDW, abnormal blood platelet parameters and decrease in PLT in GK rats, suggesting that Arctigenin could remarkably reduce the total white blood cell count and differential blood count, MPV and PDW. The thoracic aortic morphological observation revealed obvious endangium lesions in GK rats, demonstrating that Arctigenin could ameliorate the lesion extent. VEGF immumohistochemical staining showed a higher VEGF expression in the model group but lower expression in Arctigenin
Discovery of a New Classical Nova Shell Around a Nova-like Cataclysmic Variable
Guerrero, Martín A.; Sabin, Laurence; Tovmassian, Gagik; Santamaría, Edgar; Michel, Raul; Ramos-Larios, Gerardo; Alarie, Alexandre; Morisset, Christophe; Bermúdez Bustamante, Luis C.; González, Chantal P.; Wright, Nick J.
2018-04-01
The morphology and optical spectrum of IPHASX J210204.7+471015, a nebula classified as a possible planetary nebula are, however, strikingly similar to those of AT Cnc, a classical nova shell around a dwarf nova. To investigate its true nature, we have obtained high-resolution narrowband [O III] and [N II] images and deep optical spectra. The nebula shows an arc of [N II]-bright knots notably enriched in nitrogen, while an [O III]-bright bow shock is progressing throughout the ISM. Diagnostic line ratios indicate that shocks are associated with the arc and bow shock. The central star of this nebula has been identified by its photometric variability. Time-resolved photometric and spectroscopic data of this source reveal a period of 4.26 hr, which is attributed to a binary system. The optical spectrum is notably similar to that of RW Sex, a cataclysmic variable star (CV) of the UX UMa nova-like (NL) type. Based on these results, we propose that IPHASX J210204.7 + 471015 is a classical nova shell observed around a CV-NL system in quiescence.
Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK rats.
Directory of Open Access Journals (Sweden)
Sophie Calderari
Full Text Available Regenerating (REG proteins are associated with islet development, β-cell damage, diabetes and pancreatitis. Particularly, REG-1 and REG-3-beta are involved in cell growth/survival and/or inflammation and the Reg1 promoter contains interleukin-6 (IL-6-responsive elements. We showed by transcriptome analysis that islets of Goto-Kakizaki (GK rats, a model of spontaneous type 2 diabetes, overexpress Reg1, 3α, 3β and 3γ, vs Wistar islets. Goto-Kakizaki rat islets also exhibit increased cytokine/chemokine expression/release, particularly IL-6. Here we analyzed Reg1 and Reg3β expression and REG-1 immuno-localization in the GK rat pancreas in relationship with inflammation. Isolated pancreatic islets and acinar tissue from male adult Wistar and diabetic GK rats were used for quantitative RT-PCR analysis. REG-1 immunohistochemistry was performed on paraffin sections with a monoclonal anti-rat REG-1 antibody. Islet cytokine/chemokine release was measured after 48 h-culture. Islet macrophage-positive area was quantified on cryostat sections using anti-CD68 and major histocompatibility complex (MHC class II antibodies. Pancreatic exocrine-to-endocrine Reg1 and Reg3β mRNA ratios were markedly increased in Wistar vs GK rats. Conversely, both genes were upregulated in isolated GK rat islets. These findings were unexpected, because Reg genes are expressed in the pancreatic acinar tissue. However, we observed REG-1 protein labeling in acinar peri-ductal tissue close to islets and around large, often disorganized, GK rat islets, which may retain acinar cells due to their irregular shape. These large islets also showed peri-islet macrophage infiltration and increased release of various cytokines/chemokines, particularly IL-6. Thus, IL-6 might potentially trigger acinar REG-1 expression and secretion in the vicinity of large diabetic GK rat islets. This increased acinar REG-1 expression might reflect an adaptive though unsuccessful response to deleterious
Line Evolution of the Nova V5587 Sgr from Early to Nebula Phase
Directory of Open Access Journals (Sweden)
T. Kajikawa
2015-02-01
Full Text Available The spectral evolution of the nova V5587 Sgr has been monitored at Koyama Astronomical Observatory and Higashi-Hiroshima Observatory, Japan, from the early to nebula phase. The nova rebrightened several times. The spectra during the early phase showed emission lines of H α, H β, O I, He I, He II, N II, Fe II. Nova V5587 Sgr is classified into the Fe II type. The helium abundance of the nova is estimated as N(He/N(H = 0.134 ± 0.09. The light curve, the spectral evolution, and the helium abundance in V5587 Sgr are similar to those of the nova PW Vul.
Copernicus observations of Nova Cygni 1975
Jenkins, E. B.; Snow, T. P.; Upson, W. L.; Anderson, R.; Starrfield, S. G.; Gallagher, J. S.; Friedjung, M.; Linsky, J. L.; Henry, R. C.; Moos, H. W.
1977-01-01
Near-ultraviolet radiation from Nova Cygni 1975 was detected by the Copernicus satellite on five occasions from 1975 September 1 to 1975 September 9. The nova was not seen in the UV after this date. The principal result was the observation of a broad emission feature from the Mg II doublet at 2800 A. The absence of strong UV radiation at shorter wavelengths suggests that these lines are produced by collisional excitation in the outer layers of an expanding shell with electron temperature of approximately 4000 K. The absence of observed emission lines from highly ionized species indicates that the amount of material with log T between 4.4 and 5.7 is less than 0.001 times that which produces the Mg II emission. The continuum flux in the near-UV decreased as the nova evolved, showing that the total luminosity decreased as the nova faded in the visible.
Spectral evolution of Nova V400 Per (1974) and Nova V373 Sct (1975)
International Nuclear Information System (INIS)
Rosino, L.
1978-01-01
Photographic and spectroscopic observations of the two galactic novae, V400 Per and V373 Sct, which appeared in 1974 and 1975, have been carried out at Asiago. The light curves of the two novae were characterized by the presence of brightness oscillations during the early decline. The spectral evolution was quite normal: the spectra showed at first, over a relatively strong continuum, wide emission bands of moderate excitation, accompanied by blueshifted absorptions, with radial velocities of - 1760 kms -1 (Nova Per) and - 1260 kms -1 (Nova Sct). Later, after the novae entered the nebular stage, the continuum weakened, the absorption disappeared and the novae displayed the usual emission spectrum, with permitted and forbidden lines of high excitation ([O III], N III, He I, He II). Forbidden lines of Fe VI and Fe VII - and in Nova Sct, also Fe X and A X - were present for a time, but they soon disappeared, so that at the end the spectrum was dominated by the [O III] nebular lines, even stronger than Hα. (Auth.)
THE UNUSUALLY LUMINOUS EXTRAGALACTIC NOVA SN 2010U
International Nuclear Information System (INIS)
Czekala, Ian; Berger, E.; Chornock, R.; Marion, G. H.; Margutti, R.; Challis, P.; Pastorello, A.; Botticella, M. T.; Ergon, M.; Sollerman, J.; Smartt, S.; Vinkó, J.; Wheeler, J. C.
2013-01-01
We present observations of the unusual optical transient SN 2010U, including spectra taken 1.03 days to 15.3 days after maximum light that identify it as a fast and luminous Fe II type nova. Our multi-band light curve traces the fast decline (t 2 = 3.5 ± 0.3 days) from maximum light (M V = –10.2 ± 0.1 mag), placing SN 2010U in the top 0.5% of the most luminous novae ever observed. We find typical ejecta velocities of ≈1100 km s –1 and that SN 2010U shares many spectral and photometric characteristics with two other fast and luminous Fe II type novae, including Nova LMC 1991 and M31N-2007-11d. For the extreme luminosity of this nova, the maximum magnitude versus rate of decline relationship indicates a massive white dwarf (WD) progenitor with a low pre-outburst accretion rate. However, this prediction is in conflict with emerging theories of nova populations, which predict that luminous novae from massive WDs should preferentially exhibit an alternate spectral type (He/N) near maximum light.
Experimental study of the 22Ne(p,γ)23Na reaction and its implications for novae scenarios
International Nuclear Information System (INIS)
Menzel, Marie-Luise
2013-01-01
The 22 Ne(p,γ) 23 Na reaction belongs to the catalytic neon-sodium cycle and has an important role in the explosive hydrogen burning. The neon-sodium cycle takes place at temperatures of T = 0.1 - 0.5 GK and is assumed to occur in different astrophysical systems: e.g. in novae, in super novae of type Ia and during the shell-burning of red giant branch stars. The implications of 22 Ne(p,γ) 23 Na and the neon-sodium cycle in a nova scenario have been studied by using the nuclear network code libnucnet at GSI in Darmstadt. A nova is an outburst of matter in a binary system consisting of a white dwarf and a red giant star. It is therefore a representative phenomenon for explosive hydrogen burning. For the calculation of the nucleosynthesis during the nova outburst, the code libnucnet requires the initial mass composition of the novae partners, the temperature and density profiles of the nova explosion and the thermonuclear reaction rates of the participating reactions. In the following, the code determined the flow and the final atomic abundance in the neon-sodium cycle during the entire nova process. Additionally, the influence of the temperature profile of the novae outburst as well as the thermonuclear reaction rate of the 22 Ne(p,γ) 23 Na reaction on the final atomic abundance in the outburst has been studied. A characteristic measure for the reactions in astrophysical environments is the thermonuclear reaction rate. The reaction rate of 22 Ne(p,γ) 23 Na has still strong uncertainties in the temperature range of T = 0.03 - 0.3 GK. These uncertainties are based on insufficient upper limits of the resonance strengths as well as the possible existence of tentative states that are populated in the energy range of E lab p = 30 - 300 keV. The research presented in this thesis is dedicated to the experimental study of the 22 Ne(p,γ) 23 Na reaction for an improved determination of the thermonuclear reaction rate. Furthermore, the implications of 22 Ne(p,γ) 23 Na and
Energy Technology Data Exchange (ETDEWEB)
Menzel, Marie-Luise
2013-08-01
The {sup 22}Ne(p,{gamma}){sup 23}Na reaction belongs to the catalytic neon-sodium cycle and has an important role in the explosive hydrogen burning. The neon-sodium cycle takes place at temperatures of T = 0.1 - 0.5 GK and is assumed to occur in different astrophysical systems: e.g. in novae, in super novae of type Ia and during the shell-burning of red giant branch stars. The implications of {sup 22}Ne(p,{gamma}){sup 23}Na and the neon-sodium cycle in a nova scenario have been studied by using the nuclear network code libnucnet at GSI in Darmstadt. A nova is an outburst of matter in a binary system consisting of a white dwarf and a red giant star. It is therefore a representative phenomenon for explosive hydrogen burning. For the calculation of the nucleosynthesis during the nova outburst, the code libnucnet requires the initial mass composition of the novae partners, the temperature and density profiles of the nova explosion and the thermonuclear reaction rates of the participating reactions. In the following, the code determined the flow and the final atomic abundance in the neon-sodium cycle during the entire nova process. Additionally, the influence of the temperature profile of the novae outburst as well as the thermonuclear reaction rate of the {sup 22}Ne(p,{gamma}){sup 23}Na reaction on the final atomic abundance in the outburst has been studied. A characteristic measure for the reactions in astrophysical environments is the thermonuclear reaction rate. The reaction rate of {sup 22}Ne(p,{gamma}){sup 23}Na has still strong uncertainties in the temperature range of T = 0.03 - 0.3 GK. These uncertainties are based on insufficient upper limits of the resonance strengths as well as the possible existence of tentative states that are populated in the energy range of E{sup lab}{sub p} = 30 - 300 keV. The research presented in this thesis is dedicated to the experimental study of the {sup 22}Ne(p,{gamma}){sup 23}Na reaction for an improved determination of the
SWIFT X-RAY OBSERVATIONS OF CLASSICAL NOVAE. II. THE SUPER SOFT SOURCE SAMPLE
Energy Technology Data Exchange (ETDEWEB)
Schwarz, Greg J. [American Astronomical Society, 2000 Florida Avenue, NW, Suite 400, Washington, DC 20009-1231 (United States); Ness, Jan-Uwe [XMM-Newton Science Operations Centre, ESAC, Apartado 78, 28691 Villanueva de la Canada, Madrid (Spain); Osborne, J. P.; Page, K. L.; Evans, P. A.; Beardmore, A. P. [Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom); Walter, Frederick M. [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States); Andrew Helton, L. [SOFIA Science Center, USRA, NASA Ames Research Center, M.S. N211-3, Moffett Field, CA 94035 (United States); Woodward, Charles E. [Minnesota Institute of Astrophysics, 116 Church Street S.E., University of Minnesota, Minneapolis, MN 55455 (United States); Bode, Mike [Astrophysics Research Institute, Liverpool John Moores University, Birkenhead CH41 1LD (United Kingdom); Starrfield, Sumner [School of Earth and Space Exploration, Arizona State University, P.O. Box 871404, Tempe, AZ 85287-1404 (United States); Drake, Jeremy J., E-mail: Greg.Schwarz@aas.org [Smithsonian Astrophysical Observatory, 60 Garden Street, MS 3, Cambridge, MA 02138 (United States)
2011-12-01
The Swift gamma-ray burst satellite is an excellent facility for studying novae. Its rapid response time and sensitive X-ray detector provides an unparalleled opportunity to investigate the previously poorly sampled evolution of novae in the X-ray regime. This paper presents Swift observations of 52 Galactic/Magellanic Cloud novae. We included the X-Ray Telescope (0.3-10 keV) instrument count rates and the UltraViolet and Optical Telescope (1700-8000 A) filter photometry. Also included in the analysis are the publicly available pointed observations of 10 additional novae the X-ray archives. This is the largest X-ray sample of Galactic/Magellanic Cloud novae yet assembled and consists of 26 novae with Super Soft X-ray emission, 19 from Swift observations. The data set shows that the faster novae have an early hard X-ray phase that is usually missing in slower novae. The Super Soft X-ray phase occurs earlier and does not last as long in fast novae compared to slower novae. All the Swift novae with sufficient observations show that novae are highly variable with rapid variability and different periodicities. In the majority of cases, nuclear burning ceases less than three years after the outburst begins. Previous relationships, such as the nuclear burning duration versus t{sub 2} or the expansion velocity of the eject and nuclear burning duration versus the orbital period, are shown to be poorly correlated with the full sample indicating that additional factors beyond the white dwarf mass and binary separation play important roles in the evolution of a nova outburst. Finally, we confirm two optical phenomena that are correlated with strong, soft X-ray emission which can be used to further increase the efficiency of X-ray campaigns.
SWIFT X-RAY OBSERVATIONS OF CLASSICAL NOVAE. II. THE SUPER SOFT SOURCE SAMPLE
International Nuclear Information System (INIS)
Schwarz, Greg J.; Ness, Jan-Uwe; Osborne, J. P.; Page, K. L.; Evans, P. A.; Beardmore, A. P.; Walter, Frederick M.; Andrew Helton, L.; Woodward, Charles E.; Bode, Mike; Starrfield, Sumner; Drake, Jeremy J.
2011-01-01
The Swift gamma-ray burst satellite is an excellent facility for studying novae. Its rapid response time and sensitive X-ray detector provides an unparalleled opportunity to investigate the previously poorly sampled evolution of novae in the X-ray regime. This paper presents Swift observations of 52 Galactic/Magellanic Cloud novae. We included the X-Ray Telescope (0.3-10 keV) instrument count rates and the UltraViolet and Optical Telescope (1700-8000 Å) filter photometry. Also included in the analysis are the publicly available pointed observations of 10 additional novae the X-ray archives. This is the largest X-ray sample of Galactic/Magellanic Cloud novae yet assembled and consists of 26 novae with Super Soft X-ray emission, 19 from Swift observations. The data set shows that the faster novae have an early hard X-ray phase that is usually missing in slower novae. The Super Soft X-ray phase occurs earlier and does not last as long in fast novae compared to slower novae. All the Swift novae with sufficient observations show that novae are highly variable with rapid variability and different periodicities. In the majority of cases, nuclear burning ceases less than three years after the outburst begins. Previous relationships, such as the nuclear burning duration versus t 2 or the expansion velocity of the eject and nuclear burning duration versus the orbital period, are shown to be poorly correlated with the full sample indicating that additional factors beyond the white dwarf mass and binary separation play important roles in the evolution of a nova outburst. Finally, we confirm two optical phenomena that are correlated with strong, soft X-ray emission which can be used to further increase the efficiency of X-ray campaigns.
Characterization of the cGMP-dependent protein kinase SmcGK1 of Schistosoma mansoni
Directory of Open Access Journals (Sweden)
Silke Leutner
2011-06-01
Full Text Available Schistosomes are trematode parasites and of worldwide medical importance for humans and animals. Growth and development of these parasites require a specific host environment, but also permanent communication processes between the two genders. Accumulating molecular evidence indicates that the responsible interactions are mediated by signal transduction processes. Conserved signaling molecules were identified, and first approaches made for their characterization. However, no representative of the conserved family of cGMP-dependent protein kinases (cGKs has been described in this parasite yet. Within the Schistosoma mansoni genome data-set we identified cGK homologs, of which one was investigated in more detail in this study. We present the cloning of SmcGK1, whose sequence shows homology to cGKs of higher eukaryotes. SmcGK1 was found to be gender-independently transcribed in adult schistosomes. The occurrence of SmcGK1 sense and antisense transcripts suggests that the expression of this gene is controlled at the post-transcriptional level. In situ hybridization experiments demonstrated a gonad-preferential expression profile in both genders indicating a role of SmcGK1, at least during sexual development of schistosomes. Using a cGK-specific inhibitor to treat adult schistosomes in vitro finally resulted in a multifaceted phenotype including slow motion, oocyte congestion, and reduced egg production.Esquistossomos são parasitas trematodos de importância médica em todo o mundo para o homem e os animais. O crescimento e o desenvolvimento destes parasitas requerem um ambiente específico do hospedeiro, mas também um processo de comunicação permanente entre parasitas dos dois sexos. Evidência molecular tem se acumulado e indica que as interações são mediadas por processos de transdução de sinal. Moléculas sinalizadoras conservadas foram identificadas, e as primeiras abordagens têm sido feitas para sua caracterização. Contudo, não foi
PHOTOMETRIC AND SPECTROSCOPIC PROPERTIES OF NOVAE IN THE LARGE MAGELLANIC CLOUD
International Nuclear Information System (INIS)
Shafter, A. W.
2013-01-01
The photometric and spectroscopic properties of the 43 known LMC nova candidates are summarized and reviewed. Of these, photometric data sufficient to establish decline rates are available for 29 novae, while spectroscopic data sufficient to establish the spectroscopic classes are available for 18 systems. Half of the 18 novae belong to the Fe II class, with the remaining nine belonging to either the He/N or the Fe IIb classes. As seen in previous nova studies of M31 and M33, the He/N and Fe IIb novae have on average faster photometric developments than do their Fe II counterparts. Overall, the available photometry confirms earlier studies, and shows conclusively that LMC novae have faster rates of decline than do novae in the Galaxy and M31. It appears that the increased fraction of faster, He/N and Fe IIb novae observed in the LMC compared with M31 is almost certainly the result of differences in the underlying stellar population between the two galaxies. We propose that the younger population seen in the LMC compared with M31's bulge (where most of the novae are found), produces progenitor binaries with higher average white dwarf masses. The higher mean white dwarf mass not only produces a larger fraction of fast, He/N novae compared with M31, but also results in a relatively large recurrent nova population.
ON THE SPECTROSCOPIC CLASSES OF NOVAE IN M33
International Nuclear Information System (INIS)
Shafter, A. W.; Darnley, M. J.; Bode, M. F.; Ciardullo, R.
2012-01-01
We report the initial results from an ongoing multi-year spectroscopic survey of novae in M33. The survey resulted in the spectroscopic classification of six novae (M33N 2006-09a, 2007-09a, 2009-01a, 2010-10a, 2010-11a, and 2011-12a) and a determination of rates of decline (t 2 times) for four of them (2006-09a, 2007-09a, 2009-01a, and 2010-10a). When these data are combined with existing spectroscopic data for two additional M33 novae (2003-09a and 2008-02a), we find that five of the eight novae with available spectroscopic class appear to be members of either the He/N or Fe IIb (hybrid) classes, with only two clear members of the Fe II spectroscopic class. This initial finding is very different from what would be expected based on the results for M31 and the Galaxy where Fe II novae dominate, and the He/N and Fe IIb classes together make up only ∼20% of the total. It is plausible that the increased fraction of He/N and Fe IIb novae observed in M33 thus far may be the result of the younger stellar population that dominates this galaxy, which is expected to produce novae that harbor generally more massive white dwarfs than those typically associated with novae in M31 or the Milky Way.
Energy Technology Data Exchange (ETDEWEB)
Haque, Muzammel; Stanfield, Brent; Kousoulas, Konstantin G.
2016-12-15
We have previously shown that the HSV-1 gK and UL20 proteins interact and function in virion envelopment, membrane fusion, and neuronal entry. Alignment of the predicted secondary structures of gKs encoded by BoHV-1, HSV-1, HSV-2, EHV-1 and VZV indicated a high degree of domain conservation. Two BoHV-1 gK-null mutant viruses were created by either gK gene deletion or stop codon insertion. In addition, a V5 epitope-tag was inserted at the carboxyl terminus of gK gene to detect gK. The engineered gK-null mutant viruses failed to replicate and produce viral plaques. Co-immunoprecipitation of gK and UL20 expressed via different methods revealed that gK and UL20 physically interacted in the presence or absence of other viral proteins. Confocal microscopy showed that gK and UL20 colocalized in infected cells. These results indicate that BoHV-1 gK and UL20 may function in a similar manner to other alphaherpesvirus orthologues specified by HSV-1, PRV and EHV-1. -- Highlights: •Glycoprotein K(gK) is conserved among alphaherpesviruses and serves similar functions. •The bovine herpesvirus-1 gK and UL20 proteins physically interact in a similar manner to herpes simplex virus type 1 and equine herpesvirus-1. •The bovine herpesvirus-1 (BoHV-1) gK interacts with UL20 and is essential for virus replication and spread.
International Nuclear Information System (INIS)
Haque, Muzammel; Stanfield, Brent; Kousoulas, Konstantin G.
2016-01-01
We have previously shown that the HSV-1 gK and UL20 proteins interact and function in virion envelopment, membrane fusion, and neuronal entry. Alignment of the predicted secondary structures of gKs encoded by BoHV-1, HSV-1, HSV-2, EHV-1 and VZV indicated a high degree of domain conservation. Two BoHV-1 gK-null mutant viruses were created by either gK gene deletion or stop codon insertion. In addition, a V5 epitope-tag was inserted at the carboxyl terminus of gK gene to detect gK. The engineered gK-null mutant viruses failed to replicate and produce viral plaques. Co-immunoprecipitation of gK and UL20 expressed via different methods revealed that gK and UL20 physically interacted in the presence or absence of other viral proteins. Confocal microscopy showed that gK and UL20 colocalized in infected cells. These results indicate that BoHV-1 gK and UL20 may function in a similar manner to other alphaherpesvirus orthologues specified by HSV-1, PRV and EHV-1. -- Highlights: •Glycoprotein K(gK) is conserved among alphaherpesviruses and serves similar functions. •The bovine herpesvirus-1 gK and UL20 proteins physically interact in a similar manner to herpes simplex virus type 1 and equine herpesvirus-1. •The bovine herpesvirus-1 (BoHV-1) gK interacts with UL20 and is essential for virus replication and spread.
A Metabonomic Comparison of Urinary Changes in Zucker and GK Rats
Directory of Open Access Journals (Sweden)
Liang-Cai Zhao
2010-01-01
Full Text Available To further investigate pathogenesis and pathogenic process of type 2 diabetes mellitus (T2DM, we compared the urinary metabolic profiling of Zucker obese and Goto-kakizaki (GK rats by NMR-based metabonomics. Principal component analysis (PCA on urine samples of both models rats indicates markedly elevated levels of creatine/creatinine, dimethylamine, and acetoacetate, with concomitantly declined levels of citrate, 2-ketoglurarate, lactate, hippurate, and succinate compared with control rats, respectively. Simultaneously, compared with Zucker obese rats, the GK rats show decreased levels of trimethylamine, acetate, and choline, as well as increased levels of creatine/creatinine, acetoacetate, alanine, citrate, 2-ketoglutarate, succinate, lactate, and hippurate. This study demonstrates metabolic similarities between the two stages of T2DM, including reduced tricarboxylic acid (TCA cycle and increased ketone bodies production. In addition, compared with Zucker obese rats, the GK rats have enhanced concentration of energy metabolites, which indicates energy metabolic changes produced in hyperglycemia stage more than in insulin resistance stage.
Relationship of classical novae to other eruptive variables
International Nuclear Information System (INIS)
Vogt, N.
1989-01-01
Classical novae are characterized by their well known large-amplitude outbursts, accompanied by the ejection of a shell. The same stars, however, apparently pass through much longer quiescent phases whose duration exceeds that of the outburst phase by a factor ∼ 10 5 and that of historical nova records by a factor 10 2 -10 3 . Therefore a large number of variable stars should exist which actually are classical nova systems but whose last outbursts occurred in prehistoric times. We assume that some of these stars are hidden among the so-called 'nova-lies' in the literature. However some eruptive variables and symbiotic stars, i.e. stars which certainly are not nova remnants, are mentioned. Variables related to classical novae can be divided into three main classes: (i) Potential novae which are possibly classical novae in their quiescent state. Potential novae must share the basic configuration and parameters (orbital period, masses) with classical novae; they must be semi-detached cataclysmic binaries with a white dwarf as primary and a Roche-lobe-filling red dwarf on, or near, the mainsequence as secondary. (ii) Stars which share some outburst characteristics with classical novae without having the same binary configuration. For example recurrent novae with giant secondaries, very slow novae (and symbiotic binary stars). (iii) Stars which are evolutionarily related to classical novae, i.e. which possibly are progenitors or successors of novae in their secular evolution, such as binary nuclei of planetary nebulae and close, but detached, white dwarf-red dwarf pairs (e.g. V 471 Tau), both resulting from common-envelope evolution. These three main groups of nova-related stars are discussed. (author)
Optical and Near-infrared Study of Nova V2676 Oph 2012
Energy Technology Data Exchange (ETDEWEB)
Raj, A. [Korea Astronomy and Space Science Institute, Daejeon, 34055 (Korea, Republic of); Das, R. K. [Department of Astrophysics and Cosmology, S N Bose National Centre for Basic Sciences, Salt Lake, Kolkata 700106 (India); Walter, F. M., E-mail: ashish.raj@iiap.res.in [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States)
2017-02-01
We present optical spectrophotometric and near-infrared (NIR) photometric observations of the nova V2676 Oph covering the period from 2012 March 29 through 2015 May 8. The optical spectra and photometry of the nova have been taken from SMARTS and Asiago; the NIR photometry was obtained from SMARTS and Mt. Abu. The spectra were dominated by strong H i lines from the Balmer series, Fe ii, N i, and [O i] lines in the initial days, typical of an Fe ii type nova. The measured FWHM for the H β and H α lines was 800–1200 km s{sup −1}. There was pronounced dust formation starting 90 days after the outburst. The J − K color was the largest among recent dust-forming novae.
Effect of Undiagnosed Deep Adenomyosis After Failed NovaSure Endometrial Ablation
Mengerink, B.B.; Wurff, A.A. van der; Haar, J.F. ter; Rooij, I.A.L.M. van; Pijnenborg, J.M.
2015-01-01
STUDY OBJECTIVE: To determine the prevalence of adenomyosis and deep adenomyosis after NovaSure (Hologic Inc., Newark, DE) endometrial ablation in hysterectomy specimens after NovaSure endometrial ablation failure. DESIGN: Prospective observational study (Canadian Task Force classification II-2).
Novae, supernovae, and the island universe hypothesis
International Nuclear Information System (INIS)
Van Den Bergh, S.
1988-01-01
Arguments in Curtis's (1917) paper related to the island universe hypothesis and the existence of novae in spiral nebulae are considered. It is noted that the maximum magnitude versus rate-of-decline relation for novae may be the best tool presently available for the calibration of the extragalactic distance scale. Light curve observations of six novae are used to determine a distance of 18.6 + or - 3.5 MPc to the Virgo cluster. Results suggest that Type Ia supernovae cannot easily be used as standard candles, and that Type II supernovae are unsuitable as distance indicators. Factors other than precursor mass are probably responsible for determining the ultimate fate of evolving stars. 83 references
Apaijai, Nattayaporn; Charoenphandhu, Narattaphol; Ittichaichareon, Jitjiroj; Suntornsaratoon, Panan; Krishnamra, Nateetip; Aeimlapa, Ratchaneevan; Chattipakorn, Siriporn C; Chattipakorn, Nipon
2017-10-31
Both Type 2 diabetes mellitus (T2DM) and estrogen deprivation have been shown to be associated with the development of cardiovascular disease and adverse cardiac remodeling. However, the role of estrogen deprivation on adverse cardiac remodeling in nonobese T2DM rats has not been clearly elucidated. We hypothesized that estrogen-deprivation aggravates adverse cardiac remodeling in Goto-Kakizaki (GK) rats. Wild-type (WT) and GK rats at the age of 9 months old were divided into two subgroups to have either a sham operation (WTS, GKS) or a bilateral ovariectomy (WTO, GKO) ( n = 6/subgroup). Four months after the operation, the rats were killed, and the heart was excised rapidly. Metabolic parameters, cardiomyocytes hypertrophy, cardiac fibrosis, and biochemical parameters were determined. GK rats had hyperglycemia with hypoinsulinemia, and estrogen deprivation did not increase the severity of T2DM. Cardiac hypertrophy, cardiac oxidative stress, and phosphor-antinuclear factor κB were higher in WTO and GKS rats than WTS rats, and they markedly increased in GKO rats compared with GKS rats. Furthermore, cardiac fibrosis, transforming growth factor-β, Bax, phosphor-p38, and peroxisome proliferator- activated receptor γ coactivator-1α expression were increased in GKS and GKO rats compared with the lean rats. However, mitochondrial dynamics proteins including dynamin-related protein 1 and mitofusin-2 were not altered by T2DM and estrogen deprivation. Although estrogen deprivation did not aggravate T2DM in GK rats, it increased the severity of cardiac hypertrophy by provoking cardiac inflammation and oxidative stress in nonobese GK rats. © 2017 The Author(s).
Uma padre na aldeia global : nova evangelização e novas tecnologias de informação e comunicação
Aguiar, Américo Manuel Alves
2012-01-01
Nesta dissertação, revemos os últimos cem anos de pronunciamentos dos sucessores de Pedro, do Papa Leão XIII, ao Papa Bento XVI, atestando a atenção e interesse com que a igreja católica sempre olhou para as potencialidades oferecidas pelas novas tecnologias de informação e de comunicação. Olhamos de um ponto de vista comunicacional para a urgência da Nova Evangelização pronunciada pelo Papa João Paulo II, dando continuidade ao já expresso pelo Papa Paulo VI e pelo próprio II ...
Mayo, M.; Williams, C.; Rodriguez, T.; Greely, T.; Pyrtle, A. J.; Rivera-Rentas, A. L.; Vilches, M.
2004-12-01
The National Science Foundation's Graduate Teaching Fellows in K-12 Education (GK-12) Program has enabled science, technology, engineering and mathematics (STEM) graduate schools across the country to become more active in local area K-12 schools. An overview of a graduate student's experiences, insights gained and lessons learned as a Fellow in the 2003-2004 Universidad Metropolitana's (UMET) environmental science and the 2004-2005 University of South Florida's (USF) ocean science GK-12 Programs is presented. The major goals of the 2003-2004 UMET GK-12 Program were 1) to enrich environmental science teaching and learning via a thematic approach in eight local public schools and 2) to provide UMET graduate students with exposure to teaching methodologies and practical teaching experience. Utilizing examples from local environments in and nearby Carolina, Puerto Rico to teach key science principles at Escuela de la Comunidad Juana Rodriguez Mundo provided numerous opportunities to relate science topics to students' daily life experiences. By 2004, the UMET GK-12 Program had successfully engaged the entire student body (primarily comprised of bilingual minority kindergarten to sixth graders), teachers and school administrators in environment-focused teaching and learning activities. Examples of such activities include tree planting projects to minimize local erosion, conducting a science fair for the first time in many years, and numerous opportunities to experience what "real scientists do" while conducting environmental science investigations. During the 2004-2005 academic year, skills, insights and lessons learned as a UMET GK-12 Fellow are being further enhanced through participation in the USF GK-12 OCEANS Program. The overall objectives of the 2004-2005 USF GK-12 OCEANS assignment at Madeira Beach Elementary School in Saint Petersburg, Florida are to 1) engage students from various ethnic backgrounds and cultures in hands-on science activities, 2) enhance the
Identifying and quantifying recurrent novae masquerading as classical novae
International Nuclear Information System (INIS)
Pagnotta, Ashley; Schaefer, Bradley E.
2014-01-01
Recurrent novae (RNe) are cataclysmic variables with two or more nova eruptions within a century. Classical novae (CNe) are similar systems with only one such eruption. Many of the so-called CNe are actually RNe for which only one eruption has been discovered. Since RNe are candidate Type Ia supernova progenitors, it is important to know whether there are enough in our Galaxy to provide the supernova rate, and therefore to know how many RNe are masquerading as CNe. To quantify this, we collected all available information on the light curves and spectra of a Galactic, time-limited sample of 237 CNe and the 10 known RNe, as well as exhaustive discovery efficiency records. We recognize RNe as having (1) outburst amplitude smaller than 14.5 – 4.5 × log (t 3 ), (2) orbital period >0.6 days, (3) infrared colors of J – H > 0.7 mag and H – K > 0.1 mag, (4) FWHM of Hα > 2000 km s –1 , (5) high excitation lines, such as Fe X or He II near peak, (6) eruption light curves with a plateau, and (7) white dwarf mass greater than 1.2 M ☉ . Using these criteria, we identify V1721 Aql, DE Cir, CP Cru, KT Eri, V838 Her, V2672 Oph, V4160 Sgr, V4643 Sgr, V4739 Sgr, and V477 Sct as strong RN candidates. We evaluate the RN fraction among the known CNe using three methods to get 24% ± 4%, 12% ± 3%, and 35% ± 3%. With roughly a quarter of the 394 known Galactic novae actually being RNe, there should be approximately a hundred such systems masquerading as CNe.
Energy Technology Data Exchange (ETDEWEB)
Shara, Michael M.; Doyle, Trisha; Zurek, David [Department of Astrophysics, American Museum of Natural History, Central Park West and 79th Street, New York, NY 10024-5192 (United States); Lauer, Tod R. [National Optical Astronomy Observatory, P.O. Box 26732, Tucson, AZ 85726 (United States); Baltz, Edward A. [KIPAC, SLAC, 2575 Sand Hill Road, M/S 29, Menlo Park, CA 94025 (United States); Kovetz, Attay [School of Physics and Astronomy, Faculty of Exact Sciences, Tel Aviv University, Tel Aviv (Israel); Madrid, Juan P. [CSIRO, Astronomy and Space Science, P.O. Box 76, Epping, NSW 1710 (Australia); Mikołajewska, Joanna [N. Copernicus Astronomical Center, Polish Academy of Sciences, Bartycka 18, PL 00-716 Warsaw (Poland); Neill, J. D. [California Institute of Technology, 1200 East California Boulevard, MC 278-17, Pasadena CA 91125 (United States); Prialnik, Dina [Department of Geosciences, Tel Aviv University, Ramat Aviv, Tel Aviv 69978 (Israel); Welch, D. L. [Department of Physics and Astronomy, McMaster University, Hamilton, L8S 4M1, Ontario (Canada); Yaron, Ofer [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel)
2017-04-20
The extensive grid of numerical simulations of nova eruptions from the work of Yaron et al. first predicted that some classical novae might significantly deviate from the Maximum Magnitude–Rate of Decline (MMRD) relation, which purports to characterize novae as standard candles. Kasliwal et al. have announced the observational detection of a new class of faint, fast classical novae in the Andromeda galaxy. These objects deviate strongly from the MMRD relationship, as predicted by Yaron et al. Recently, Shara et al. reported the first detections of faint, fast novae in M87. These previously overlooked objects are as common in the giant elliptical galaxy M87 as they are in the giant spiral M31; they comprise about 40% of all classical nova eruptions and greatly increase the observational scatter in the MMRD relation. We use the extensive grid of the nova simulations of Yaron et al. to identify the underlying causes of the existence of faint, fast novae. These are systems that have accreted, and can thus eject, only very low-mass envelopes, of the order of 10{sup −7}–10{sup −8} M {sub ⊙}, on massive white dwarfs. Such binaries include, but are not limited to, the recurrent novae. These same models predict the existence of ultrafast novae that display decline times, t {sub 2,} to be as short as five hours. We outline a strategy for their future detection.
NSF GK-12 Fellows as Mentors for K-12 Teachers Participating in Field Research Experiences
Ellins, K.; Perry, E.
2005-12-01
The University of Texas Institute for Geophysics (UTIG) recognizes the value of providing educational opportunities to K-12 teachers who play a critical role in shaping the minds of young people who are the future of our science. To that end, UTIG established the "Texas Teachers in the Field" program in 2000 to formalize the participation of K-12 teachers in field programs that included UTIG scientists. In 2002, "Texas Teachers in the Field" evolved through UTIG's involvement in a University of Texas at Austin GK-12 project led by the Environmental Sciences Institute, which enabled UTIG to partner a subset of GK-12 Fellows with teachers participating in geophysical field programs. During the three years of the GK-12 project, UTIG successfully partnered four GK-12 Fellows with five K-12 teachers. The Fellows served as mentors to the teachers, as liaisons between UTIG scientists leading field programs and teachers and their students, and as resources in science, mathematics, and technology instruction. Specifically, Fellows prepared teachers and their students for the field investigations, supervised the design of individual Teacher Research Experience (TRE) projects, and helped teachers to develop standards-aligned curriculum resources related to the field program for use in their own classrooms, as well as broader distribution. Although all but one TRE occurred during the school year, Texas school districts and principals were willing to release teachers to participate because the experience and destinations were so extraordinary (i.e., a land-based program in Tierra del Fuego, Argentina; and research cruises to the Southeast Caribbean Sea and Hess Deep in the Pacific Ocean) and carried opportunities to work with scientists from around the world. This exceptional collaboration of GK-12 Fellows, K-12 teachers and research scientists enriches K-12 student learning and promotes greater enthusiasm for science. The level of mentoring, preparation and follow-up provided
Swift observations of Nova Scuti 2017
Kuin, N. P. M.; Page, K. L.; Williams, S. C.; Darnley, M. J.; Nelson, T. J.; Osborne, J.
2017-08-01
Nova Sct 2017 (ASASSN-17hx/ASASSN-17ib) went into eruption on 2017-06-19.41 (hereafter taken as Day 0), as reported on the ASAS SN transient page (see also ATEL #10523,#10524) Spectroscopic confirmation (ATEL #10527,#10542) observed emission in H and He I, and in N II as well as Fe II. The ASASSN light curve data show a peak of V = 8.75 on 2017, July 30, day 40.867.
International Nuclear Information System (INIS)
Ragunathan, Preethi; Raghunath, Gokul; Kuramitsu, Seiki; Yokoyama, Shigeyuki; Kumarevel, Thirumananseri; Ponnuraj, Karthe
2013-01-01
The expression, purification, characterization and crystallization of GK2848, a carbonic anhydrase from G. kaustophilus, are described. The crystals diffracted to a resolution of 2.70 Å. GK2848, a hypothetical protein from the thermophilic organism Geobacillus kaustophilus, was cloned and overexpressed in Escherichia coli. The protein was purified to homogeneity using Ni–NTA affinity-column and gel-filtration chromatography. The purified protein was crystallized using the sitting-drop vapour-diffusion method. The crystals diffracted to a resolution of 2.70 Å and belonged to the orthorhombic space group P2 1 2 1 2. GK2848 bears sequence homology to carbonic anhydrases of various bacterial species, indicating that it belongs to the carbonic anhydrase family of proteins. A subsequent carbonic anhydrase activity assay of GK2848 using the Wilbur–Anderson method confirmed its function as a carbonic anhydrase. A preliminary structure solution was obtained by molecular replacement using MOLREP. Mutation and biochemical characterization of the protein are in progress. The structure and functional analysis of GK2848 might provide valuable information on a novel class of carbonic anhydrases, as none of its homologous structures have been characterized
Directory of Open Access Journals (Sweden)
Mei-Fang Zhong
2012-01-01
Full Text Available We investigated large vessel function in lean Goto-Kakizaki diabetic rats (GK and Otsuka Long-Evans Tokushima Fatty diabetic rats (OLETF with possible roles of hyperglycemia/hyperosmolarity and insulin. Both young and old GK showed marked hyperglycemia with normal insulin level and well-preserved endothelium-dependent and endothelium-independent vasodilation in aorta and carotid artery. There were significant elevations in endothelial/inducible nitric oxide synthase (eNOS/iNOS and inducible/constitutive heme oxygenase (HO-1/HO-2 in GK. The endothelium-dependent vasodilation in GK was inhibited partly by NOS blockade and completely by simultaneous blocking of HO and NOS. In contrast, OLETF showed hyperinsulinemia and mild hyperglycemia but significant endothelium dysfunction beginning at early ages with concomitantly reduced eNOS. Insulin injection corrected hyperglycemia in GK but induced endothelium dysfunction and intima hyperplasia. Hyperglycemia/hyperosmolarity in vitro enhanced vessel eNOS/HO. We suggest that hyperinsulinemia plays a role in endothelium dysfunction in obese diabetic OLETF, while hyperglycemia/hyperosmolarity-induced eNOS/HO upregulation participates in the adaptation of endothelium function in lean diabetic GK.
Early Photometric and Spectral Evolution of Nova Cygni 2014 (V2659 Cyg
Directory of Open Access Journals (Sweden)
Burlak M. A.
2015-12-01
Full Text Available We present optical spectroscopic and UBV (RIC photometric observations of Nova Cygni 2014 (V2659 Cyg from its rebrightening to the nebular stage. After the first maximum, the nova underwent several irregular flare-like rebrightenings, with amplitudes up to two magnitudes, accompanied with spectral changes. During the bright state, forbidden lines became weaker; the absorption components of Balmer, He I, Fe II, N I, N II, O I lines strengthened, indicating an increase in the density and mass-loss rate in the form of a wind.
Directory of Open Access Journals (Sweden)
M. Sh. Avrushchenko
2012-01-01
Full Text Available Objective: to evaluate the efficacy of the nerve growth factor mimetic GK-2 used to improve the structural and functional state of the brain in the early postresuscitation period. Material and methods. Cardiac arrest was induced in mature male albino rats for 12 minutes, followed by resuscitation. The neurological state of the resuscitated animals was assessed by a scoring scale. On postresuscitation day 7, the density and composition of neuronal populations of Purkinje cells in the lateral cerebellar region and pyramidal neurons in the hippocampal CA1 sector were determined by a differential morphometric analysis. The results were statistically processed using the ANOVA method. Results. The use of GK-2 was found to accelerate neurological recovery in the resuscitated animals. On day 7 after 12-minute cardiac arrest, the resuscitated animals showed neuronal dystrophic changes and death in the neuronal populations highly susceptible to ischemia. It was shown that the systemic administration of the nerve growth factor mimetic GK-2 contributed to a reduction in the magnitude and depth of postresuscitation changes in the cerebellar Purkinje cells and prevented dystrophic changes in the pyramidal cells of the hippocampal CA1 sector. The findings suggest that GK-2 has a neuroprotective effect in the recovery period after total body ischemia. Conclusion. The results of this study indicate the efficiency of the systemic administration of the nerve growth factor mimetic GK-2 in improving the brain structural and functional state in the early postresuscitation period. This determines perspectives for the use of GK-2 to prevent and correct posthypoxic encephalopathies. Key words: the nerve growth factor mimetic GK-2, postresuscitation period, neuronal dystrophic changes and death, neurological status.
International Nuclear Information System (INIS)
Slivinsky, V.W.; Drake, R.P.
1985-01-01
The authors intend that Nova be the best diagnosed ICF research facility in operation today. The authors experience in providing advanced diagnostics for previous laser systems will be extended at Nova, and will be challenged by the development of new instrumentation to diagnose the more advanced targets made possible by this powerful laser. Previous experience has shown that to understand target performance, the authors must have as complete a set of diagnostics as possible. The Nova diagnostics are divided into two sets: the basic set required for the initial Nova experiments and the more advanced set for later, generally more complex, experiments. The basic set will be operational for the first Nova shots; it was a Nova line item funded with Nova construction money. This basic set is presented in a table
The synthetic parasite-derived peptide GK1 increases survival in a preclinical mouse melanoma model.
Pérez-Torres, Armando; Vera-Aguilera, Jesús; Hernaiz-Leonardo, Juan Carlos; Moreno-Aguilera, Eduardo; Monteverde-Suarez, Diego; Vera-Aguilera, Carlos; Estrada-Bárcenas, Daniel
2013-11-01
The therapeutic efficacy of a synthetic parasite-derived peptide GK1, an immune response booster, was evaluated in a mouse melanoma model. This melanoma model correlates with human stage IIb melanoma, which is treated with wide surgical excision; a parallel study employing a surgical treatment was carried out as an instructive goal. C57BL/6 mice were injected subcutaneously in the flank with 2×10(5) B16-F10 murine melanoma cells. When the tumors reached 20 mm3, mice were separated into two different groups; the GK1 group, treated weekly with peritumoral injections of GK1 (10 μg/100 μL of sterile saline solution) and the control group, treated weekly with an antiseptic peritumoral injection of 100 μL of sterile saline solution without further intervention. All mice were monitored daily for clinical appearance, tumor size, and survival. Surgical treatment was performed in parallel when the tumor size was 20 mm3 (group A), 500 mm3 (group B), and >500 mm3 (group C). The GK1 peptide effectively increased the mean survival time by 9.05 days, corresponding to an increase of 42.58%, and significantly delayed tumor growth from day 3 to 12 of treatment. In addition, tumor necrosis was significantly increased (pcancers remains to be determined, and surgical removal remains a challenge for any new experimental treatment of melanoma in mouse models.
Zemko, Polina; Orio, Marina
2016-07-01
We present the results of optical and X-ray observations of two quiescent novae, V2491 Cyg and V4743 Sgr. Our observations suggest the intriguing possibility of localization of hydrogen burning in magnetic novae, in which accretion is streamed to the polar caps. V2491 Cyg was observed with Suzaku more than 2 years after the outburst and V4743 Sgr was observed with XMM Newton 2 and 3.5 years after maximum. In the framework of a monitoring program of novae previously observed as super soft X-ray sources we also obtained optical spectra of V4743 Sgr with the SALT telescope 11.5 years after the eruption and of V2491 Cyg with the 6m Big Azimutal Telescope 4 and 7 years post-outburst. In order to confirm the possible white dwarf spin period of V2491 Cyg measured in the Suzaku observations we obtained photometric data using the 90cm WIYN telescope at Kitt Peak and the 1.2 m telescope in Crimea. We found that V4743 Sgr is an intermediate polar (IP) and V2491 Cyg is a strong IP candidate. Both novae show modulation of their X-ray light curves and have X-ray spectra typical of IPs. The Suzaku and XMM Newton exposures revealed that the spectra of both novae have a very soft blackbody-like component with a temperature close to that of the hydrogen burning white dwarfs in their SSS phases, but with flux by at least two orders of magnitude lower, implying a possible shrinking of emitting regions in the thin atmosphere that is heated by nuclear burning underneath it. In quiescent IPs, independently of the burning, an ultrasoft X-ray flux component originates at times in the polar regions irradiated by the accretion column, but the soft component of V4743 Sgr disappeared in 2006, indicating that the origin may be different from accretion. We suggest it may have been due to an atmospheric temperature gradient on the white dwarf surface, or to continuing localized thermonuclear burning at the bottom of the envelope, before complete turn-off. The optical spectra of V2491 Cyg and V
Nova outburst modeling and its application to the recurrent nova phenomenon
International Nuclear Information System (INIS)
Sparks, W.M.; Starrfield, S.; Truran, J.
1985-12-01
The thermonuclear runaway (TNR) theory for the cause of the common novae is reviewed. Numerical simulations of this theory were performed using an implicit hydrodynamic Lagrangian computer code. Relevant physical phenomena are explained with the simpler envelope-in-place calculations. Next the models that include accretion are discussed. The calculations agree very well with observations of common novae. The observational differences between common novae and recurrent novae are examined. We propose input parameters to the TNR model which can give the outburst characteristics of RS Ophiuchi and discuss the implications. This review is concluded with a brief discussion of two current topics in novae research: shear mixing on the white dwarf and Neon novae. 36 refs., 4 figs
UBVJHKLM Photometry and Low-Resolution Spectroscopy of Nova Delphini 2013 (V339 Del
Directory of Open Access Journals (Sweden)
Burlak M. A.
2015-03-01
Full Text Available We present UBVJHKLM photometric observations of Nova Delphini 2013 that started several hours before maximum light and lasted for 130 nights. Using the obtained data, we derived several photometric parameters of the Nova: the time of maximum light, brightness at maximum, rate of decline, t2 = 11 d. This places Nova Del 2013 among fast novae according to the classification introduced by Payne-Gaposchkin. We estimated the interstellar reddening EB−V = 0.18 using maps of Galactic extinction and the absolute brightness in maximum light via the MMRD relation that allowed us to determine the distance D ≈ 2.7 kpc and height above the Galactic plane z ≈ 440 pc. Low-resolution spectroscopy shows that Nova Del 2013 belongs to the Fe II spectral type of novae. The broad emission feature near 6825 Å observed during 2013 August and September may be the Raman-scattered OVI 1032 Å line.
Holomorphic two-spheres in the complex Grassmann manifold G(k, n)
Indian Academy of Sciences (India)
of Sciences, Beijing 100049, People's Republic of China. 2Department of Mathematics, University of Science and Technology of China, Hefei, ..... author's knowledge is concerned, there is no corresponding example or counterexample. Example. Through direct calculations, one can show that f : S2 −→ G(k, 2k) defined by.
Two-Point Codes for the Generalised GK curve
DEFF Research Database (Denmark)
Barelli, Élise; Beelen, Peter; Datta, Mrinmoy
2017-01-01
completely cover and in many cases improve on their results, using different techniques, while also supporting any GGK curve. Our method builds on the order bound for AG codes: to enable this, we study certain Weierstrass semigroups. This allows an efficient algorithm for computing our improved bounds. We......We improve previously known lower bounds for the minimum distance of certain two-point AG codes constructed using a Generalized Giulietti–Korchmaros curve (GGK). Castellanos and Tizziotti recently described such bounds for two-point codes coming from the Giulietti–Korchmaros curve (GK). Our results...
X-RAY FADING AND EXPANSION IN THE “MINIATURE SUPERNOVA REMNANT” OF GK PERSEI
Energy Technology Data Exchange (ETDEWEB)
Takei, D. [Institute of Physical and Chemical Research (RIKEN), RIKEN SPring-8 Center, 1-1-1 Kouto, Sayo, Hyogo 679-5148 (Japan); Drake, J. J.; Slane, P. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Yamaguchi, H. [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Uchiyama, Y. [Department of Physics, Rikkyo University, 3-34-1 Nishi-Ikebukuro, Toshima, Tokyo 171-8501 (Japan); Katsuda, S., E-mail: takei@spring8.or.jp [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, 3-1-1 Yoshino-dai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan)
2015-03-10
We report on a second epoch of Chandra X-ray imaging spectroscopy of the spatially resolved old nova remnant GK Persei. An ACIS-S3 observation of 97.4 ks was conducted in 2013 November after a lapse of 13.8 yr from the last visit in 2000. The X-ray emitting nebula appeared more faint and patchy compared with the first epoch. The flux decline was particularly evident in fainter regions and the mean decline was 30%–40% in the 0.5–1.2 keV energy band. A typical expansion of the brightest part of the remnant was 1.″9, which corresponds to an expansion rate of 0.″14 yr{sup −1}. The soft X-ray spectra extracted from both the 2000 and 2013 data can be explained by a non-equilibrium ionization collisional plasma model convolved with interstellar absorption, though do not allow us to constrain the origin of the flux evolution. The plasma temperature has not significantly evolved since the 2000 epoch and we conclude that the fading of the X-ray emission is due largely to expansion. This implies that recent expansion has been into a lower density medium, a scenario that is qualitatively consistent with the structure of the circumstellar environment photographed soon after the initial explosion more than a century ago. Fainter areas are fading more quickly than brighter areas, indicating that they are fainter because of a lower ambient medium density and consequently more rapid expansion.
Demonstration of efficient full-aperture type I/type II third harmonic conversion on Nova
International Nuclear Information System (INIS)
Wegner, P.J.; Henesian, M.A.; Marchi, F.T.; Speck, D.R.
1988-01-01
The ten arms of the Nova laser system readily deliver 22.5 kJ of third harmonic radiation in 1-ns pulses to targets for fusion experiments. Frequency conversion experiments conducted on a single arm have produced >7.5 kJ of 3ω radiation in longer (2.5-ns) pulses at the output of a Nova crystal array with 15 kJ of 1ω drive. Equivalent on-target energies (40-60 kJ) in 2-3-ns pulses is available at target chamber center when the laser disks in the output section of the Nova amplifier are replaced with new high-damage threshold glass. The remaining issue facing frequency conversion on Nova is to demonstrate similar 3-ω energy (>40 kJ) on-target at shorter (1-ns) pulse lengths with controlled pulse shape at 1→ drive energies up to 9 kJ. Frequency conversion to 40 kJ of 3→ with precisely shaped pulses is required for future experiments. The authors assembled a full-aperture (74-cm) array of these crystals to test on an arm outfitted with the new laser glass. Measurements of conversion efficiency, pulse time history, and optical quality of the converted beam are reported
Directory of Open Access Journals (Sweden)
Hui-peng Song
2011-10-01
Full Text Available A series of novel N-(pyrimidin-4-ylthiazol-2-amine derivatives have been synthesized and evaluated as glucokinase (GK activators. Ethyl 2-(6-(4-(2-hydroxyethylpiperazin-1-yl-2-methylpyrimidin-4-yl-aminothiazole-5-carboxylate was found to be a potent dual-acting hypoglycemic agent activating both GK and PPARγ. When given orally to normal mice, the compound demonstrated significant efficacy in decreasing the glucose level after oral glucose loading.
cAMP-secretion coupling is impaired in diabetic GK/Par rat β-cells: a defect counteracted by GLP-1.
Dolz, Manuel; Movassat, Jamileh; Bailbé, Danielle; Le Stunff, Hervé; Giroix, Marie-Hélène; Fradet, Magali; Kergoat, Micheline; Portha, Bernard
2011-11-01
cAMP-raising agents with glucagon-like peptide-1 (GLP-1) as the first in class, exhibit multiple actions that are beneficial for the treatment of type 2 diabetic (T2D) patients, including improvement of glucose-induced insulin secretion (GIIS). To gain additional insight into the role of cAMP in the disturbed stimulus-secretion coupling within the diabetic β-cell, we examined more thoroughly the relationship between changes in islet cAMP concentration and insulin release in the GK/Par rat model of T2D. Basal cAMP content in GK/Par islets was significantly higher, whereas their basal insulin release was not significantly different from that of Wistar (W) islets. Even in the presence of IBMX or GLP-1, their insulin release did not significantly change despite further enhanced cAMP accumulation in both cases. The high basal cAMP level most likely reflects an increased cAMP generation in GK/Par compared with W islets since 1) forskolin dose-dependently induced an exaggerated cAMP accumulation; 2) adenylyl cyclase (AC)2, AC3, and G(s)α proteins were overexpressed; 3) IBMX-activated cAMP accumulation was less efficient and PDE-3B and PDE-1C mRNA were decreased. Moreover, the GK/Par insulin release apparatus appears less sensitive to cAMP, since GK/Par islets released less insulin at submaximal cAMP levels and required five times more cAMP to reach a maximal secretion rate no longer different from W. GLP-1 was able to reactivate GK/Par insulin secretion so that GIIS became indistinguishable from that of W. The exaggerated cAMP production is instrumental, since GLP-1-induced GIIS reactivation was lost in the presence the AC blocker 2',5'-dideoxyadenosine. This GLP-1 effect takes place in the absence of any improvement of the [Ca(2+)](i) response and correlates with activation of the cAMP-dependent PKA-dependent pathway.
International Nuclear Information System (INIS)
Starrfield, S.G.
1988-01-01
The classical nova outburst occurs on the white dwarf component in a close binary system. Nova systems are members of the general class of cataclysmic variables and other members of the class are the Dwarf Novae, AM Her variables, Intermediate Polars, Recurrent Novae, and some of the Symbiotic variables. Although multiwavelength observations have already provided important information about all of these systems, in this review I will concentrate on the outbursts of the classical and recurrent novae and refer to other members of the class only when necessary. 140 refs., 1 tab
Directory of Open Access Journals (Sweden)
Adeolu A. Adedapo
2016-10-01
Full Text Available All over the world, cardiovascular diseases are a risk factor for poor health and early death with predisposing factors to include age, gender, tobacco use, physical inactivity, excessive alcohol consumption, unhealthy diet, obesity, family history of cardiovascular disease, hypertension, diabetes mellitus, hyperlipidemia, psychosocial factors, poverty and low educational status, and air pollution. It is envisaged that herbal products that can stem this trend would be of great benefit. Garcinia kola (GK, also known as bitter kola is one of such plants. Generally used as a social snack and offered to guests in some cultural settings, bitter kola has been indicated in the treatment of laryngitis, general inflammation, bronchitis, viral infections and diabetes. In this study, the effects of methanol seed extract of Garcinia kola on the proliferation of Vascular Smooth Muscle Cells (VSMCs in cell culture by Angiotensin II (Ang II and LPS-induced NO production were carried out. Confluent VSMCs were exposed to GK (25, 50 and 100 μg/ml before or after treatment with lipopolyssacharide (100μg/ml, and Angiotensin II (10-8-10-6M. Cellular proliferation was determined by MTT assay and NO production by Griess assay. Treatment with Angiotensin II (10-8, 10-6 or LPS significantly enhanced proliferation of VSM cells while LPS significantly increased nitric oxide (NO production. Treatment with GK (25, 50 & 100 μg/ml attenuated VSM cell proliferation. The results indicate that GK has potential to inhibit mitogen activated vascular cell growth and possibly inhibit inflammatory responses to LPS. Thus GK may be useful in condition that is characterized by cellular proliferation and inflammatory responses.
Near-infrared and optical studies of the highly obscured nova V1831 Aquilae (Nova Aquilae 2015)
Banerjee, D. P. K.; Srivastava, Mudit K.; Ashok, N. M.; Munari, U.; Hambsch, F.-J.; Righetti, G. L.; Maitan, A.
2018-01-01
Near-infrared (NIR) and optical photometry and spectroscopy are presented for the nova V1831 Aquilae, covering the early decline and dust-forming phases during the first ∼90 d after its discovery. The nova is highly reddened due to interstellar extinction. Based solely on the nature of the NIR spectrum, we are able to classify the nova to be of the Fe II class. The distance and extinction to the nova are estimated to be 6.1 ± 0.5 kpc and Av ∼ 9.02, respectively. Lower limits of the electron density, emission measure and ionized ejecta mass are made from a Case B analysis of the NIR Brackett lines, while the neutral gas mass is estimated from the optical [O I] lines. We discuss the cause of the rapid strengthening of the He I 1.0830-μm line during the early stages. V1831 Aql formed a modest amount of dust fairly early (∼19.2 d after discovery); the dust shell is not seen to be optically thick. Estimates of the dust temperature, dust mass and grain size are made. Dust formation commences around day 19.2 at a condensation temperature of 1461 ± 15 K, suggestive of a carbon composition, following which the temperature is seen to decrease gradually to 950 K. The dust mass shows a rapid initial increase, which we interpret as being due to an increase in the number of grains, followed by a period of constancy, suggesting the absence of grain destruction processes during this latter time. A discussion of the evolution of these parameters is made, including certain peculiarities seen in the grain radius evolution.
Neon novae, recurrent novae, and type I supernovae
International Nuclear Information System (INIS)
Starrfield, S.; Sparks, W.M.; Truran, J.W.; Shaviv, G.; Illinois Univ., Urbana, IL; Technion-Israel Inst. of Tech., Haifa
1989-01-01
Over the past few years, we have been investigating the effects of accretion onto massive white dwarfs and its implications for their growth in mass toward the Chandrasekhar limit, in attempts to identify a possible relationship between SN I and novae. In our studies we have considered accretion at various mass accretion rates onto a variety of different white dwarf masses. We have found that there is a critical white dwarf mass above which a significant fraction of the accreted mass can remain on the white dwarf after the outburst. Below this value of the white dwarf mass, all of the accreted mass, plus core material dredged up into the envelope, is ejected as a result of the explosion. Our latest results include accretion and boundary layer heating produced by the infalling material. From these studies, we have identified some members of the class of recurrent novae, those involving a thermonuclear runaway, as the novae that are occurring on very massive white dwarfs and evolving toward an SN I explosion. One of the outgrowths of our uv studies of novae in outburst has been the identification of a class of novae which eject material that is very rich in the elements from oxygen to aluminum. We have shown that these outbursts occur on ONeMg white dwarfs, which are necessarily very massive white dwarfs. 11 refs
Shell-type SNRs as sources of cosmic rays
Sinitsyna, V. G.; Andreeva, M. S.; Balygin, K. A.; Borisov, S. S.; Ivanov, I. A.; Kirichenko, A. M.; Klimov, A. I.; Kozhukhova, I. P.; Mirzafatikhov, R. M.; Moseiko, N. I.; Ostashev, I. E.; Palamarchuk, A. I.; Sinitsyna, V. Y.; Volokh, I. G.
2017-06-01
Investigations of VHE gamma-ray sources by any methods, including mirror Cherenkov telescopes, touch on the problem of the cosmic ray origin and, accordingly, the role of the Galaxy in their generation. SHALON observations have yielded results on Galactic supernova remnants (SNR) of different ages. Among them are: the shell-type SNRs Tycho's SNR (1572y), Cas A (1680y), IC 443 (age ˜ (3 ÷ 30) × 103 y), Cygni SNR (age ˜ (5 ÷ 7) × 103 y), G166.0 + 4.3 (age ˜ 24 × 103 y) and the classical nova GK Per (Nova 1901). Observation results are presented for each of the SNRs with spectral energy distributions by SHALON in comparison with other experiment data and images by SHALON together with data from X-rays by Chandra and radio-data by CGPS. The collected experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy 800 GeV-100 TeV gamma-rays in Tycho's SNR, Cas A and IC443. For the first time, unique data on GK Per (Nova1901) TeV gamma-ray emission were obtained with the SHALON experiment. The X-ray data shows that the nova remnant of GK Per could be a younger remnant that will resemble older SNRs like IC 443 which interact with molecular clouds. GK Per is supposed to be a candidate for TeV gamma-ray emission due to accelerated particles in the reverse shock region.
Mikolajewska, Joanna
2010-01-01
The symbiotic novae are thermonuclear novae in symbiotic binary systems -- interacting binaries with evolved red giant donors, and the longest orbital periods. This paper aims at presenting physical characteristics of these objects and discussing their place among the whole family of symbiotic stars.
Farese, R V; Standaert, M L; Yamada, K; Huang, L C; Zhang, C; Cooper, D R; Wang, Z; Yang, Y; Suzuki, S; Toyota, T
1994-11-08
Type II diabetic Goto-Kakizaki (GK) rats were insulin-resistant in euglycemic-hyperinsulinemic clamp studies. We therefore examined insulin signaling systems in control Wistar and diabetic GK rats. Glycerol-3-phosphate acyltransferase (G3PAT), which is activated by headgroup mediators released from glycosyl-phosphatidylinositol (GPI), was activated by insulin in intact and cell-free adipocyte preparations of control, but not diabetic, rats. A specific chiro-inositol-containing inositol phosphoglycan (IPG) mediator, prepared from beef liver, bypassed this defect and comparably activated G3PAT in cell-free adipocyte preparations of both diabetic GK and control rats. A myo-inositol-containing IPG mediator did not activate G3PAT. Relative to control adipocytes, labeling of GPI by [3H]glucosamine was diminished by 50% and insulin failed to stimulate GPI hydrolysis in GK adipocytes. In contrast to GPI-dependent G3PAT activation, insulin-stimulated hexose transport was intact in adipocytes and soleus and gastrocnemius muscles of the GK rat, as was insulin-induced activation of mitogen-activated protein kinase and protein kinase C. We conclude that (i) chiro-inositol-containing IPG mediator activates G3PAT during insulin action, (ii) diabetic GK rats have a defect in synthesizing or releasing functional chiro-inositol-containing IPG, and (iii) defective IPG-regulated intracellular glucose metabolism contributes importantly to insulin resistance in diabetic GK rats.
A statistical analysis of IUE spectra of dwarf novae and nova-like stars
Ladous, Constanze
1990-01-01
First results of a statistical analysis of the IUE International Ultraviolet Explorer archive on dwarf novae and nova like stars are presented. The archive contains approximately 2000 low resolution spectra of somewhat over 100 dwarf novae and nova like stars. Many of these were looked at individually, but so far the collective information content of this set of data has not been explored. The first results of work are reported.
International Nuclear Information System (INIS)
Drake, R.P.
1985-11-01
The Nova laser, at the Lawrence Livermore National Laboratory, provides unique opportunities for target experiments. It has unprecedented energy on target and significant flexibility. The paper presented by John Hunt described the capabilities and the status of Nova. This paper discusses plans for future experiments using Nova, and the present status of target experiments. We plan to perform high-quality physics experiments that exploit the unique capabilities of Nova. Because this is our goal, we are fielding an extensive array of well-characterized target diagnostics to measure the emissions from the target. The first section of this paper discusses the basic target diagnostics. We are also taking care to quantify the performance of the laser
International Nuclear Information System (INIS)
Bruch, A.
1987-01-01
The nature of dwarf novae with their components white dwarf star, cool star, accretion disk, boundary layer and hot spot is investigated. It is shown that very different physical states and processes occur in the components of dwarf novae. Spectroscopical and photometrical observations are carried out. For better understanding the radiation portions of the single dwarf novae components are separated from the total electromagnetic spectrum recieved from the dwarf novae. The model assumptions are compared with the observations and verified
THE {sup 7}Be ii RESONANCE LINES IN TWO CLASSICAL NOVAE V5668 SGR AND V2944 OPH
Energy Technology Data Exchange (ETDEWEB)
Tajitsu, Akito [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Sadakane, Kozo [Astronomical Institute, Osaka Kyoiku University, Asahigaoka, Kashiwara, Osaka 582-8582 (Japan); Naito, Hiroyuki [Nayoro Observatory, 157-1 Nisshin, Nayoro, Hokkaido 096-0066 (Japan); Arai, Akira; Kawakita, Hideyo [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Aoki, Wako, E-mail: tajitsu@naoj.org [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)
2016-02-20
We report spectroscopic observations of the resonance lines of singly ionized {sup 7}Be in the blueshifted absorption line systems found in the post-outburst spectra of two classical novae—V5668 Sgr (Nova Sagittarii 2015 No. 2) and V2944 Oph (Nova Ophiuchi 2015). The unstable isotope {sup 7}Be should have been created during the thermonuclear runaway (TNR) of these novae and decayed to form {sup 7}Li within a short period (a half-life of 53.22 days). These confirmations of {sup 7}Be are the second and the third ones following the first case found in V339 Del by Tajitsu et al. The blueshifted absorption line systems in both novae are clearly divided into two velocity components, both of which contain {sup 7}Be. This means that the absorbing gases in both velocity components consist of products of TNR. We estimated the amounts of {sup 7}Be produced during the outbursts of both novae and concluded that significant {sup 7}Li should have been created. These findings strongly suggest that the explosive production of {sup 7}Li via the reaction {sup 3}He(α,γ){sup 7}Be and its subsequent decay to {sup 7}Li occurs frequently among classical novae and contributes to the process of Galactic Li enrichment.
Brazil Geological Basic Survey Program - Ponte Nova - Sheet SF.23-X-B-II - Minas Gerais State
International Nuclear Information System (INIS)
Brandalise, L.A.
1991-01-01
The present report refers to the Ponte Nova Sheet (SF.23-X-B-II) systematic geological mapping, on the 1:100.000 scale. The Sheet covers the Zona da Mata region, Minas Gerais State, in the Mantiqueira Geotectonic Province, to the eastern part of Sao Francisco Geotectonic Province, as defined in the project. The high grade metamorphic rocks to low amphibolite, occurring in the area were affected by a marked low angle shearing transposition, and show diphtheritic effects. Archaean to Proterozoic ages are attributed to the metamorphites mostly by comparison to similar types of the region. Three deformed events were registered in the region. Analysis of the crustal evolution pattern based on geological mapping, laboratorial analyses, gravimetric and air magnetometry data, and available geochronologic data is given in the 6. Chapter, Part II, in the text. Major element oxides, trace-elements, and rare-earths elements were analysed to establish parameters for the rocks environment elucidation. Geochemical survey was carried out with base on pan concentrated and stream sediments distributed throughout the Sheet. Gneisses quarries (industrial rocks) in full exploration activity have been registered, as well as sand and clay deposits employed in construction industry. Metallogenetic/Provisional analysis points out the area as a favorable one for gold prospection. (author)
2012-01-01
As announced in the previous Bulletin, Novae has opened a new snack bar on the Flagstaff car park, just a few metres from CERN's reception area (Building 33). Just a few metres from the CERN Reception, the new Novae snack point welcomes visitors and CERNois. Opening hours Currently: Monday to Friday, 8 a.m. to 4 p.m. From September: Monday to Friday, 7:45 a.m. to 5 p.m.; Saturdays from 8 a.m. to 2 p.m. The snack bar selection includes breakfast, starting at 2.70 CHF, cold dishes from 5 CHF, and hot dishes from 6 CHF. Novae has also installed a 24-hour-a-day food vending machine in the CERN hostel (Building 39) and in Building 13. You can buy pasta and cooked dishes for 6.50 CHF to 8 CHF. In addition, a groceries vending machine has been installed in the main building, just across from the news kiosk. Nearly 60 different items are available around the clock. Finally, Novae has introduced a new payment system in several buildings on the Meyrin site. It accepts credit ca...
International Nuclear Information System (INIS)
Shara, M.M.; Potter, M.; Shara, D.J.
1989-01-01
Three of the oldest recovered novae were monitored with a CCD camera almost nightly for six weeks. The cyclic variability reported by Della Valle and Rosino (1987) for Nova Oph 1848 is confirmed. A similar variability is also suggested for Nova Cyg 1876, though this system exhibits more random flickering than Nova Oph. No secular variability is seen in Nova Sge 1783. 12 refs
Directory of Open Access Journals (Sweden)
Layla Amiri
2015-07-01
Full Text Available Background/Aim: Type 2 diabetes is the most common metabolic disorder, characterized by insulin resistance and pancreatic islet beta-cell failure. The most common complications associated with type 2 diabetes are hyperinsulinemia, hyperglycemia, hyperlipidemia, increased inflammatory and reduced insulin response. Aspirin (ASA and other non-steroidal anti-inflammatory drugs (NSAIDs have been associated with the prevention of diabetes, obesity and related cardiovascular disorders. Aspirin has been used in many clinical and experimental trials for the prevention of diabetes and associated complications. Methods: In this study, five month old Goto-Kakizaki (GK rats, which showed signs of mild hyperglycemia (fasting blood glucose 80-95 mg/dl vs 55-60 mg/dl Wistar control rats were used. Two subgroups of GK and Wistar control rats were injected intraperitoneally with 100 mg aspirin/kg body weight/ day for 5 weeks. Animals were sacrificed and blood and tissues were collected after performing glucose tolerance (2 h post 2g IP glucose ingestion tests in experimental and control groups. Results: Aspirin caused a moderate decrease in hyperglycemia. However, we observed a significant improvement in glucose tolerance after ASA treatment in GK rats compared to the nondiabetic Wistar rats. Also, the ASA treated GK rats exhibited a significant decrease in insulinemia. ASA treatment also caused a marked reduction in the pro-inflammatory prostaglandin, PGE2, which was significantly higher in GK rats. On the other hand, no significant organ toxicity was observed after ASA treatment at this dose and time period. However, the total cholesterol and lipoprotein levels were significantly increased in GK rats, which decreased after ASA treatment. Immunofluorescence staining for insulin/glucagon secreting pancreatic cells showed improved beta-cell structural and functional integrity in ASA-treated rats which was also confirmed by SDS-PAGE and Western blot analysis
Šimon, V.
2015-03-01
Context. GK Per is an intermediate polar that has been displaying dwarf nova outbursts since the middle of the twentieth century. Aims: I analyzed a series of such outbursts in the optical and X-ray bands. I pay attention to the relation of intensities of the optical and X-ray emissions, and its reproducibility in a series of these consecutive outbursts. Methods: This analysis uses the data from the BAT/Swift, ASM/RXTE, AAVSO, and AFOEV databases. It investigates the relation of the time evolution of the profiles of outbursts in the individual bands (hard X-ray, medium/hard X-ray, and optical). Results: This analysis shows that the X-ray intensity steeply rises only in the start of the optical outburst and steeply declines only when the optical outburst comes to its end. However, the 1.5-50 keV band intensity saturates and balances on a plateau during the outburst. (The longer the outburst, the longer its plateau.) The peak X-ray intensities of this series display a significantly narrower range than the optical ones (a factor of about two versus a factor of about eight). This implies a discrepancy between the mass flow through the disk and the production of the X-ray emission via bremsstrahlung at the polar caps of the white dwarf. This discrepancy is the largest in the time of the peak optical intensity when the whole disk (or at least its inner part) is in the hot state and the flow of matter through the disk is the greatest. This study shows that a series of outbursts constitutes more general properties of this discrepancy. I argue that the saturation of the X-ray luminosity in outburst cannot be caused by a dominant increase in X-ray absorption. In the interpretation, large structural changes of the accreting regions at the magnetic poles of the white dwarf occur during the outburst. A buried shock proposed by some authors for polars is also promising for explaining the X-ray light curves of outbursts of GK Per. This research made use of the BAT/Swift, ASM
Nova frequency conversion and focusing system
International Nuclear Information System (INIS)
Summers, M.A.; Seppala, L.G.; Williams, J.D.
1985-01-01
New developments in crystal array technology provided significant improvements in the mechanical design and optical performance of the Nova 2 omega/3 omega array hardware. The final Nova array configuration was tested on the Novette laser and on the first arm of Nova. Ten Nova 2 omega/3 omega crystal arrays were assembled and tested for crystal alignment and wave front distortion before installation on the Nova target chamber. Ten Nova focus lens positioners were assembled and tested last year. The positioning accuracy and repeatability of each assembly were evaluated before installation on the target chamber. A cylindrical focusing system was also developed for installation in the Nova lens positioner assembly. Finally, 10 completed frequency conversion and focusing systems were activated
Directory of Open Access Journals (Sweden)
Guo Jingsheng
2012-12-01
Full Text Available Abstract Background Neointimal formation plays an important role in the pathogenesis of coronary restenosis after percutaneous coronary intervention (PCI, especially in patients with diabetes mellitus. Recently, some studies have shown that 5-ethynyl-2'-deoxyuridine (EdU incorporation can serve as a novel alternative to the 5-bromo-2'-deoxyuridine (BrdU antibody detection method for detection of DNA synthesis in regenerating avian cochlea, chick embryo and the adult nervous system. However, few studies have been performed to assess the suitability of EdU for detecting DNA synthesis in vascular neointima. Methods The carotid artery balloon injury model was established in Goto-Kakizaki (GK and Wistar rats. A Cell-LightTM EdU Kit was used to detect EdU-labeled cell nuclei of common carotid arteries at day 7 after catheter balloon injury. Different methods of injecting EdU were tested. The protein levels of proliferating cell nuclear antigen (PCNA and p-Akt (Ser473, as well as the mRNA levels of PCNA were evaluated by Western blotting and quantitative real-time PCR (qRT-PCR, respectively. Immunohistochemical staining was also employed to visualize PCNA-positive cells. Results At day 7 after catheter balloon injury, far more EdU-positive and PCNA-positive cells were observed in GK rats. When comparing groups that received different EdU doses, it was found that the percentage of EdU-positive cells at a dose of 100 mg/kg body weight was than at doses of 25 mg/kg and 50 mg/kg. The number of positive cells was significantly higher in the repeated injection group compared to the single injection group. Further, after balloon injury DNA synthesis in GK rats was more notable than in Wistar rats. Neointimal formation in GK rats was more obvious than in Wistar rats. The protein levels of PCNA and p-Akt (Ser473 and the mRNA levels of PCNA were increased in injured rats as compared to uninjured rats, and were significantly higher in GK rats than in Wistar rats
Quark-Nova Explosion inside a Collapsar: Application to Gamma Ray Bursts
Directory of Open Access Journals (Sweden)
Rachid Ouyed
2009-01-01
Full Text Available If a quark-nova occurs inside a collapsar, the interaction between the quark-nova ejecta (relativistic iron-rich chunks and the collapsar envelope leads to features indicative of those observed in Gamma Ray Bursts. The quark-nova ejecta collides with the stellar envelope creating an outward moving cap (Γ∼ 1–10 above the polar funnel. Prompt gamma-ray burst emission from internal shocks in relativistic jets (following accretion onto the quark star becomes visible after the cap becomes optically thin. Model features include (i precursor activity (optical, X-ray, γ-ray, (ii prompt γ-ray emission, and (iii afterglow emission. We discuss SN-less long duration GRBs, short hard GRBs (including association and nonassociation with star forming regions, dark GRBs, the energetic X-ray flares detected in Swift GRBs, and the near-simultaneous optical and γ-ray prompt emission observed in GRBs in the context of our model.
Uranium in Nova Scotia: a background summary for the uranium inquiry, Nova Scotia
International Nuclear Information System (INIS)
1982-01-01
Since the mid 1970's Nova Scotia has experienced increased exploration for a number of commodities including uranium. The exploration activity for uranium has resulted in discovery of significant occurrences of the element. It became obvious to the Government of Nova Scotia that a segment of the population of the Province is concerned about the potential hazards associated with the exploration, mining and milling stages of the uranium industry. Public concern has resulted in the appointment of a Commissioner under the Public Inquiries Act of Nova Scotia to inquire and make recommendations to the Governor-in-Council on all aspects of exploration, development, mining, processing, storage, waste management and transportation of uranium in any form. The regulation of mineral exploration and mining activities is carried out by the Nova Scotia Department of Mines and Energy through the Mineral Resources Act of the Province of Nova Scotia. The regulation of the special radioactive aspects involved in the mining and processing of uranium ore is the responsibility of the federal Atomic Energy Control Board. The purposes of this report is to: outline the history of uranium exploration in Nova Scotia; summarize the results of geological surveys by provincial and federal government agencies, universities and exploration companies which document the natural levels of radioactivity in the Province; briefly outline the physical and chemical characteristics of uranium and thorium which make these elements unique and a potential environmental and health concern; outline chronologically the steps taken by the Nova Scotia Department of Mines and Energy to monitor and regulate uranium exploration activities; classify the types of uranium deposits known to occur in Nova Scotia and describe their main geological features; outline the role of the Nova Scotia Department of Mines and Energy in the regulation of mining activities in the Province. The report is written for the interested
The NOvA Technical Design Report
International Nuclear Information System (INIS)
Ayres, D.S.; Drake, G.R.; Goodman, M.C.; Grudzinski, J.J.; Guarino, V.J.; Talaga, R.L.; Zhao, A.; Stamoulis, P.; Stiliaris, E.; Tzanakos, G.; Zois, M.
2007-01-01
Technical Design Report (TDR) describes the preliminary design of the NOvA accelerator upgrades, NOvA detectors, detector halls and detector sites. Compared to the March 2006 and November 2006 NOvA Conceptual Design Reports (CDR), critical value engineering studies have been completed and the alternatives still active in the CDR have been narrowed to achieve a preliminary technical design ready for a Critical Decision 2 review. Many aspects of NOvA described this TDR are complete to a level far beyond a preliminary design. In particular, the access road to the NOvA Far Detector site in Minnesota has an advanced technical design at a level appropriate for a Critical Decision 3a review. Several components of the accelerator upgrade and new neutrino detectors also have advanced technical designs appropriate for a Critical Decision 3a review. Chapter 1 is an Executive Summary with a short description of the NOvA project. Chapter 2 describes how the Fermilab NuMI beam will provide a narrow band beam of neutrinos for NOvA. Chapter 3 gives an updated overview of the scientific basis for the NOvA experiment, focusing on the primary goal to extend the search for ν μ → ν e oscillations and measure the sin 2 (2θ 13 ) parameter. This parameter has not been measured in any previous experiment and NOvA would extend the search by about an order of magnitude beyond the current limit. A secondary goal is to measure the dominant mode oscillation parameters, sin 2 (2θ 23 ) and Δm 32 2 to a more precise level than previous experiments. Additional physics goals for NOvA are also discussed. Chapter 4 describes the Scientific Design Criteria which the Fermilab accelerator complex, NOvA detectors and NOvA detector sites must satisfy to meet the physics goals discussed in Chapter 3. Chapter 5 is an overview of the NOvA project. The changes in the design relative to the NOvA CDR are discussed. Chapter 6 summarizes the NOvA design performance relative to the Design Criteria set out
Climate change in Nova Scotia : a background paper to guide Nova Scotia's climate change action plan
International Nuclear Information System (INIS)
2007-10-01
Climate change causes changes in the temperature of the earth, the level of the sea, and the frequency of extreme weather conditions. The province of Nova Scotia recently released an act related to environmental goals and sustainable prosperity. Addressing climate change is a key element in achieving Nova Scotia's sustainable prosperity goals outlined in the act. The Nova Scotia Department of Energy is working towards developing both policy and action, to help meet its target of a 10 per cent reduction in greenhouse gases from 1990 levels by the year 2020. Two major plans are underway, notably a climate change action plan and a renewed energy strategy. This report provided background information on Nova Scotia's climate change action plan. It discussed climate change issues affecting Nova Scotia, air pollutants, energy sources in Nova Scotia, energy consumers in the province, and Nova Scotia's approach to climate change. The report also discussed actions underway and funding sources. It was concluded that in order for the climate change action plan to be successful, Nova Scotians must use energy more efficiently; use renewable energy; use cleaner energy; and plan for change. 13 refs., 2 tabs., 6 figs., 4 appendices
The NOvA Technical Design Report
Energy Technology Data Exchange (ETDEWEB)
Ayres, D.S.; Drake, G.R.; Goodman, M.C.; Grudzinski, J.J.; Guarino, V.J.; Talaga, R.L.; Zhao, A.; /Argonne; Stamoulis, P.; Stiliaris, E.; Tzanakos, G.; Zois, M.; /Athens U. /Caltech /UCLA /Fermilab /College de France /Harvard U. /Indiana U. /Lebedev Inst. /Michigan State U. /Minnesota U., Duluth /Minnesota U.
2007-10-08
Technical Design Report (TDR) describes the preliminary design of the NOvA accelerator upgrades, NOvA detectors, detector halls and detector sites. Compared to the March 2006 and November 2006 NOvA Conceptual Design Reports (CDR), critical value engineering studies have been completed and the alternatives still active in the CDR have been narrowed to achieve a preliminary technical design ready for a Critical Decision 2 review. Many aspects of NOvA described this TDR are complete to a level far beyond a preliminary design. In particular, the access road to the NOvA Far Detector site in Minnesota has an advanced technical design at a level appropriate for a Critical Decision 3a review. Several components of the accelerator upgrade and new neutrino detectors also have advanced technical designs appropriate for a Critical Decision 3a review. Chapter 1 is an Executive Summary with a short description of the NOvA project. Chapter 2 describes how the Fermilab NuMI beam will provide a narrow band beam of neutrinos for NOvA. Chapter 3 gives an updated overview of the scientific basis for the NOvA experiment, focusing on the primary goal to extend the search for {nu}{sub {mu}} {yields} {nu}{sub e} oscillations and measure the sin{sup 2}(2{theta}{sub 13}) parameter. This parameter has not been measured in any previous experiment and NOvA would extend the search by about an order of magnitude beyond the current limit. A secondary goal is to measure the dominant mode oscillation parameters, sin{sup 2}(2{theta}{sub 23}) and {Delta}m{sub 32}{sup 2} to a more precise level than previous experiments. Additional physics goals for NOvA are also discussed. Chapter 4 describes the Scientific Design Criteria which the Fermilab accelerator complex, NOvA detectors and NOvA detector sites must satisfy to meet the physics goals discussed in Chapter 3. Chapter 5 is an overview of the NOvA project. The changes in the design relative to the NOvA CDR are discussed. Chapter 6 summarizes the NOvA
Nova laser assurance-management system
International Nuclear Information System (INIS)
Levy, A.J.
1983-01-01
In a well managed project, Quality Assurance is an integral part of the management activities performed on a daily basis. Management assures successful performance within budget and on schedule by using all the good business, scientific, engineering, quality assurance, and safety practices available. Quality assurance and safety practices employed on Nova are put in perspective by integrating them into the overall function of good project management. The Nova assurance management system was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management system. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project
School Psychology in Nova Scotia
King, Sara; McGonnell, Melissa; Noyes, Amira
2016-01-01
Registration as a psychologist in Nova Scotia can be at the master's or doctoral level; however, the Nova Scotia Board of Examiners in Psychology has announced a move to the doctoral degree as the entry-level to practice. Many school psychologists in Nova Scotia practice at the master's level; therefore, this change could affect school psychology…
Explosive hydrogen burning in novae
International Nuclear Information System (INIS)
Wiescher, M.; Goerres, J.; Thielemann, F.K.; Ritter, H.
1986-01-01
Recent observations (nova CrA 81 and Aql 82) reported large enhancements of element abundances beyond CNO nuclei in nova ejecta, which still wait for a clear theoretical explanation. Attempts to interprete these findings include scenarios like nova events on a O-Ne-Mg white dwarf or nuclear processing which enables the transfer of CNO material to heavier nuclei. In the present study we included all available nuclear information on proton-rich unstable nuclei, to update thermo-nuclear reaction rates in explosive hydrogen burning. They are applied in a systematic analysis of explosive hydrogen burning for a variety of temperature conditions, appropriate to nova explosions. We find that (a) for temperatures T>2 10 8 K, pre-existing material in Ne, Al, or Mg can be transferred to heavier nuclei following the flow pattern of a r(apid) p(roton-capture) process (b) for T> or approx.3.5 10 8 K CNO matter can be processed to heavier nuclei (in accordance with previous findings). On the basis of these results it seems unlikely that nova Aql 82 (which shows strong carbon and oxygen enrichment together with heavier elements) can be explained by a nova event on a bare O-Ne-Mg white dwarf but is rather a result of burning with T> or approx.3.5 10 8 K. An application to existing nova models shows a reduced 26 Al production, when compared to earlier predictions. Both conclusions, however, have to be verified by complete nova calculations which include the improved nuclear physics input, presented here. (orig.)
Searching for nova shells around cataclysmic variables
Sahman, D. I.; Dhillon, V. S.; Knigge, C.; Marsh, T. R.
2015-08-01
We present the results of a search for nova shells around 101 cataclysmic variables (CVs), using H α images taken with the 4.2-m William Herschel Telescope (WHT) and the 2.5-m Isaac Newton Telescope Photometric H α Survey of the Northern Galactic Plane (IPHAS). Both telescopes are located on La Palma. We concentrated our WHT search on nova-like variables, whilst our IPHAS search covered all CVs in the IPHAS footprint. We found one shell out of the 24 nova-like variables we examined. The newly discovered shell is around V1315 Aql and has a radius of ˜2.5 arcmin, indicative of a nova eruption approximately 120 yr ago. This result is consistent with the idea that the high mass-transfer rate exhibited by nova-like variables is due to enhanced irradiation of the secondary by the hot white dwarf following a recent nova eruption. The implications of our observations for the lifetime of the nova-like variable phase are discussed. We also examined four asynchronous polars, but found no new shells around any of them, so we are unable to confirm that a recent nova eruption is the cause of the asynchronicity in the white dwarf spin. We find tentative evidence of a faint shell around the dwarf nova V1363 Cyg. In addition, we find evidence for a light echo around the nova V2275 Cyg, which erupted in 2001, indicative of an earlier nova eruption ˜300 yr ago, making V2275 Cyg a possible recurrent nova.
Observations of classical novae in outburst
Starrfield, S.; Stryker, L. L.; Sonneborn, G.; Sparks, Warren M.; Ferland, Gary; Wagner, R. M.; Williams, R. E.; Gehrz, Robert D.; Ney, Edward P.; Kenyon, Scott
1988-01-01
The IUE obtained ultraviolet data on novae in outburst. The characteristics of every one of the outbursts are different. Optical and infrared data on many of the same novae were also obtained. Three members of the carbon-oxygen class of novae are presented.
Energy Technology Data Exchange (ETDEWEB)
Shafter, A. W. [Department of Astronomy, San Diego State University, San Diego, CA 92182 (United States); Henze, M. [European Space Astronomy Centre, P.O. Box 78, E-28692 Villanueva de la Cañada, Madrid (Spain); Rector, T. A. [Department of Physics and Astronomy, University of Alaska Anchorage, 3211 Providence Dr., Anchorage, AK 99508 (United States); Schweizer, F. [Carnegie Observatories, 813 Santa Barbara St., Pasadena, CA 91101 (United States); Hornoch, K. [Astronomical Institute, Academy of Sciences, CZ-251 65 Ondřejov (Czech Republic); Orio, M. [Astronomical Observatory of Padova (INAF), I-35122 Padova (Italy); Pietsch, W. [Max Planck Institute for Extraterrestrial Physics, P.O. Box 1312, Giessenbachstr., D-85741, Garching (Germany); Darnley, M. J.; Williams, S. C.; Bode, M. F. [Astrophysics Research Institute, Liverpool John Moores University, Liverpool L3 5RF (United Kingdom); Bryan, J., E-mail: aws@nova.sdsu.edu [McDonald Observatory, Austin, TX 78712 (United States)
2015-02-01
The reported positions of 964 suspected nova eruptions in M31 recorded through the end of calendar year 2013 have been compared in order to identify recurrent nova (RN) candidates. To pass the initial screen and qualify as a RN candidate, two or more eruptions were required to be coincident within 0.′1, although this criterion was relaxed to 0.′15 for novae discovered on early photographic patrols. A total of 118 eruptions from 51 potential RN systems satisfied the screening criterion. To determine what fraction of these novae are indeed recurrent, the original plates and published images of the relevant eruptions have been carefully compared. This procedure has resulted in the elimination of 27 of the 51 progenitor candidates (61 eruptions) from further consideration as RNe, with another 8 systems (17 eruptions) deemed unlikely to be recurrent. Of the remaining 16 systems, 12 candidates (32 eruptions) were judged to be RNe, with an additional 4 systems (8 eruptions) being possibly recurrent. It is estimated that ∼4% of the nova eruptions seen in M31 over the past century are associated with RNe. A Monte Carlo analysis shows that the discovery efficiency for RNe may be as low as 10% that for novae in general, suggesting that as many as one in three nova eruptions observed in M31 arise from progenitor systems having recurrence times ≲100 yr. For plausible system parameters, it appears unlikely that RNe can provide a significant channel for the production of Type Ia supernovae.
Nova-driven winds in globular clusters
International Nuclear Information System (INIS)
Scott, E.H.; Durisen, R.H.
1978-01-01
Recent sensitive searches for Hα emission from ionized intracluster gas in globular clusters have set upper limits that conflict with theoretical predictions. We suggest that nova outbursts heat the gas, producing winds that resolve this discrepancy. The incidence of novae in globular clusters, the conversion of kinetic energy of the nova shell to thermal energy of the intracluster gas, and the characteristics of the resultant winds are discussed. Calculated emission from the nova-driven models does not conflict with any observations to date. Some suggestions are made concerning the most promising approaches for future detection of intracluster gas on the basis of these models. The possible relationship of nova-driven winds of globular cluster X-ray sources is also considered
Gillespie, S. A.; Parikh, A.; Barton, C. J.; Faestermann, T.; José, J.; Hertenberger, R.; Wirth, H.-F.; de Séréville, N.; Riley, J. E.; Williams, M.
2017-08-01
Sulphur isotopic ratio measurements may help to establish the astrophysical sites in which certain presolar grains were formed. Nova model predictions of the 34S/32S ratio are, however, unreliable due to the lack of an experimental 34S(p ,γ )35Cl reaction rate. To this end, we have measured the 34S(3He,d )35Cl reaction at 20 MeV using a high resolution quadrupole-dipole-dipole-dipole magnetic spectrograph. Twenty-two levels over 6.2 MeV rate has been determined using a Monte Carlo method. Hydrodynamic nova model calculations have been performed using this new reaction rate. These models show that remaining uncertainties in the 34S(p ,γ ) rate affect nucleosynthesis predictions by less than a factor of 1.4, and predict a 34S/32S isotopic ratio of 0.014-0.017. Since recent type II supernova models predict 34S/32S=0.026 -0.053 , the 34S/32S isotopic ratio may be used, in conjunction with other isotopic signatures, to distinguish presolar grains from oxygen-neon nova and type II supernova origin. Our results address a key nuclear physics uncertainty on which recent considerations discounting the nova origin of several grains depend.
Synoptic GNIRS XD Spectra ToO Novae
Woodward, Chick; Helton, Andrew; Spitzer/Chandra Team
2007-02-01
Novae are important contributors to galactic chemical enrichment on local scales. NIR spectroscopy of novae provides information about the elemental abundances of the gas and dust in the ejecta dispersing into the ISM as well as kinematic information related to the outburst. We propose to obtain synoptic GNIRS spectra of select Target of Opportunity (ToO) novae in the Magellanic Clouds (MC) and the galaxy to study the dynamics of the ejecta, to determine the temporal evolution of coronal lines and recombination lines (measuring their strength and velocity profiles), and to determine abundances. Being all equidistant, MC nova permit a more robust analysis of distant-dependent physical parameters of outburst than is generally possible for Galactic novae. The GNIRS data will provide critical spectral coverage and synoptic data to complement extant Spitzer and Chandra nova programs. Triggering of the GNIRS program will occur when a nova becomes brighter than V=12 mag, (assuming that adequate PWFS guide stars exist) as reported in the IAUC or CBET.
Polarimetry and spectroscopy of the "oxygen flaring" DQ Herculis-like nova: V5668 Sagittarii (2015)
Harvey, E. J.; Redman, M. P.; Darnley, M. J.; Williams, S. C.; Berdyugin, A.; Piirola, V. E.; Fitzgerald, K. P.; O'Connor, E. G. P.
2018-03-01
Context. Classical novae are eruptions on the surface of a white dwarf in a binary system. The material ejected from the white dwarf surface generally forms an axisymmetric shell of gas and dust around the system. The three-dimensional structure of these shells is difficult to untangle when viewed on the plane of the sky. In this work a geometrical model is developed to explain new observations of the 2015 nova V5668 Sagittarii. Aim. We aim to better understand the early evolution of classical nova shells in the context of the relationship between polarisation, photometry, and spectroscopy in the optical regime. To understand the ionisation structure in terms of the nova shell morphology and estimate the emission distribution directly following the light curve's dust-dip. Methods: High-cadence optical polarimetry and spectroscopy observations of a nova are presented. The ejecta is modelled in terms of morpho-kinematics and photoionisation structure. Results: Initially observational results are presented, including broadband polarimetry and spectroscopy of V5668 Sgr nova during eruption. Variability over these observations provides clues towards the evolving structure of the nova shell. The position angle of the shell is derived from polarimetry, which is attributed to scattering from small dust grains. Shocks in the nova outflow are suggested in the photometry and the effect of these on the nova shell are illustrated with various physical diagnostics. Changes in density and temperature as the super soft source phase of the nova began are discussed. Gas densities are found to be of the order of 109 cm-3 for the nova in its auroral phase. The blackbody temperature of the central stellar system is estimated to be around 2.2 × 105 K at times coincident with the super soft source turn-on. It was found that the blend around 4640 Å commonly called "nitrogen flaring" is more naturally explained as flaring of the O II multiplet (V1) from 4638-4696 Å, i.e. "oxygen flaring
Optical evolution of Nova Ophiuchi 2007 = V2615 Oph
Munari, U.; Henden, A.; Valentini, M.; Siviero, A.; Dallaporta, S.; Ochner, P.; Tomasoni, S.
2008-06-01
The moderately fast Nova Oph 2007 reached maximum brightness on 2007 March 28 at V= 8.52, B-V=+1.12, V-RC=+0.76, V-IC=+1.59 and RC-IC=+0.83, after fast initial rise and a pre-maximum halt lasting a week. Decline times were tV2= 26.5, tB2= 30, tV3= 48.5 and tB3= 56.5 d. The distance to the nova is d= 3.7 ± 0.2 kpc, the height above the Galactic plane is z= 215 pc, the reddening is E(B-V) = 0.90 and the absolute magnitude at maximum is MmaxV=-7.2 and MmaxB=-7.0. The spectrum four days before maximum resembled a F6 supergiant, in an agreement with broad-band colours. It later developed into that of a standard `Fe ii'-class nova. Nine days past maximum, the expansion velocity estimated from the width of Hα emission component was ˜730 km s-1, and the displacement from it of the principal and diffuse-enhanced absorption systems was ˜650 and 1380 km s-1, respectively. Dust probably formed and disappeared during the period from 82 to 100 d past maximum, causing (at peak dust concentration) an extinction of ΔB= 1.8 mag and an extra ΔE(B-V) = 0.44 reddening.
Dolz, Manuel; Bailbé, Danielle; Giroix, Marie-Hélène; Calderari, Sophie; Gangnerau, Marie-Noelle; Serradas, Patricia; Rickenbach, Katharina; Irminger, Jean-Claude; Portha, Bernard
2005-11-01
Because acetylcholine (ACh) is a recognized potentiator of glucose-stimulated insulin release in the normal beta-cell, we have studied ACh's effect on islets of the Goto-Kakizaki (GK) rat, a spontaneous model of type 2 diabetes. We first verified that ACh was able to restore the insulin secretory glucose competence of the GK beta-cell. Then, we demonstrated that in GK islets 1) ACh elicited a first-phase insulin release at low glucose, whereas it had no effect in Wistar; 2) total phospholipase C activity, ACh-induced inositol phosphate production, and intracellular free calcium concentration ([Ca2+]i) elevation were normal; 3) ACh triggered insulin release, even in the presence of thapsigargin, which induced a reduction of the ACh-induced [Ca2+]i response (suggesting that ACh produces amplification signals that augment the efficacy of elevated [Ca2+]i on GK exocytosis); 4) inhibition of protein kinase C did not affect [Ca2+]i nor the insulin release responses to ACh; and 5) inhibition of cAMP-dependent protein kinases (PKAs), adenylyl cyclases, or cAMP generation, while not affecting the [Ca2+]i response, significantly lowered the insulinotropic response to ACh (at low and high glucose). In conclusion, ACh acts mainly through activation of the cAMP/PKA pathway to potently enhance Ca2+-stimulated insulin release in the GK beta-cell and, in doing so, normalizes its defective glucose responsiveness.
Isotopic 32S/33S ratio as a diagnostic of presolar grains from novae
Directory of Open Access Journals (Sweden)
A. Parikh
2014-10-01
Full Text Available Measurements of sulphur isotopes in presolar grains can help to identify the astrophysical sites in which these grains were formed. A more precise thermonuclear rate of the 33S(p,γ34Cl reaction is required, however, to assess the diagnostic ability of sulphur isotopic ratios. We have studied the 33S(3He,d34Cl proton-transfer reaction at 25 MeV using a high-resolution quadrupole–dipole–dipole–dipole magnetic spectrograph. Deuteron spectra were measured at ten scattering angles between 10° and 55°. Twenty-four levels in 34Cl over Ex=4.6–5.9 MeV were observed, including three levels for the first time. Proton spectroscopic factors were extracted for the first time for levels above the 33S + p threshold, spanning the energy range required for calculations of the thermonuclear 33S(p,γ34Cl rate in classical nova explosions. We have determined a new 33S(p,γ34Cl rate using a Monte Carlo method and have performed new hydrodynamic nova simulations to determine the impact on nova nucleosynthesis of remaining nuclear physics uncertainties in the reaction rate. We find that these uncertainties lead to a factor of ≤5 variation in the 33S(p,γ34Cl rate over typical nova peak temperatures, and variation in the ejected nova yields of SCa isotopes by ≤20%. In particular, the predicted 32S/33S ratio is 110–130 for the nova model considered, compared to 110–440 with previous rate uncertainties. As recent type II supernova models predict ratios of 130–200, the 32S/33S ratio may be used to distinguish between grains of nova and supernova origin.
Farese, R V; Standaert, M L; Yamada, K; Huang, L C; Zhang, C; Cooper, D R; Wang, Z; Yang, Y; Suzuki, S; Toyota, T
1994-01-01
Type II diabetic Goto-Kakizaki (GK) rats were insulin-resistant in euglycemic-hyperinsulinemic clamp studies. We therefore examined insulin signaling systems in control Wistar and diabetic GK rats. Glycerol-3-phosphate acyltransferase (G3PAT), which is activated by headgroup mediators released from glycosyl-phosphatidylinositol (GPI), was activated by insulin in intact and cell-free adipocyte preparations of control, but not diabetic, rats. A specific chiro-inositol-containing inositol phosph...
WGBH-TV, Boston, MA.
News clippings, reviews, and feature articles about the Public Broadcasting System science-adventure series "Nova" are collected here. Included are comments from the New York Times, Washington Post, Christian Science Monitor, and TV Guide. Commentaries are primarily favorable and include synopses of various episodes. (DGC)
Directory of Open Access Journals (Sweden)
K. Mukai
2015-02-01
Full Text Available In recent years, recurrent nova eruptions are often observed very intensely in wide range of wavelengths from radio to optical to X-rays. Here I present selected highlights from recent multi-wavelength observations. The enigma of T Pyx is at the heart of this paper. While our current understanding of CV and symbiotic star evolution can explain why certain subset of recurrent novae have high accretion rate, that of T Pyx must be greatly elevated compared to the evolutionary mean. At the same time, we have extensive data to be able to estimate how the nova envelope was ejected in T Pyx, and it turns to be a rather complex tale. One suspects that envelope ejection in recurrent and classical novae in general is more complicated than the textbook descriptions. At the end of the review, I will speculate that these two may be connected.
Theory of Nova Outbursts and Type Ia Supernovae
Directory of Open Access Journals (Sweden)
M. Kato
2015-02-01
Full Text Available We briefly review the current theoretical understanding of the light curves of novae. These curves exhibit a homologous nature, dubbed the universal decline law, and when time-normalized, they almost follow a single curve independently of the white dwarf (WD mass or chemical composition of the envelope. The optical and near-infrared light curves of novae are reproduced mainly by free-free emission from their optically thick winds. We can estimate the WD mass from multiwavelength observations because the optical, UV, and soft X-ray light curves evolve differently and we can easily resolve the degeneracy of the optical light curves. Recurrent novae and classical novae are a testbed of type Ia supernova scenarios. In the orbital period versus secondary mass diagram, recurrent novae are located in different regions from classical novae and the positions of recurrent novae are consistent with the single degenerate scenario.
Pulsed power supply for Nova Upgrade
International Nuclear Information System (INIS)
Bacon, J.L.; Kajs, J.P.; Walls, A.; Weldon, W.F.; Zowarka, R.C.
1992-01-01
This report describes work carried out at the Center for Electromechanics at The University of Texas at Austin (CEM-UT). A baseline design of the Nova Upgrade has been completed by Lawrence Livermore National Laboratory. The Nova Upgrade is an 18 beamline Nd: glass laser design utilizing fully relayed 4x4 30 cm aperture segmented optical components. The laser thus consists of 288 independent beamlets nominally producing 1.5 to 2.0 MJ of 0.35 μm light in a 3 to 5 ns pulse. The laser design is extremely flexible and will allow a wide range of pulses to irradiate ICF targets. This facility will demonstrate ignition/gain and the scientific feasibility of ICF for energy and defense applications. The pulsed power requirements for the Nova Upgrade are given. CEM-UT was contracted to study and develop a design for a homopolar generator/inductor (HPG/inductor) opening switch system which would satisfy the pulsed power supply requirements of the Nova Upgrade. The Nd:glass laser amplifiers used in the Nova Upgrade will be powered by light from xenon flashlamps. The pulsed power supply for the Nova Upgrade powers the xenon flashlamps. This design and study was for a power supply to drive flashlamps
DEFF Research Database (Denmark)
Petersen, Nicoline Jacoby; Bræstrup, Lise
"Bossa Nova" giver dig de bedste bud på, hvordan du takler den menneskelige dimension i ledelse. Når du bevæger dig ud på gulvet, opstår der konflikter, kærlighed, jalousi og vrede. Pludselig opdager du, at medarbejdere tænker meget anderledes end dig selv, har forskellige behov og af og til......, kriser og meget andet. Her er værdifulde iagttagelser og tips, som enhver leder ? uanset branche ? kan bruge i sin dagligdag. "Bossa Nova" er uundværlig for den, der vil lære mere om, hvordan man får mennesker til at præstere det sublime, så ledelse bliver en dans, hvor alle kan følge takten....
Absolute spectrophotometry of Nova Cygni 1975
International Nuclear Information System (INIS)
Kontizas, E.; Kontizas, M.; Smyth, M.J.
1976-01-01
Radiometric photoelectric spectrophotometry of Nova Cygni 1975 was carried out on 1975 August 31, September 2, 3. α Lyr was used as reference star and its absolute spectral energy distribution was used to reduce the spectrophotometry of the nova to absolute units. Emission strengths of Hα, Hβ, Hγ (in W cm -2 ) were derived. The Balmer decrement Hα:Hβ:Hγ was compared with theory, and found to deviate less than had been reported for an earlier nova. (author)
Microturbulence as a third dimension in the G-K giant region of the HR diagram
International Nuclear Information System (INIS)
Foy, R.
1978-01-01
The structure of the HR diagram in the G-K giant region is complex, because of the funneling effect and of the intersection of evolutionary tracks for different stellar masses. Therefore it is impossible to derive the age of a cool giant from its location in the HR diagram alone. To remove this indeterminacy a third dimension is needed, and the author suggests microturbulence as the appropriate observational parameter. (Auth.)
NOVA Corporation of Alberta annual report, 1992
International Nuclear Information System (INIS)
1993-01-01
Nova Corporation and its related businesses are involved in natural gas production, gas pipelines, consulting services, and upgrading of natural gas into chemicals and plastics. Nova owns Alberta Gas Transmission Division, the primary gas transportation system in Alberta, with 11,400 miles of pipeline and total deliveries in 1992 of 3.4 trillion ft 3 . Nova also owns 50% of Foothills Pipe Lines Ltd., one of Canada's largest carriers of exported gas, and 50% of TQM Pipeline Partnership, which transports natural gas in Quebec. Nova conducts its chemicals business through Novacor Chemicals Ltd., which has plants in Alberta, Ontario, Quebec, and the USA. Novacor's major petrochemicals are methanol, ethylene, propylene, and styrene and its major plastics are polystyrene, polypropylene, and polyethylene. Nova's gas-producing branch Novalta Resources produced 26 billion ft 3 of natural gas in 1992 and has proven reserves of 334 billion ft 3 . Nova's net income in 1992 was $164 million, compared to only $46 million in 1991. The company's operations, along with management discussion and analysis, are presented for 1992 and financial statements are included. 20 figs., 43 tabs
Shara, Michael M.; Doyle, Trisha F.; Pagnotta, Ashley; Garland, James T.; Lauer, Tod R.; Zurek, David; Baltz, Edward A.; Goerl, Ariel; Kovetz, Attay; Machac, Tamara; Madrid, Juan P.; Mikołajewska, Joanna; Neill, J. D.; Prialnik, Dina; Welch, D. L.; Yaron, Ofer
2018-02-01
Ten weeks of daily imaging of the giant elliptical galaxy M87 with the Hubble Space Telescope (HST) has yielded 41 nova light curves of unprecedented quality for extragalactic cataclysmic variables. We have recently used these light curves to demonstrate that the observational scatter in the so-called maximum-magnitude rate of decline (MMRD) relation for classical novae is so large as to render the nova-MMRD useless as a standard candle. Here, we demonstrate that a modified Buscombe-de Vaucouleurs hypothesis, namely that novae with decline times t2 > 10 d converge to nearly the same absolute magnitude about two weeks after maximum light in a giant elliptical galaxy, is supported by our M87 nova data. For 13 novae with daily sampled light curves, well determined times of maximum light in both the F606W and F814W filters, and decline times t2 > 10 d we find that M87 novae display M606W,15 = -6.37 ± 0.46 and M814W,15 = -6.11 ± 0.43. If very fast novae with decline times t2 < 10 d are excluded, the distances to novae in elliptical galaxies with stellar binary populations similar to those of M87 should be determinable with 1σ accuracies of ± 20 per cent with the above calibrations.
Photometry and polarimetry of Nova Andromedae 1986
Energy Technology Data Exchange (ETDEWEB)
Kikuchi, Sen; Mikami, Yoshitaka; Kondo, Masayuki
1988-01-01
We have carried out photometry of Nova Andromedae 1986 and find that it should be classified as a fast nova. We have also made polarimetry simultaneously at six wavelengths between 0.36-0.70 ..mu..m. The polarization increased between 2 and 22 days after the light maximum showing that dust formation was associated with the nova explosion.
The Development of Geo-KOMPSAT-2A (GK-2A) Convective Initiation Algorithm over the Korea peninsular
Kim, H. S.; Chung, S. R.; Lee, B. I.; Baek, S.; Jeon, E.
2016-12-01
The rapid development of convection can bring heavy rainfall that suffers a great deal of damages to society as well as threatens human life. The high accurate forecast of the strong convection is essentially demanded to prevent those disasters from the severe weather. Since a geostationary satellite is the most suitable instrument for monitoring the single cloud's lifecycle from its formation to extinction, it has been attempted to capture the precursor signals of convection clouds by satellite. Keeping pace with the launch of Geo-KOMPSAT-2A (GK-2A) in 2018, we planned to produce convective initiation (CI) defined as the indicator of potential cloud objects to bring heavy precipitation within two hours. The CI algorithm for GK-2A is composed of four stages. The beginning is to subtract mature cloud pixels, a sort of convective cloud mask by visible (VIS) albedo and infrared (IR) brightness temperature thresholds. Then, the remained immature cloud pixels are clustered as a cloud object by watershed techniques. Each clustering object is undergone 'Interest Fields' tests for IR data that reflect cloud microphysical properties at the current and their temporal changes; the cloud depth, updraft strength and production of glaciations. All thresholds of 'Interest fields' were optimized for Korean-type convective clouds. Based on scores from tests, it is decided whether the cloud object would develop as a convective cell or not. Here we show the result of case study in this summer over the Korea peninsular by using Himawari-8 VIS and IR data. Radar echo and data were used for validation. This study suggests that CI products of GK-2A would contribute to enhance accuracy of the very short range forecast over the Korea peninsular.
The UBV Color Evolution of Classical and Symbiotic Novae
Directory of Open Access Journals (Sweden)
I. Hachisu
2015-02-01
Full Text Available We identified a general course of classical nova outbursts in the B − V vs. U − B diagram. It has been reported that novae show spectra similar to A–F supergiants near optical light maximum. However, they do not follow the supergiant sequence in the color-color diagram, neither the blackbody nor the main-sequence sequence. Instead, we found that novae evolve along a new sequence in the pre-maximum and near-maximum phases, which we call the nova-giant sequence. This sequence is parallel to but Δ(U − B ≈ −0.2 mag bluer than the supergiant sequence. After optical maximum, its color quickly evolves back blueward along the same nova-giant sequence and reaches the point of free-free emission (B − V = −0.03, U − B = −0.97 and stays there for a while, which is coincident with the intersection of the blackbody sequence and the nova-giant sequence. Then the color evolves leftward (blueward in B − V but almost constant in U − B due mainly to development of strong emission lines. This is the general course of nova outbursts in the color-color diagram, which is deduced from eight well-observed novae including various speed classes. For a nova with unknown extinction, we can determine a reliable value of the color excess by matching the observed track of the target nova with this general course. This is a new and convenient method for obtaining color excesses of classical novae. Using this method, we redetermined the color excesses of nineteen well-observed novae.
International Nuclear Information System (INIS)
Lea, N.
1996-01-01
The involvement of the Calgary-based company NOVA Gas International (NGI) in Malaysia's peninsular gas utilization (PGU) project, was described. Phase I and II of the project involved linking onshore gas processing plants with a natural gas transmission system. Phase III of the PGU project was a gas transmission pipeline that began midway up the west coast of peninsular Malaysia to the Malaysia-Thailand border. The complex 549 km pipeline included route selection, survey and soil investigation, archaeological study, environmental impact assessment, land acquisition, meter-station construction, telecommunication systems and office buildings. NGI was the prime contractor on the project through a joint venture with OGP Technical Services, jointly owned by NGI and Petronas, the Thai state oil company. Much of NGI's success was attributed to excellent interpersonal skills, particularly NGI's ability to build confidence and credibility with its Thai partners
A nova outburst powered by shocks
Li, Kwan-Lok; Metzger, Brian D.; Chomiuk, Laura; Vurm, Indrek; Strader, Jay; Finzell, Thomas; Beloborodov, Andrei M.; Nelson, Thomas; Shappee, Benjamin J.; Kochanek, Christopher S.; Prieto, José L.; Kafka, Stella; Holoien, Thomas W.-S.; Thompson, Todd A.; Luckas, Paul J.; Itoh, Hiroshi
2017-10-01
Classical novae are runaway thermonuclear burning events on the surfaces of accreting white dwarfs in close binary star systems, sometimes appearing as new naked-eye sources in the night sky1. The standard model of novae predicts that their optical luminosity derives from energy released near the hot white dwarf, which is reprocessed through the ejected material2-5. Recent studies using the Fermi Large Area Telescope have shown that many classical novae are accompanied by gigaelectronvolt γ-ray emission6,7. This emission likely originates from strong shocks, providing new insights into the properties of nova outflows and allowing them to be used as laboratories for the study of the unknown efficiency of particle acceleration in shocks. Here, we report γ-ray and optical observations of the Milky Way nova ASASSN-16ma, which is among the brightest novae ever detected in γ-rays. The γ-ray and optical light curves show a remarkable correlation, implying that the majority of the optical light comes from reprocessed emission from shocks rather than the white dwarf8. The ratio of γ-ray to optical flux in ASASSN-16ma directly constrains the acceleration efficiency of non-thermal particles to be around 0.005, favouring hadronic models for the γ-ray emission9. The need to accelerate particles up to energies exceeding 100 gigaelectronvolts provides compelling evidence for magnetic field amplification in the shocks.
X-ray Modeling of Classical Novae
Nemeth, Peter
2010-01-01
It has been observed and theoretically supported in the last decade that the peak of the spectral energy distribution of classical novae gradually shifts to higher energies at constant bolometric luminosity after a nova event. For this reason, comprehensive evolutionary studies require spectral analysis in multiple spectral bands. After a nova explosion, the white dwarf can maintain stable surface hydrogen burning, the duration of which strongly correlates with the white dwarf mass. During this stage the peak of the luminosity is in the soft X-ray band (15 - 60 Angstroms). By extending the modeling range of TLUSTY/SYNSPEC, I analyse the luminosity and abundance evolution of classical novae. Model atoms required for this work were built using atomic data from NIST/ASD and TOPBASE. The accurate but incomplete set of energy levels and radiative transitions in NIST were completed with calculated data from TOPBASE. Synthetic spectra were then compared to observed data to derive stellar parameters. I show the capabilities and validity of this project on the example of V4743 Sgr. This nova was observed with both Chandra and XMM-Newton observatories and has already been modeled by several scientific groups (PHOENIX, TMAP).
Aprendizagens e novas tecnologias
Directory of Open Access Journals (Sweden)
Pedro Demo
2011-06-01
Full Text Available Pretendo aqui, muito preliminarmente, reunir alguns argumentos favoráveis à multiplicidade de oportunidades de aprender que o aluno pode encontrar hoje em ambientes de aprendizagem mediados por novas tecnologias. Centro-me principalmente na desconstrução de algumas resistências pedagógicas (EVANS, 2001 ainda persistentes entre nós como “transmissão de conteúdos”; agarramento a uma única teoria; fixação na aula instrucionista; extirpação/endeusamento de processos avaliativos, etc. Procuro ver, em um vasto âmbito de ofertas teóricas, componentes atualmente ressaltados na discussão tecnológica em vigor, com o objetivo de indicar oportunidades de reconstrução muito aproveitável de autores e clássicos, uma vez que aprender bem não foi algo inventado pelas novas tecnologias; sempre existiu e os grandes pedagogos tiveram consciência disso, insinuando infinitas maneiras de aprender bem (DEMO, 2008. As novas tecnologias proporcionam oportunidades ainda mais ampliadas, em meio também a enormes riscos e desacertos. O que menos interessa aqui é incidir em panaceias tecnológicas, bem a gosto do consumismo neoliberal. Interessa, porém, explorar novas oportunidades de aprendizagem, bem mais centradas na atividade dos alunos, flexíveis, motivadoras e capazes de sustentar processos de autoria e autonomia.
A semi-supervised method to detect seismic random noise with fuzzy GK clustering
International Nuclear Information System (INIS)
Hashemi, Hosein; Javaherian, Abdolrahim; Babuska, Robert
2008-01-01
We present a new method to detect random noise in seismic data using fuzzy Gustafson–Kessel (GK) clustering. First, using an adaptive distance norm, a matrix is constructed from the observed seismic amplitudes. The next step is to find centres of ellipsoidal clusters and construct a partition matrix which determines the soft decision boundaries between seismic events and random noise. The GK algorithm updates the cluster centres in order to iteratively minimize the cluster variance. Multiplication of the fuzzy membership function with values of each sample yields new sections; we name them 'clustered sections'. The seismic amplitude values of the clustered sections are given in a way to decrease the level of noise in the original noisy seismic input. In pre-stack data, it is essential to study the clustered sections in a f–k domain; finding the quantitative index for weighting the post-stack data needs a similar approach. Using the knowledge of a human specialist together with the fuzzy unsupervised clustering, the method is a semi-supervised random noise detection. The efficiency of this method is investigated on synthetic and real seismic data for both pre- and post-stack data. The results show a significant improvement of the input noisy sections without harming the important amplitude and phase information of the original data. The procedure for finding the final weights of each clustered section should be carefully done in order to keep almost all the evident seismic amplitudes in the output section. The method interactively uses the knowledge of the seismic specialist in detecting the noise
Thermonuclear reaction rate of 17O(p,γ)18F
International Nuclear Information System (INIS)
Fox, C.; Iliadis, C.; Champagne, A.E.; Fitzgerald, R.P.; Longland, R.; Newton, J.; Pollanen, J.; Runkle, R.
2005-01-01
The 17 O(p,γ) 18 F and 17 O(p,α) 14 N reactions have a profound influence on hydrogen-burning nucleosynthesis in a number of stellar sites, including red giants, asymptotic giant branch (AGB) stars, massive stars, and classical novae. Previously evaluated thermonuclear rates for both reactions carry large uncertainties. We investigated the proton-capture reaction on 17 O in the bombarding energy range of E p lab = 180-540 keV. We observed a previously undiscovered resonance at E R lab = 193.2 ± 0.9 keV. The resonance strength amounts to (ωγ) pγ (1.2±0.2)x10 -6 eV. With this value, the uncertainties of the 17 O(p,γ) 18 F reaction rates are reduced by orders of magnitude in the peak temperature range of classical novae (T=0.1-0.4 GK). We also report on a reevaluation of the 17 O(p,γ) 18 F reaction rates at lower temperatures that are pertinent to red giants, AGB stars, or massive stars. The present work establishes the 17 O(p,γ) 18 F reaction rates over a temperature range of T= 0.01-1.5 GK with statistical uncertainties of 10-50%. The new recommended reaction rates deviate from the previously accepted values by an order of magnitude around T≅0.2 GK and by factors of 2-3 at T < 0.1 GK
Imaging the Ejecta in Classical Novae
Linford, Justin
2016-10-01
A nova outburst results when sufficient mass accretes from a companion star onto the surface of a white dwarf, triggering a thermonuclear explosion. In classical novae the bulk of the emission comes from the warm, expanding ejecta. The prevailing theories assume that the explosion occurs as a single, spherically symmetric ejection event and predict a simple relationship between the white dwarf mass, the accretion rate, and the mass loss and energetics of the explosion. However, observations with modern instruments indicate that nova eruptions are far from simple. There is now evidence for multiple ejection events, common envelopes, non-spherical geometry, and even jet-like structures in the ejecta. Our ENova collaboration combines radio, mm, optical, and X-ray observations and detailed theoretical modelling to study the most common major explosions in the universe. Among our results so far are the direct demonstration of the importance of shocks in novae, including the detection of gamma-ray producing shocks in several sources, and the realization that multiple, long-lived outflows are much more common than previously assumed. Here we propose to continue these highly successful observations with coordinated detailed VLA radio interferometry and HST optical imaging and spectroscropy of several recent novae with substantial VLA monitoring already in progress.
Classical and Recurrent Novae as Quintessential Panchromatic Transients
Mukai, K.; Nelson, T.; Chomiuk, L.; Finzell, T.; Linford, J.; Mioduszewski, A.; Rupen, M.; Sokoloski, J.; Weston, J.
2014-07-01
In classical and recurrent novae, thermonuclear runaway (TNR) of accreted material on the white dwarf surface results in ejection of 10^{-6} to 10^{-4} solar masses at velocities of order 1000 km s^{-1}. They are routinely detected as transients from X-rays to radio, and 6 novae (so far) have also been detected in GeV gamma-rays with Fermi/LAT. It appears that all the nearby novae are detected with Fermi, suggesting gamma-ray emission to be a universal property of novae, while a few exceptional novae further away are also detected, indicating that the gamma-ray luminosity of novae varies from system to system. Here we present selected results from our multi-wavelength observations of recent classical and recurrent novae and discuss evidence for multiple, discrete mass ejection episodes driven by a single TNR. The collision among these shells create shocks that can be observed through synchrotron radio emission and optically thin, thermal, hard X-ray emission. We do not find obvious correlation between the X-ray flux and the GeV flux, even though the latter must also result from shocks. It is clear that shocks can either be efficient particle accelerator or efficient thermal X-ray emitter, but not necessarily both at the same time.
Nucleosynthesis in nova outbursts
International Nuclear Information System (INIS)
Iliadis, C.; Azuma, R.E.; Buchmann, L.
1994-02-01
Astronomical observations have shown that He, CNO material and/or heavy elements are considerably enriched in certain nova ejecta relative to solar matter. The heavy element enrichments can be explained by the dredge-up of matter from an underlying ONeMg white dwarf and subsequent redistribution of the material by the rp-process. The proton capture reactions on 32 S and 36 A r important for hydrogen burning during nova outbursts have been measured experimentally. The derived stellar reaction rates have been incorporated into large-scale network calculations and the astrophysical consequences are discussed. (author)
Time-Dependent Dust Formation in Novae
Directory of Open Access Journals (Sweden)
Kyung-Won Suh
1991-06-01
Full Text Available The dust formation processes in novae are investigated with close attention to recent infrared observations. Using mainly the classical nucleation theory, we have calculated the time scales of dust formation and growth in the environments of novae. Those time scales roughly resemble the typical observations. We have classified the dust-forming novae into three classes according to their explosion properties and the thermodynamic properties of dust grains. Oxygen grains from much later than carbon grains because of their thermodynamic properties. The effect of grain formation to the efficiency of stellar winds to drive the material outward is tested with newly obtained Planck mean values of dust grains.
2014-01-01
Novae lance une enquête de satisfaction auprès de ses clients. Vous pouvez accéder au questionnaire au sujet des trois restaurants d’entreprise du CERN en utilisant le lien et les codes ci-dessous. Le délai de réponse est fixé au jeudi 29 mai. https://survey.mis-trend.ch/NOVAE Voici les codes à introduire (en respectant la casse) pour entrer dans le questionnaire, selon le site : CERN Restaurant n°1 : CERN114 CERN Restaurant n°2 : CERN214 CERN Restaurant n°3 : CERN314 Nous attirons votre attention sur le fait que tout questionnaire rempli sera validé. Nous vous prions donc de ne pas utiliser ce lien pour tester le questionnaire. Merci d’avance pour votre collaboration. L'équipe Novae
On Presolar Stardust Grains from CO Classical Novae
Iliadis, Christian; Downen, Lori N.; José, Jordi; Nittler, Larry R.; Starrfield, Sumner
2018-03-01
About 30%–40% of classical novae produce dust 20–100 days after the outburst, but no presolar stardust grains from classical novae have been unambiguously identified yet. Although several studies claimed a nova paternity for certain grains, the measured and simulated isotopic ratios could only be reconciled, assuming that the grains condensed after the nova ejecta mixed with a much larger amount of close-to-solar matter. However, the source and mechanism of this potential post-explosion dilution of the ejecta remains a mystery. A major problem with previous studies is the small number of simulations performed and the implied poor exploration of the large nova parameter space. We report the results of a different strategy, based on a Monte Carlo technique, that involves the random sampling over the most important nova model parameters: the white dwarf composition; the mixing of the outer white dwarf layers with the accreted material before the explosion; the peak temperature and density; the explosion timescales; and the possible dilution of the ejecta after the outburst. We discuss and take into account the systematic uncertainties for both the presolar grain measurements and the simulation results. Only those simulations that are consistent with all measured isotopic ratios of a given grain are accepted for further analysis. We also present the numerical results of the model parameters. We identify 18 presolar grains with measured isotopic signatures consistent with a CO nova origin, without assuming any dilution of the ejecta. Among these, the grains G270_2, M11-334-2, G278, M11-347-4, M11-151-4, and Ag26 have the highest probability of a CO nova paternity.
MID-INFRARED SPECTROSCOPIC OBSERVATIONS OF THE DUST-FORMING CLASSICAL NOVA V2676 OPH
Energy Technology Data Exchange (ETDEWEB)
Kawakita, Hideyo; Arai, Akira; Shinnaka, Yoshiharu [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Ootsubo, Takafumi [Department of Earth Science and Astronomy, Graduate School of Arts and Sciences, The University of Tokyo, 3-8-1 Komaba, Meguro-ku, Tokyo 153-8902 (Japan); Nagashima, Masayoshi, E-mail: kawakthd@cc.kyoto-su.ac.jp [Department of Physics, Faculty of Science, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan)
2017-02-01
The dust-forming nova V2676 Oph is unique in that it was the first nova to provide evidence of C{sub 2} and CN molecules during its near-maximum phase and evidence of CO molecules during its early decline phase. Observations of this nova have revealed the slow evolution of its lightcurves and have also shown low isotopic ratios of carbon ({sup 12}C/{sup 13}C) and nitrogen ({sup 14}N/{sup 15}N) in its envelope. These behaviors indicate that the white dwarf (WD) star hosting V2676 Oph is a CO-rich WD rather than an ONe-rich WD (typically larger in mass than the former). We performed mid-infrared spectroscopic and photometric observations of V2676 Oph in 2013 and 2014 (respectively 452 and 782 days after its discovery). No significant [Ne ii] emission at 12.8 μ m was detected at either epoch. These provided evidence for a CO-rich WD star hosting V2676 Oph. Both carbon-rich and oxygen-rich grains were detected in addition to an unidentified infrared feature at 11.4 μ m originating from polycyclic aromatic hydrocarbon molecules or hydrogenated amorphous carbon grains in the envelope of V2676 Oph.
NUCLEAR MIXING METERS FOR CLASSICAL NOVAE
Energy Technology Data Exchange (ETDEWEB)
Kelly, Keegan J.; Iliadis, Christian; Downen, Lori; Champagne, Art [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599-3255 (United States); José, Jordi [Departament de Física i Enginyeria Nuclear, EUETIB, Universitat Politècnica de Catalunya, E-08036 Barcelona (Spain)
2013-11-10
Classical novae are caused by mass transfer episodes from a main-sequence star onto a white dwarf via Roche lobe overflow. This material possesses angular momentum and forms an accretion disk around the white dwarf. Ultimately, a fraction of this material spirals in and piles up on the white dwarf surface under electron-degenerate conditions. The subsequently occurring thermonuclear runaway reaches hundreds of megakelvin and explosively ejects matter into the interstellar medium. The exact peak temperature strongly depends on the underlying white dwarf mass, the accreted mass and metallicity, and the initial white dwarf luminosity. Observations of elemental abundance enrichments in these classical nova events imply that the ejected matter consists not only of processed solar material from the main-sequence partner but also of material from the outer layers of the underlying white dwarf. This indicates that white dwarf and accreted matter mix prior to the thermonuclear runaway. The processes by which this mixing occurs require further investigation to be understood. In this work, we analyze elemental abundances ejected from hydrodynamic nova models in search of elemental abundance ratios that are useful indicators of the total amount of mixing. We identify the abundance ratios ΣCNO/H, Ne/H, Mg/H, Al/H, and Si/H as useful mixing meters in ONe novae. The impact of thermonuclear reaction rate uncertainties on the mixing meters is investigated using Monte Carlo post-processing network calculations with temperature-density evolutions of all mass zones computed by the hydrodynamic models. We find that the current uncertainties in the {sup 30}P(p, γ){sup 31}S rate influence the Si/H abundance ratio, but overall the mixing meters found here are robust against nuclear physics uncertainties. A comparison of our results with observations of ONe novae provides strong constraints for classical nova models.
Nucleosynthesis in nova outbursts
Energy Technology Data Exchange (ETDEWEB)
Iliadis, C [TRIUMF, Vancouver, BC (Canada); [Univ. of Toronto, McLennan Physical Labs., Toronto, ON (Canada); Azuma, R E [Univ. of Toronto, McLennan Physical Lab., Toronto, ON (Canada); Buchmann, L [TRIUMF, Vancouver, BC (Canada); and others
1994-02-01
Astronomical observations have shown that He, CNO material and/or heavy elements are considerably enriched in certain nova ejecta relative to solar matter. The heavy element enrichments can be explained by the dredge-up of matter from an underlying ONeMg white dwarf and subsequent redistribution of the material by the rp-process. The proton capture reactions on 32{sup S} and 36{sup A}r important for hydrogen burning during nova outbursts have been measured experimentally. The derived stellar reaction rates have been incorporated into large-scale network calculations and the astrophysical consequences are discussed. (author) 17 refs., 2 figs.
The distances of the Galactic Novae
Ozdonmez, Aykut; Guver, Tolga; Cabrera-Lavers, Antonio; Ak, Tansel
2016-07-01
Using location of the RC stars on the CMDs obtained from the UKIDSS, VISTA and 2MASS photometry, we have derived the reddening-distance relations towards each Galactic nova for which at least one independent reddening measurement exists. We were able to determine the distances of 72 Galactic novae and set lower limits on the distances of 45 systems. The reddening curves of the systems are presented. These curves can be also used to estimate reddening or the distance of any source, whose location is close to the position of the nova in our sample. The distance measurement method in our study can be easily applicable to any source, especially for ones that concentrated along the Galactic plane.
Nova: the laser fusion breakeven experiment
International Nuclear Information System (INIS)
Godwin, R.O.; Glaze, J.A.; Hagen, W.F.; Holzrichter, J.F.; Simmons, W.W.; Trenholme, J.B.
1979-01-01
A new laboratory building is being constructed adjacent to the Shiva laser to house the Phase I $137M ten-beam Nova laser and a target chamber designed for twenty beams. The first ten beams will be operational in early 1980. Following Phase I, it is planned that the Shiva laser will be shut down and upgraded into ten Nova laser beams. These beams will then be combined with Nova Phase I beams to provide the full twenty beams having a minimum output energy of 300 kJ in a 3 nc pulse, or a power capability of 300 terawatts (10 12 watts) in a 100 ps pulse. This paper will describe the Phase I engineering project
Can isolated single black holes produce X-ray novae?
Matsumoto, Tatsuya; Teraki, Yuto; Ioka, Kunihito
2018-03-01
Almost all black holes (BHs) and BH candidates in our Galaxy have been discovered as soft X-ray transients, so-called X-ray novae. X-ray novae are usually considered to arise from binary systems. Here, we propose that X-ray novae are also caused by isolated single BHs. We calculate the distribution of the accretion rate from interstellar matter to isolated BHs, and find that BHs in molecular clouds satisfy the condition of the hydrogen-ionization disc instability, which results in X-ray novae. The estimated event rate is consistent with the observed one. We also check an X-ray novae catalogue (Corral-Santana et al.) and find that 16/59 ˜ 0.27 of the observed X-ray novae are potentially powered by isolated BHs. The possible candidates include IGR J17454-2919, XTE J1908-094, and SAX J1711.6-3808. Near-infrared photometric and spectroscopic follow-ups can exclude companion stars for a BH census in our Galaxy.
A Radio Emission Analysis of Classical Nova V351 Pup (1991)
Wendeln, Carolyn; Chomiuk, Laura; Finzell, Thomas; Linford, Justin D.; Strader, Jay
2017-05-01
Previously, Nova Puppis 1991 (V351 Pup) was measured to host one of the most massive ejections claimed in the literature. Multi-frequency radio detections from one epoch were published for this nova in the 1990's; and yet, the remaining data collected by the Karl G. Jansky Very Large Array (VLA) have remained unpublished. In this paper, we analyze the remaining unpublished data sets for V351 Pup at frequencies of 4.9, 8.4, 14.9, and 22.5 GHz. We fit the resulting light curve to a model of expanding thermal ejecta, under the assumption that the radio emission is dominated by free-free radiation and accounting for high levels of clumping in the ejecta. Images of V351 Pup in both the radio (from the VLA) and Hα+[N II] (from Hubble Space Telescope) exhibit no aspherical structure, strengthening our assumption of spherical symmetry. From expansion parallax methods, we estimate the distance to V351 Pup to be 5.0 ± 1.5 kpc. Our light-curve fit yields a value of {{log}}10({M}{ej})=-5.2+/- 0.7 {M}⊙ for the ejecta mass, implying that V351 Pup is on the low end of expectations for ejecta mass from classical novae. A comparison between our derived ejecta mass and theoretical models gives evidence for a very massive (1.25 {M}⊙ ) white dwarf, which is consistent with spectroscopic evidence for an oxygen-neon white dwarf.
Assaly-Kaddoum, Rana; Giuliano, François; Laurin, Miguel; Gorny, Diane; Kergoat, Micheline; Bernabé, Jacques; Vardi, Yoram; Alexandre, Laurent; Behr-Roussel, Delphine
2016-09-01
Erectile dysfunction is highly prevalent in type II diabetes mellitus. Low intensity extracorporeal shock wave therapy improves erectile function in patients with erectile dysfunction of vasculogenic origin, including diabetes. However, its mode of action remains unknown. We investigated the effects of low intensity extracorporeal shock wave therapy compared to or combined with sildenafil on erectile dysfunction in a type II diabetes mellitus model. Our purpose was to test our hypothesis of a mode of action targeting the cavernous nitric oxide/cyclic guanosine monophosphate pathway. GK rats, a validated model of type II diabetes mellitus, and age matched Wistar rats were treated with low intensity extracorporeal shock wave therapy twice weekly for 3 weeks. Treatment was repeated after a 3-week no-treatment interval. The penis was stretched and dipped in a specifically designed water-filled cage. Shock waves were delivered by a calibrated probe yielding a controlled energy flux density (0.09 mJ/mm(2)). The probe was attached to an electrohydraulic unit with a focused shock wave source, allowing for accurate extrapolation to humans. Following a 4-week washout period erectile function was assessed as well as endothelium dependent and independent, and nitrergic relaxations of the corpus cavernosum of GK rats. Low intensity extracorporeal shock wave therapy significantly improved erectile function in GK rats to the same extent as sildenafil. Treatment effects were potentiated when combined with sildenafil. Shock wave effects were not associated with improved cavernous endothelium dependent or independent, or nitrergic reactivity. Low intensity extracorporeal shock wave therapy improved erectile function in GK rats. Unexpectedly, this was not mediated by a nitric oxide/cyclic guanosine monophosphate dependent mechanism. Sildenafil increased shock wave efficacy. This preclinical paradigm to deliver low intensity extracorporeal shock wave therapy to the rat penis should
SN 2010U: A LUMINOUS NOVA IN NGC 4214
International Nuclear Information System (INIS)
Humphreys, Roberta M.; Helton, L. Andrew; Prieto, Jose L.; Rosenfield, Philip; Williams, Benjamin; Murphy, Jeremiah; Dalcanton, Julianne; Gilbert, Karoline; Kochanek, Christopher S.; Stanek, K. Z.; Khan, Rubab; Szczygiel, Dorota; Mogren, Karen; Fesen, Robert A.; Milisavljevic, Dan
2010-01-01
The luminosity, light curve, post-maximum spectrum, and lack of a progenitor on deep pre-outburst images suggest that SN 2010U was a luminous, fast nova. Its outburst magnitude is consistent with that for a fast nova using the maximum magnitude-rate of decline relationship for classical novae.
Nova Aquilae 1982: the nature of its dust
International Nuclear Information System (INIS)
Longmore, A.J.; Williams, P.M.
1984-01-01
Infrared photometric measurements of Nova Aquilae 1982, covering a period from 37 to 261 days after its discovery, have been obtained. Thermal emission was present even from the first observation. The observations show that the conventional picture of dust forming in the nova ejecta does not apply in this case, and suggest that a re-examination of the infrared modelling of earlier novae would be worthwhile. (U.K.)
Dust formation and ionization in novae
International Nuclear Information System (INIS)
Yamamoto, Tetsuo; Sato, Shuji; Nariai, Kyoji.
1979-01-01
In order to explain the fact that some novae show the increase of infrared radiation indicating the formation of circumstellar dust grains while some others do not, the theory that the formation of dust in the circumstellar envelope of a nova depends on the intensity of ultraviolet radiation from a central star has been presented. It is known that the central star of a nova emits radiation at nearly constant rate, and its effective temperature rises. It was concluded that the novae with higher emission than a certain value are the poor candidates for dust formation because the whole envelope is ionized before dust is formed. But this conclusion is misleading. The evolution of the ultraviolet radiation emanating from a central star is summarized. The condensation of grains is possible when the partial pressure of the vapor, from which the grains are formed, becomes higher than the saturation vapor pressure. The temperature of grains can be estimated by equating the radiations absorbed and emitted. The grains evaporate if the grain temperature is higher than the condensation temperature. The formation of a Stroemgren sphere in the exploding envelope of a nova is discussed. For the formation of grains, it is necessary that temperature drops below the condensation temperature before the whole envelope is ionized. Hence dust grains do not grow if the grain temperature at a phase is higher than the condensation temperature. (Kako, I.)
Assurance management program for the 30 Nova laser fusion project
International Nuclear Information System (INIS)
Levy, A.J.
1983-01-01
The Nova assurance management program was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management program. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project
Nova Scotia Power : in-stream tidal
International Nuclear Information System (INIS)
Meade, K.
2007-01-01
The Government of Nova Scotia, the Government of New Brunswick, Nova Scotia Power and others have funded a feasibility study of North American sites for commercial instream tidal power. In July 2007, Nova Scotia Power received partial funding for a demonstration project. This presentation provided information on a demonstration plant for tidal power run by Nova Scotia Power. It discussed the benefits of the Open Hydro technology for this plant. In this simple design, the generator is on the circumference of the turbine. The design does not involve any power transmission systems or any pitching of blades. In addition, the technology is environmentally sound as it is completely shrouded, has low rotational speed, and a large open centre allows fish to pass through, and it does not require lubricants. The last benefit that was presented was the scale up of 250 kW machine deployed in a European test facility. The presentation also discussed the advantages of developing tidal power at this time. It was concluded that tidal energy has significant potential. Although it is intermittent, it is predictable and bulk power system can be scheduled to accommodate it. figs
Characterisation and application of NovaFiber lignin
Gosselink, R.J.A.; Snijder, M.H.B.; Kranenbarg, A.; Keijsers, E.R.P.; Jong, de E.; Stigsson, L.L.
2004-01-01
Sulphur-free lignin coming from a novel alkaline-pulping process called NovaFiber, which has been developed by KIRAM AB, has been characterised and evaluated for potential applications. A Kraft lignin has been used for comparison. Considering the characterisation results of a NovaFiber softwood and
Intriguing Misalignment Between Radio and Optical Structures in Classical Nova V5668 Sgr
Linford, Justin; Lawrence, Stephen; Chomiuk, Laura; Sokoloski, Jennifer; Nelson, Thomas; Mukai, Koji; Rupen, Michael; Mioduszewski, Amy; van der Horst, Alexander; Kawash, Adam
2018-01-01
The mass-loss and particle acceleration mechanism that drive gamma-ray production in classical novae remain largely unknown, but clues can be found in high spatial resolution images. The nova V5668 Sgr erupted in March of 2015 and was detected by the Fermi Gamma-ray Space Telescope approximately 2 days after its eruption. We obtained high-resolution radio images of the ejecta with the Karl G. Jansky Very Large Array (VLA) in December 2016 and January 2017. The VLA images reveal a bipolar morphology, very similar to that seen in V959 Mon. We obtained images of the ejecta with the Hubble Space Telescope (HST) in July 2017 using two narrow-band filters: F657N H-alpha+[N II] and F502N [O III]. The HST images also show a bipolar structure, but the HST structure is not aligned with the VLA structure. We present preliminary results of this multi-wavelength project.
Big and Little Feet Provincial Profiles: Nova Scotia
Directory of Open Access Journals (Sweden)
Sarah Dobson
2017-09-01
Full Text Available This communiqué provides a summary of the production- and consumption-based greenhouse gas emissions accounts for Nova Scotia, as well as their associated trade flows. It is part of a series of communiqués profiling the Canadian provinces and territories.1 In simplest terms, a production-based emissions account measures the quantity of greenhouse gas emissions produced in Nova Scotia. In contrast, a consumption-based emissions account measures the quantity of greenhouse gas emissions generated during the production process for final goods and services that are consumed in Nova Scotia through household purchases, investment by firms and government spending. Trade flows refer to the movement of emissions that are produced in Nova Scotia but which support consumption in a different province, territory or country (and vice versa. For example, emissions at the Port of Halifax that are associated with goods that are subsequently exported to Ontario for sale are recorded as a trade flow from Nova Scotia to Ontario. Moving in the opposite direction, emissions associated with the production of motor gasoline in New Brunswick that is exported to Nova Scotia for sale are recorded as a trade flow from New Brunswick to Nova Scotia. For further details on these results in a national context, the methodology for generating them and their policy implications, please see the companion papers to this communiqué series: (1 Fellows and Dobson (2017; and (2 Dobson and Fellows (2017. Additionally, the consumption emissions and trade flow data for each of the provinces and territories are available at: http://www.policyschool.ca/embodied-emissions-inputs-outputs-datatables-2004-2011/.
Antidiabetic effects of glucokinase regulatory protein small-molecule disruptors
Lloyd, David J.; St Jean, David J.; Kurzeja, Robert J. M.; Wahl, Robert C.; Michelsen, Klaus; Cupples, Rod; Chen, Michelle; Wu, John; Sivits, Glenn; Helmering, Joan; Komorowski, Renée; Ashton, Kate S.; Pennington, Lewis D.; Fotsch, Christopher; Vazir, Mukta; Chen, Kui; Chmait, Samer; Zhang, Jiandong; Liu, Longbin; Norman, Mark H.; Andrews, Kristin L.; Bartberger, Michael D.; van, Gwyneth; Galbreath, Elizabeth J.; Vonderfecht, Steven L.; Wang, Minghan; Jordan, Steven R.; Véniant, Murielle M.; Hale, Clarence
2013-12-01
Glucose homeostasis is a vital and complex process, and its disruption can cause hyperglycaemia and type II diabetes mellitus. Glucokinase (GK), a key enzyme that regulates glucose homeostasis, converts glucose to glucose-6-phosphate in pancreatic β-cells, liver hepatocytes, specific hypothalamic neurons, and gut enterocytes. In hepatocytes, GK regulates glucose uptake and glycogen synthesis, suppresses glucose production, and is subject to the endogenous inhibitor GK regulatory protein (GKRP). During fasting, GKRP binds, inactivates and sequesters GK in the nucleus, which removes GK from the gluconeogenic process and prevents a futile cycle of glucose phosphorylation. Compounds that directly hyperactivate GK (GK activators) lower blood glucose levels and are being evaluated clinically as potential therapeutics for the treatment of type II diabetes mellitus. However, initial reports indicate that an increased risk of hypoglycaemia is associated with some GK activators. To mitigate the risk of hypoglycaemia, we sought to increase GK activity by blocking GKRP. Here we describe the identification of two potent small-molecule GK-GKRP disruptors (AMG-1694 and AMG-3969) that normalized blood glucose levels in several rodent models of diabetes. These compounds potently reversed the inhibitory effect of GKRP on GK activity and promoted GK translocation both in vitro (isolated hepatocytes) and in vivo (liver). A co-crystal structure of full-length human GKRP in complex with AMG-1694 revealed a previously unknown binding pocket in GKRP distinct from that of the phosphofructose-binding site. Furthermore, with AMG-1694 and AMG-3969 (but not GK activators), blood glucose lowering was restricted to diabetic and not normoglycaemic animals. These findings exploit a new cellular mechanism for lowering blood glucose levels with reduced potential for hypoglycaemic risk in patients with type II diabetes mellitus.
Energy Technology Data Exchange (ETDEWEB)
Lea, N.
1996-01-01
The involvement of the Calgary-based company NOVA Gas International (NGI) in Malaysia`s peninsular gas utilization (PGU) project, was described. Phase I and II of the project involved linking onshore gas processing plants with a natural gas transmission system. Phase III of the PGU project was a gas transmission pipeline that began midway up the west coast of peninsular Malaysia to the Malaysia-Thailand border. The complex 549 km pipeline included route selection, survey and soil investigation, archaeological study, environmental impact assessment, land acquisition, meter-station construction, telecommunication systems and office buildings. NGI was the prime contractor on the project through a joint venture with OGP Technical Services, jointly owned by NGI and Petronas, the Thai state oil company. Much of NGI`s success was attributed to excellent interpersonal skills, particularly NGI`s ability to build confidence and credibility with its Thai partners.
Continuum emission from classical nova winds
International Nuclear Information System (INIS)
Harkness, R.P.
1983-01-01
The emergent continuum of a slow classical nova during outburst is considered in the quasi-steady optically thick, transonic wind model. Models are presented for various steady mass loss rates and are related to the evolution of slow novae during decline and early post-maximum. The continuum emission is found to depart radically from a blackbody spectrum and to exhibit features common to highly extended stellar atmospheres. (author)
New Observations of the Old Magnetic Nova GQ Muscae
Directory of Open Access Journals (Sweden)
Narloch W.
2014-03-01
Full Text Available Photometric observations of GQ Mus performed between 1992 and 2011 are reported. We find that the total amplitude of the orbital modulation of its brightness decreased from ~ 0.9 mag in 1992 to ~ 0.2 mag in 2010, becoming comparable to the amplitude of chaotic flickering on a time scale of several minutes. Optical spectra obtained in 2001 and 2012 indicate continuing activity of GQ Mus. The spectra show broad emission lines of He II and H I typical for magnetic cataclysmic variables. The nova was found to be an UV-bright object in 2001 and 2012. We also show that the orbital period of GQ Mus has been constant between 1989 and 2010–2011.
Nova chain design and performance
International Nuclear Information System (INIS)
Simmons, W.W.; Glaze, J.A.; Trenholme, J.B.; Hagen, W.F.
1980-01-01
During the past year design of the Nova laser has undergone significant change as a result of developments in our laser glass and optical coating evaluation programs. Two notable aspects of the glass development program deserve emphasis. First, vendor qualification for production of fluorophosphate laser glass is progressing satisfactorily. There is a reasonable expectation that vendors can meet fluorophosphate glass specifications within Nova schedule constraints. Secondly, recent gain saturation measurements have shown that the saturation fluence of the fluorophosphate glass is larger than previously supposed (approx. 5.5 J/cm 2 ) and in fact is somewhat larger than Shiva silicate glasses. Hence, performance of Nova for pulses in the 3 ns and longer range should be satisfactory. For pulses in the 1 ns regime, of course, the fluorophosphate chain will have superior performance to that of silicate because of its low nonlinear index of refraction (approx. 30% that of silicate). These and other considerations have led us to choose a chain design based upon the use of fluorophosphate glass in our amplifiers
Slow magnetic monopoles search in NOvA
Antoshkin, Alexander; Frank, Martin
2018-04-01
The NOvA far detector is well suited for finding exotic particles due to its technical features (see [1]). One type of those exotic particles is a "slow" magnetic monopole. It is assumed that the energy deposition of such monopoles should be enough to be registered (see [2]). Measurement of the expected signals was performed on the NOvA test bench at JINR (see [3]). Result of this measurement allows us to perform slow monopole's research using NOvA software and hardware with high efficiency. As a whole, the research can lead to a discovery, or it can limit the existence of monopoles in a wide range of parameters, previously unreachable in other experiments (MACRO, SLIM, RICE, IceCube). Several special software tools have been developed. Slow Monopole Trigger has been created and implemented in the NOvA Data-Driven-Trigger system. Also, an online reconstruction algorithm has been developed and tested on 5% of the data. A technical description of these tools and current results of the analysis are presented in this work.
NOVA: a software to analyze complexome profiling data
Giese, H.; Ackermann, J.; Heide, H.; Bleier, L.; Drose, S.; Wittig, I.; Brandt, U.; Koch, I.
2015-01-01
SUMMARY: We introduce nova, a software for the analysis of complexome profiling data. nova supports the investigation of the composition of complexes, cluster analysis of the experimental data, visual inspection and comparison of experiments and many other features. AVAILABILITY AND IMPLEMENTATION:
Nucleosynthesis and the nova outburst
International Nuclear Information System (INIS)
Starrfield, S.
1995-01-01
A nova outburst is the consequence of the accretion of hydrogen rich material onto a white dwarf and it can be considered as the largest hydrogen bomb in the Universe. The fuel is supplied by a secondary star in a close binary system while the strong degeneracy of the massive white dwarf acts to contain the gas during the early stages of the explosion. The containment allows the temperature in the nuclear burning region to exceed 10 8 K under all circumstances. As a result a major fraction of CNO nuclei in the envelope are transformed into β + -unstable nuclei. We discuss the effects of these nuclei on the evolution. Recent observational studies have shown that there are two compositional classes of novae; one which occurs on carbon-oxygen white dwarfs, and a second class that occurs on oxygen-neon-magnesium white dwarfs. In this review we will concentrate on the latter explosions since they produce the most interesting nucleosynthesis. We report both on the results of new observational determinations of nova abundances and, in addition, new hydrodynamic calculations that examine the consequences of the accretion process on 1.0M circle-dot , 1.25M circle-dot , and 1.35M circle-dot white dwarfs. Our results show that novae can produce 22 Na, 26 Al, and other intermediate mass nuclei in interesting amounts. We will present the results of new calculations, done with updated nuclear reaction rates and opacities, which exhibit quantitative differences with respect to published work
A new method of determining the ejected mass of novae
Energy Technology Data Exchange (ETDEWEB)
Sparks, W.M.
1994-12-31
A new method of determining the ejected mass of novae based on simple, reasonable assumptions is presented. This method assumes that the remnant mass on the white dwarf is the same as that from the previous nova outburst. The hydrogen, helium, and metal abundances of the accreted material from the secondary must also be known or assumed. The white dwarf`s mass has a small effect because the amount of hydrogen consumed during the thermonuclear runaway only depends weakly upon this mass. If the composition of the ejecta and the time of the remnant shell burnout are determined from observations, then the ejected and remnant masses can be deduced. At present only a sharp decrease in the X-rays observed by ROSAT has been attributed to this remnant burnout and only for two novae: GQ Mus and V1974 Cyg. The ejected and remnant masses for these two novae are calculated. If other indicators of nova remnant burnout, such as a rapid decrease in high-ionization lines, can be identified, then this method could be applied to additional novae.
The NOvA software testing framework
International Nuclear Information System (INIS)
Tamsett, M; Group, C
2015-01-01
The NOvA experiment at Fermilab is a long-baseline neutrino experiment designed to study vε appearance in a vμ beam. NOvA has already produced more than one million Monte Carlo and detector generated files amounting to more than 1 PB in size. This data is divided between a number of parallel streams such as far and near detector beam spills, cosmic ray backgrounds, a number of data-driven triggers and over 20 different Monte Carlo configurations. Each of these data streams must be processed through the appropriate steps of the rapidly evolving, multi-tiered, interdependent NOvA software framework. In total there are greater than 12 individual software tiers, each of which performs a different function and can be configured differently depending on the input stream. In order to regularly test and validate that all of these software stages are working correctly NOvA has designed a powerful, modular testing framework that enables detailed validation and benchmarking to be performed in a fast, efficient and accessible way with minimal expert knowledge. The core of this system is a novel series of python modules which wrap, monitor and handle the underlying C++ software framework and then report the results to a slick front-end web-based interface. This interface utilises modern, cross-platform, visualisation libraries to render the test results in a meaningful way. They are fast and flexible, allowing for the easy addition of new tests and datasets. In total upwards of 14 individual streams are regularly tested amounting to over 70 individual software processes, producing over 25 GB of output files. The rigour enforced through this flexible testing framework enables NOvA to rapidly verify configurations, results and software and thus ensure that data is available for physics analysis in a timely and robust manner. (paper)
The assurance management program for the Nova laser fusion project
International Nuclear Information System (INIS)
Levy, A.J.
1983-01-01
In a well managed project, Quality Assurance is an integral part of the management activities performed on a daily basis. Management assures successful performance within budget and on schedule by using all the good business, scientific, engineering, quality assurance, and safety practices available. Quality assurance and safety practices employed on Nova are put in perspective by integrating them into the overall function of good project management. The Inertial Confinement Fusion (ICF) approach is explained in general terms. The laser ICF and magnetic fusion facilities are significantly different in that the laser system is used solely as a highly reliable energy source for performing plasma physics experiments related to fusion target development; by contrast, magnetic fusion facilities are themselves the experiments. The Nova project consists of a 10-beam, 74 cm aperture neodymium-glass laser experimental facility which is being constructed by the Lawrence Livermore National Laboratory (LLNL) for the U.S. Department of Energy. Nova has a total estimated cost of $176M and will become operational in the Fall of 1984. The Nova laser will be used as the high energy driver for studying the regime of ignition for ICF. The Nova assurance management program was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management program. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project
Radio Observations of Gamma-ray Novae
Linford, Justin D.; Chomiuk, L.; Ribeiro, V.; project, E.-Nova
2014-01-01
Recent detection of gamma-ray emission from classical novae by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope surprised many in the astronomical community. We present results from radio observations, obtained using the Karl G. Jansky Very Large Array (VLA), of three gamma-ray novae: Mon2012, Sco2012, and Del2013. Radio observations allow for the calculation of ejecta masses, place limits on the distances, and provide information about the gamma-ray emission mechanism for these sources.
ToO Galactic Nova -- Michelle ``Quick Response''
Helton, L. Andrew; Woodward, Chick; Evans, Nye; Geballe, Tom; Spitzer Nova Team
2006-08-01
Stars are the engines of energy production and chemical evolution in our Universe, depositing radiative and mechanical energy into their environments and enriching the ambient ISM with elements synthesized in their interiors and dust grains condensed in their atmospheres. Classical novae (CN) contribute to this cycle of chemical enrichment through explosive nucleosynthesis and the violent ejection of material dredged from the white dwarf progenitor and mixed with the accreted surface layers. We propose to obtain mid-IR spectra of a new galactic CN in outburst to investigate aspects of the CN phenomenon including the in situ formation and mineralogy of nova dust and the elemental abundances resulting from thermonuclear runaway. Synoptic, high S/N Michelle spectra permit: 1) determination of the grain size distribution and mineral composition of nova dust; 2) estimation of chemical abundances of nova ejecta from coronal and other emission line spectroscopy; and 3) measurement of the density and masses of the ejecta. This Gemini `Target of Opportunity' initiative (trigger K=5- 8 mag, assuming adequate PWFS guide stars exist) complements our extensive Spitzer, Chandra, Swift, XMM-Newton CN DDT/ToO programs.
Synoptic Mid-IR Spectra ToO Novae
Helton, L. Andrew; Woodward, Chick; Evans, Nye; Geballe, Tom; Spitzer Nova Team
2007-02-01
Stars are the engines of energy production and chemical evolution in our Universe, depositing radiative and mechanical energy into their environments and enriching the ambient ISM with elements synthesized in their interiors and dust grains condensed in their atmospheres. Classical novae (CN) contribute to this cycle of chemical enrichment through explosive nucleosynthesis and the violent ejection of material dredged from the white dwarf progenitor and mixed with the accreted surface layers. We propose to obtain mid-IR spectra of a new galactic CN in outburst to investigate aspects of the CN phenomenon including the in situ formation and mineralogy of nova dust and the elemental abundances resulting from thermonuclear runaway. Synoptic, high S/N Michelle spectra permit: 1) determination of the grain size distribution and mineral composition of nova dust; 2) estimation of chemical abundances of nova ejecta from coronal and other emission line spectroscopy; and 3) measurement of the density and masses of the ejecta. This Gemini `Target of Opportunity' initiative (trigger K=5- 8 mag, assuming adequate PWFS guide stars exist) complements our extensive Spitzer, Chandra, Swift, XMM-Newton CN DDT/ToO programs.
Energy distributions of symbiotic novae
International Nuclear Information System (INIS)
Bryan, G.L.; Kwok, S.
1991-01-01
The IRAS low-resolution spectra of three recent symbiotic novae are fitted with a dust continuum radiative transfer model. It is found that the dust shells are detached from the photosphere and that the sizes of the inner radii are correlated with times since outburst. An analysis of the IUE spectra of HM Sge at different epochs suggests that the strength of the 2200 A feature is decreasing with times and the grains responsible for the feature are probably formed in the white dwarf ejecta. A complete accounting of the entire energy budget from radio to X-ray shows that most of the energy is emitted by the cool component in the infrared, and a significant fraction of the flux of the hot component is escaping in the far-ultraviolet. The density-bounded nature of the circumstellar gas nebulae could be the result of a bipolar geometry of the nebulae. Unlike classical novae, the optical outburst of symbiotic novae is due to the ionization of the preexisting envelope of the cool component and is not the result of a sudden ejection by the hot component. 55 refs
Nova Scotia wind integration study : final report
International Nuclear Information System (INIS)
2008-01-01
An independent study was commissioned by the Nova Scotia Department of Energy to identify and assess the impacts of integrating large scale wind power generation into Nova Scotia's electric power system. The purpose of the study was to help Nova Scotia's efforts towards building its renewable energy supply, in order to secure a local energy resource and to protect the environment. This report provided an overview of Nova Scotia's electric power sector, including organizations involved; existing generation system; existing transmission system; renewable energy standards; Nova Scotia Power integrated resource plan; and 2007 renewable energy request for proposals. The major assumptions for the study that were discussed included system parameters; system capacity reserve requirements; expansion plans to 2020; and allocation of new wind generation by zone. Wind resource data and system dispatch modeling were also presented and transmission system modeling was outlined. This included a discussion of steady state reliability requirements; inputs to the load flow model; load flow study and contingency analysis; intra-province transmission congestion; and potential impacts on system security. The report also presented an approach to impact analysis and mitigation such as the impact on greenhouse gas and other air emissions and the impact of wind energy prices on system costs. It was concluded that one of the most important factors in evaluation of the economic impact of wind power integration is the forecasted fuel prices for the thermal units. If the fuel prices had varied significantly from the forecasted values, the study economic impact results could have been quite different. 55 tabs., 64 figs., 1 appendix
Long-Term Photometry of Very Slow Novae
Directory of Open Access Journals (Sweden)
Chochol D.
2003-12-01
Full Text Available Long-term photographic, photoelectric and recent CCD photometry of the classical nova V723 Cas and symbiotic novae V1329 Cyg, PU Vul, V1016 Cyg and HM Sge were used to find their orbital periods. The arguments in favor of the presence of the third components in these systems are given. Physical processes, responsible for the brightness variations, are discussed.
The geographic accessibility of pharmacies in Nova Scotia.
Law, Michael R; Heard, Deborah; Fisher, Judith; Douillard, Jay; Muzika, Greg; Sketris, Ingrid S
2013-01-01
Geographic proximity is an important component of access to primary care and the pharmaceutical services of community pharmacies. Variations in access to primary care have been found between rural and urban areas in Canadian and international jurisdictions. We studied access to community pharmacies in the province of Nova Scotia. We used information on the locations of 297 community pharmacies operating in Nova Scotia in June 2011. Population estimates at the census block level and network analysis were used to study the number of Nova Scotia residents living within 800 m (walking) and 2 km and 5 km (driving) distances of a pharmacy. We then simulated the impact of pharmacy closures on geographic access in urban and rural areas. We found that 40.3% of Nova Scotia residents lived within walking distance of a pharmacy; 62.6% and 78.8% lived within 2 km and 5 km, respectively. Differences between urban and rural areas were pronounced: 99.2% of urban residents lived within 5 km of a pharmacy compared with 53.3% of rural residents. Simulated pharmacy closures had a greater impact on geographic access to community pharmacies in rural areas than urban areas. The majority of Nova Scotia residents lived within walking or short driving distance of at least 1 community pharmacy. While overall geographic access appears to be lower than in the province of Ontario, the difference appears to be largely driven by the higher proportion of rural dwellers in Nova Scotia. Further studies should examine how geographic proximity to pharmacies influences patients' access to traditional and specialized pharmacy services, as well as health outcomes and adherence to therapy. Can Pharm J 2013;146:39-46.
Soumya, Neelagiri; Kumar, I Sravan; Shivaprasad, S; Gorakh, Landage Nitin; Dinesh, Neeradi; Swamy, Kayala Kambagiri; Singh, Sushma
2015-04-01
An adenosine monophosphate forming acetyl CoA synthetase (AceCS) which is the key enzyme involved in the conversion of acetate to acetyl CoA has been identified from Leishmania donovani for the first time. Sequence analysis of L. donovani AceCS (LdAceCS) revealed the presence of a 'PX4GK' motif which is highly conserved throughout organisms with higher sequence identity (96%) to lower sequence identity (38%). A ∼ 77 kDa heterologous protein with C-terminal 6X His-tag was expressed in Escherichia coli. Expression of LdAceCS in promastigotes was confirmed by western blot and RT-PCR analysis. Immunolocalization studies revealed that it is a cytosolic protein. We also report the kinetic characterization of recombinant LdAceCS with acetate, adenosine 5'-triphosphate, coenzyme A and propionate as substrates. Site directed mutagenesis of residues in conserved PX4GK motif of LdAceCS was performed to gain insight into its potential role in substrate binding, catalysis and its role in maintaining structural integrity of the protein. P646A, G651A and K652R exhibited more than 90% loss in activity signifying its indispensible role in the enzyme activity. Substitution of other residues in this motif resulted in altered substrate specificity and catalysis. However, none of them had any role in modulation of the secondary structure of the protein except G651A mutant. Copyright © 2015 Elsevier B.V. All rights reserved.
Observations and predictions of EUV emission from classical novae
International Nuclear Information System (INIS)
Starrfield, S.; Truran, J.W.; Sparks, W.M.; Krautter, J.
1989-01-01
Theoretical modeling of novae in outburst predicts that they should be active emitters of radiation both in the EUV and soft X-ray wavelengths twice during the outburst. The first time is very early in the outburst when only an all sky survey can detect them. This period lasts only a few hours. They again become bright EUV and soft X-ray emitters late in the outburst when the remnant object becomes very hot and is still luminous. The predictions imply both that a nova can remain very hot for months to years and that the peak temperature at this time strongly depends upon the mass of the white dwarf. It is important to observe novae at these late times because a measurement of both the flux and temperature can provide information about the mass of the white dwarf, the tun-off time scale, and the energy budget of the outburst. We review the existing observations of novae in late stages of their outburst and present some newly obtained data for GQ Mus 1983. We then provide results of new hydrodynamic simulations of novae in outburst and compare the predictions to the observations. 43 refs., 6 figs
Eruptions and superhumps in dwarf novae
International Nuclear Information System (INIS)
Patterson, J.
1979-01-01
The existence of two distinct eruption types in dwarf novae is considered. A small subclass of dwarf novae, the SU Ursae Majoris stars, show occasional very bright and long eruptions (''supermaxima''), and during supermaxima, large-amplitude photometric variations (''superhumps'') at a period related to the orbital period are seen. Two new stars showing these effects, AY Lyrae and YZ Cancri, are reported. A third star, WZ Sagittae, is probably also a member of the class. Models for the superhumps are reviewed and found to be unsatisfactory. Observational constraints on a successful model are discussed
Spectral evolution of dwarf nova outbursts
International Nuclear Information System (INIS)
Cannizzo, J.K.; Kenyon, S.J.
1987-01-01
The disk instability model for dwarf nova eruptions is investigated by computing the spectral development of the accretion disk through a complete limit cycle. Observed stellar spectra are used to model the radiation emitted by optically thick annuli within the disc. The general findings agree with those of Smak (1984) and Pringle et al. (1986). It is suggested that the dwarf nova oscillations might be a source of information concerning the evolution of the inner disk and that detailed observations of this phenomenon can be used to test various outburst mechanisms. 74 references
Spectroscopy of poorly known northern dwarf novae. Part. I
International Nuclear Information System (INIS)
Bruch, A.
1989-01-01
Spectroscopic observations of 12 dwarf novae are presented most of which hitherto unknown spectroscopically. The classifications as dwarf novae could be confirmed in most cases. Two objects remain doubtful: CI UMa and MR Per. The latter has the spectrum of a very late type main sequence star with hydrogen emissions and might be a flare star showing extremely slow flares, while the CI UMa spectrum does not contain any emission line above the noise level. In two dwarf novae - DX And and NS Per - absorption lines of the secondary star are newly detected
CIRCUMSTELLAR SHELL FORMATION IN SYMBIOTIC RECURRENT NOVAE
Energy Technology Data Exchange (ETDEWEB)
Moore, Kevin; Bildsten, Lars [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93106 (United States)
2012-12-20
We present models of spherically symmetric recurrent nova shells interacting with circumstellar material (CSM) in a symbiotic system composed of a red giant (RG) expelling a wind and a white dwarf accreting from this material. Recurrent nova eruptions periodically eject material at high velocities ({approx}> 10{sup 3} km s{sup -1}) into the RG wind profile, creating a decelerating shock wave as CSM is swept up. High CSM densities cause the shocked wind and ejecta to have very short cooling times of days to weeks. Thus, the late-time evolution of the shell is determined by momentum conservation instead of energy conservation. We compute and show evolutionary tracks of shell deceleration, as well as post-shock structure. After sweeping up all the RG wind, the shell coasts at a velocity {approx}100 km s{sup -1}, depending on system parameters. These velocities are similar to those measured in blueshifted CSM from the symbiotic nova RS Oph, as well as a few Type Ia supernovae that show evidence of CSM, such as 2006X, 2007le, and PTF 11kx. Supernovae occurring in such systems may not show CSM interaction until the inner nova shell gets hit by the supernova ejecta, days to months after the explosion.
Moldwin, M. B.; Hogue, T. S.; Nonacs, P.; Shope, R. E.; Daniel, J.
2008-12-01
Many science and research skills are taught by osmosis in graduate programs with the expectation that students will develop good communication skills (speaking, writing, and networking) by observing others, attending meetings, and self reflection. A new National Science Foundation Graduate Teaching Fellows in K- 12 Education (GK-12; http://ehrweb.aaas.org/gk12new/) program at UCLA (SEE-LA; http://measure.igpp.ucla.edu/GK12-SEE-LA/overview.html ) attempts to make the development of good communication skills an explicit part of the graduate program of science and engineering students. SEE-LA places the graduate fellows in two pairs of middle and high schools within Los Angeles to act as scientists-in- residence. They are partnered with two master science teachers and spend two-days per week in the classroom. They are not student teachers, or teacher aides, but scientists who contribute their content expertise, excitement and experience with research, and new ideas for classroom activities and lessons that incorporate inquiry science. During the one-year fellowship, the graduate students also attend a year-long Preparing Future Faculty seminar that discusses many skills needed as they begin their academic or research careers. Students are also required to include a brief (two-page) summary of their research that their middle or high school students would be able to understand as part of their published thesis. Having students actively thinking about and communicating their science to a pre-college audience provides important science communication training and helps contribute to science education. University and local pre- college school partnerships provide an excellent opportunity to support the development of graduate student communication skills while also contributing significantly to the dissemination of sound science to K-12 teachers and students.
Rate of nova production in the Galaxy
International Nuclear Information System (INIS)
Liller, W.; Mayer, B.; PROBLICOM Sky Survey, Los Angeles, CA)
1987-01-01
The ongoing PROBLICOM program in the Southern Hemisphere now makes it possible to derive a reliable value for the overall production rate of Galactic novae. The results, 73 + or - 24/y, indicates that the Galaxy outproduces M 31 by a factor of two or three. It is estimated that the rate of supernova ejecta is one and a half orders of magnitude greater than that of novae in the Galaxy. 15 references
Directory of Open Access Journals (Sweden)
Kemin Yan
2018-03-01
Full Text Available Objective: Ileal transposition (IT surgery has been reported to improve glucose and lipid metabolism, and fibroblast growth factor 21 (FGF21 is a powerful metabolic regulator. In the present study, we aimed to investigate the effects of IT surgery on metabolism and its possible relationship with the FGF21 signaling pathway in diabetic Goto-Kakizaki (GK rats.Methods: Ten-week-old male GK rats were subjected to IT surgery with translocation of a 10 cm ileal segment to the proximal jejunum (IT group or sham surgery without the ileum transposition (Sham-IT group. Rats in the no surgery group did not receive any surgical intervention. Six weeks later, body weight, fat mass, fasting blood glucose (FBG, and serum levels of FGF21 and leptin were measured. The expression of the FGF21 signaling pathway and white adipose tissue (WAT browning-related genes in the WAT and liver were evaluated by real-time reverse transcription polymerase chain reaction (RT-qPCR and western blot.Results: IT surgery significantly decreased the body weights and FBG levels and increased the insulin sensitivity of GK rats. The total WAT mass of the IT rats showed a 41.5% reduction compared with the Sham-IT rats, and serum levels of FGF21 and leptin of the IT rats decreased by 26.3 and 61.7%, respectively (all P < 0.05. The mRNA levels of fibroblast growth factor receptor 1 (FGFR1 and its co-receptor β klotho (KLB in the perirenal WAT (pWAT of the IT rats were 1.4- and 2.4-fold that of the Sham-IT rats, respectively, and the FGFR1 protein levels were 1.7-fold of the Sham-IT rats (all P < 0.05. In accordance with the pWAT, the protein levels of FGFR1 and KLB in the epididymal WAT (eWAT of the IT rats notably increased to 3.0- and 3.9-fold of the Sham-IT rats (P < 0.05. Furthermore, uncoupling protein 1 (UCP1 protein levels in the eWAT and pWAT of the IT rats also increased to 2.2- and 2.3-fold of the Sham-IT rats (P < 0.05. However, the protein levels of FGFR1 and KLB in the
Results of Statewide TerraNova Testing, Fall 1998.
La Marca, Paul M.
This summary provides key findings about state, district, and school level performance on the TerraNova examinations (CTB/McGraw Hill) in Nevada in 1998-1999. The TerraNova tests are used to assess students in grades 4, 8, and 10 as stipulated by Nevada law. Within this summary, a description of performance as measured by national percentile…
The Distance to Nova V959 Mon from VLA Imaging
Linford, J. D.; Ribeiro, V. A. R. M.; Chomiuk, L.; Nelson, T.; Sokoloski, J. L.; Rupen, M. P.; Mukai, K.; O'Brien, T. J.; Mioduszewski, A. J.; Weston, J.
2015-06-01
Determining reliable distances to classical novae is a challenging but crucial step in deriving their ejected masses and explosion energetics. Here we combine radio expansion measurements from the Karl G. Jansky Very Large Array with velocities derived from optical spectra to estimate an expansion parallax for nova V959 Mon, the first nova discovered through its γ-ray emission. We spatially resolve the nova at frequencies of 4.5-36.5 GHz in nine different imaging epochs. The first five epochs cover the expansion of the ejecta from 2012 October to 2013 January, while the final four epochs span 2014 February-May. These observations correspond to days 126 through 199 and days 615 through 703 after the first detection of the nova. The images clearly show a non-spherical ejecta geometry. Utilizing ejecta velocities derived from three-dimensional modeling of optical spectroscopy, the radio expansion implies a distance between 0.9 ± 0.2 and 2.2 ± 0.4 kpc, with a most probable distance of 1.4 ± 0.4 kpc. This distance implies a γ-ray luminosity of 0.6× {{10}35} erg s-1, which is much less than the prototype γ-ray-detected nova, V407 Cyg, possibly due to the lack of a red giant companion in the V959 Mon system. V959 Mon also has a much lower γ-ray luminosity than other classical novae detected in γ-rays to date, indicating a range of at least a factor of 10 in the γ-ray luminosities for these explosions.
A Recurrent Nova Super-Remnant in the Andromeda Galaxy
DEFF Research Database (Denmark)
Darnley, M. J.; Hounsell, R.; O'Brien, T. J.
2017-01-01
Here we report that the most rapidly recurring nova, M31N 2008-12a, which erupts annually, is surrounded by a "nova super-remnant" which demonstrates that M31N 2008-12a has erupted with high frequency for millions of years....
NOVAS TECNOLOGIAS NO ENVELHECIMENTO
Directory of Open Access Journals (Sweden)
Rosa Maria Farah
2010-02-01
Full Text Available O Programa de Estudos Pós-Graduados em Gerontologia/PUC-SP desenvolve pesquisas em diversificadas linhas algumas das quais têm em comum o acolhimento à questão das novas tecnologias no envelhecimento. São investigações de caráter interdisciplinar que envolvem docentes-pesquisadores, orientandos de mestrado e de iniciação científica. Na área da educação a distância, a PUC-SP inaugura um trabalho em que o idoso interessado em avançar em seus conhecimentos é recebido em um ambiente virtual de aprendizagem, em que pode participar de cursos avançados de aquisição de novas linguagens e de navegação na Internet, cujas consequências são o investimento em uma via mais digna para o envelhecer no sentido de esse idoso sentir-se um ser ligado aos novos tempos em que a interatividade digital traz-lhe possibilidades ilimitadas de contatos com o outro, com o mundo enfim. A pesquisa sobre a inclusão cibersocial do idoso mostra o que significa colocar o idoso em contato com a Internet, quando este recebe, por meio das redes sociais, ofertas de várias ordens, e equipamentos que contornam limitações de ordem física ou motora. Além disso, o registro digital da memória do idoso, de sua história e referências também podem constituir conteudos preciosos para pesquisas. A relação do idoso com a informática pode situá-lo como um ator, produtor e reprodutor no ciberespaço. Isso significa que as vantagens do uso do computador fazem o idoso ganhar novo sentido na vida, na medida em que pode assim preencher o vazio causado pelas perdas que lhe vão ocorrendo, possibilitando que ele redimensione seu olhar para o presente e futuro. Palavras-chave: o sujeito-idoso nas novas tecnologias; novas tecnologias e envelhecimento; o idoso na educação a distância; internet na velhice.
Gamma-ray emission from internal shocks in novae
Martin, P.; Dubus, G.; Jean, P.; Tatischeff, V.; Dosne, C.
2018-04-01
Context. Gamma-ray emission at energies ≥100 MeV has been detected from nine novae using the Fermi Large Area Telescope (LAT), and can be explained by particle acceleration at shocks in these systems. Eight out of these nine objects are classical novae in which interaction of the ejecta with a tenuous circumbinary material is not expected to generate detectable gamma-ray emission. Aim. We examine whether particle acceleration at internal shocks can account for the gamma-ray emission from these novae. The shocks result from the interaction of a fast wind radiatively-driven by nuclear burning on the white dwarf with material ejected in the initial runaway stage of the nova outburst. Methods: We present a one-dimensional model for the dynamics of a forward and reverse shock system in a nova ejecta, and for the associated time-dependent particle acceleration and high-energy gamma-ray emission. Non-thermal proton and electron spectra are calculated by solving a time-dependent transport equation for particle injection, acceleration, losses, and escape from the shock region. The predicted emission is compared to LAT observations of V407 Cyg, V1324 Sco, V959 Mon, V339 Del, V1369 Cen, and V5668 Sgr. Results: The ≥100 MeV gamma-ray emission arises predominantly from particles accelerated up to 100 GeV at the reverse shock and undergoing hadronic interactions in the dense cooling layer downstream of the shock. The emission rises within days after the onset of the wind, quickly reaches a maximum, and its subsequent decrease reflects mostly the time evolution of the wind properties. Comparison to gamma-ray data points to a typical scenario where an ejecta of mass 10-5-10-4 M⊙ expands in a homologous way with a maximum velocity of 1000-2000 km s-1, followed within a day by a wind with a velocity values of which result in the majority of best-fit models having gamma-ray spectra with a high-energy turnover below 10 GeV. Our typical model is able to account for the main
What does an erupting nova do to its red dwarf companion?
International Nuclear Information System (INIS)
Kovetz, A.; Prialnik, D.; Shara, M.M.
1988-01-01
During nova eruptions and for decades afterward, the red dwards in cataclysmic binaries are irradiated with hundreds of times more luminosity than they themselves produce. Simulations of the time-dependent irradiation of three red dwarf models (0.25, 0.50, and 0.75 solar mass) are presented. The mass transfer rates forced by irradiation after nova eruption are found to be enhanced by two orders of magnitude because of the irradiation. The time scale for irradiation to become unimportant is that of the white dwarf cooling time scale, a few centuries. These two results support the hibernation scenario of novae, which suggests that novae remain bright for a few centuries after eruption because of irradiation-induced mass transfer. After irradiation decreases mass transfer slows, and some very old novae may then become extremely faint. 26 references
Late-type components of slow novae and symbiotic stars
Energy Technology Data Exchange (ETDEWEB)
Allen, D A [Anglo-Australian Observatory, Epping (Australia); Royal Observatory, Edinburgh (UK))
1980-08-01
It is argued that the various types of symbiotic stars and the slow novae are the same phenomena exhibiting a range of associated time-scales, the slow novae being of intermediate speed. Evidence is summarized showing that both types of object contain normal M giants or mira variables. This fact is at odds with currently fashionable single-star models for slow novae, according to which the M star is totally disrupted before the outburst. Spectral types of the late-type components are presented for nearly 80 symbiotic stars and slow novae, derived from 2 ..mu..m spectroscopy. It is found that both the intensity of the emission spectrum and the electron density of the gas are functions of the spectral type of the late-type star. Explanations for these correlations are given. On the assumption that the late-type components are normal giants, spectroscopic parallaxes are determined; credible distances are derived which indicate that the known symbiotic stars have been sampled as far afield as the Galactic Centre. Hydrogen shell flashes on a white dwarf accreting gas from the late-type components offer an attractive explanation of the phenomena of slow novae and symbiotic stars, and such models are discussed in the concluding section.
Canada-Nova Scotia Offshore Petroleum Board annual report, 1992-1993
International Nuclear Information System (INIS)
1993-06-01
The Canada-Nova Scotia Offshore Petroleum Board was established as the agency responsible for the regulation of the hydrocarbon resources in the Nova Scotia offshore. The Board evaluates resource potential, administers petroleum exploration and production rights, approves offshore activities, and approves benefits and development plans. The main activities of the Board in 1992-1993 are summarized and financial statements are presented. Highlights include production of 572,300 m 3 of oil during the first production season of LASMO Nova Scotia Ltd.'s Cohasset development, the first commercial offshore oil production for Canada; four major resource evaluation projects in the Glenelg Field, the Laurentian sub-basin, the Fundy Rift Basin, and the Panuke Field; holding of discussions between Nova Scotia, Newfoundland, and Canada on the maritime boundary lines between respective offshore petroleum board jurisdictions, in the wake of a June 1992 determination of the disputed maritime boundary around St. Pierre et Miquelon; and amendments of certain safety-related legislation applicable to offshore operations. Employment benefits of the Cohasset project during 1992 totalled ca 470 Nova Scotians and 120 other Canadians. 3 tabs
International Nuclear Information System (INIS)
Wennfors, B.
1976-01-01
Ten of the two hundred cosmic X-ray sources exhibit characteristics in their emissions analogous to novae, i.e. after a rapid increase in luminosity, lasting about three days, follows a period of about a month with a slow decrease, and thereafter a rapid decrease to invisibility. The spectra of such sources are discussed in general terms and brief descriptions are given of the five which have been identified with optical objects. Three models for the history of X-ray novae, all based on X-ray emission from a compact object in an orbit very near a larger star, are discussed. (JIW)
Observations and simulations of recurrent novae: U Sco and V394 CrA
Starrfield, S.; Sonneborn, G.; Sparks, Warren M.; Shaviv, G.; Williams, R. E.; Heathcote, S.; Ferland, Gary; Gehrz, Robert D.; Ney, Edward P.; Kenyon, Scott
1988-01-01
Observations and analysis of the Aug. 1987 outburst of the recurrent nova V394 CrA are presented. This nova is extremely fast and its outburst characteristics closely resemble those of the recurrent nova U Sco. Hydrodynamic simulations of the outbursts of recurrent novae were performed. Results as applied to the outbursts of V394 CrA and U Sco are summarized.
THE INTER-ERUPTION TIMESCALE OF CLASSICAL NOVAE FROM EXPANSION OF THE Z CAMELOPARDALIS SHELL
International Nuclear Information System (INIS)
Shara, Michael M.; Mizusawa, Trisha; Zurek, David; Martin, Christopher D.; Neill, James D.; Seibert, Mark
2012-01-01
The dwarf nova Z Camelopardalis is surrounded by the largest known classical nova shell. This shell demonstrates that at least some dwarf novae must have undergone classical nova eruptions in the past, and that at least some classical novae become dwarf novae long after their nova thermonuclear outbursts. The current size of the shell, its known distance, and the largest observed nova ejection velocity set a lower limit to the time since Z Cam's last outburst of 220 years. The radius of the brightest part of Z Cam's shell is currently ∼880 arcsec. No expansion of the radius of the brightest part of the ejecta was detected, with an upper limit of ≤0.17 arcsec yr –1 . This suggests that the last Z Cam eruption occurred ≥5000 years ago. However, including the important effect of deceleration as the ejecta sweeps up interstellar matter in its snowplow phase reduces the lower limit to 1300 years. This is the first strong test of the prediction of nova thermonuclear runaway theory that the interoutburst times of classical novae are longer than 1000 years. The intriguing suggestion that Z Cam was a bright nova, recorded by Chinese imperial astrologers in October-November 77 B.C.E., is consistent with our measurements. If Z Cam was indeed the nova of 77 B.C.E. we predict that its ejecta are currently expanding at 85 km s –1 , or 0.11 arcsec yr –1 . Detection and measurement of this rate of expansion should be possible in just a few years.
International Nuclear Information System (INIS)
Helton, L. Andrew; Woodward, Charles E.; Gehrz, Robert D.; Walter, Frederick M.; Vanlandingham, Karen; Schwarz, Greg J.; Evans, Aneurin; Ness, Jan-Uwe; Geballe, Thomas R.; Greenhouse, Matthew; Krautter, Joachim; Liller, William; Lynch, David K.; Rudy, Richard J.; Shore, Steven N.; Starrfield, Sumner; Truran, Jim
2010-01-01
We examine the ejecta evolution of the classical nova V1065 Centauri, constructing a detailed picture of the system based on spectrophotometric observations obtained from 9 to approximately 900 days post-outburst with extensive coverage from optical to mid-infrared wavelengths. We estimate a reddening toward the system of E(B-V) = 0.5 ± 0.1, based upon the B - V color and analysis of the Balmer decrement, and derive a distance estimate of 8.7 +2.8 -2.1 kpc. The optical spectral evolution is classified as P o fe N ne A o according to the CTIO Nova Classification system of Williams et al. Photoionization modeling yields absolute abundance values by number, relative to solar of He/H = 1.6 ± 0.3, N/H = 144 ± 34, O/H = 58 ± 18, and Ne/H = 316 ± 58 for the ejecta. We derive an ejected gas mass of M g = (1.6 ± 0.2) x 10 -4 M sun . The infrared excess at late epochs in the evolution of the nova arises from dust condensed in the ejecta composed primarily of silicate grains. We estimate a total dust mass, M d , of order (0.2-3.7) x 10 -7 M sun , inferred from modeling the spectral energy distribution observed with the Spitzer IRS and Gemini-South GNIRS spectrometers. Based on the speed class, neon abundance, and the predominance of silicate dust, we classify V1065 Cen as an ONe-type classical nova.
Policy statement on gas distribution in Nova Scotia
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-01-30
This paper presented Nova Scotia's policy related to gas distribution. The government of Nova Scotia views natural gas as an economic enabler and is committed to ensuring that natural gas is available and accessible to Nova Scotians where it is economically feasible. Natural gas will give the province an efficient and clean burning energy supply that will make existing businesses more competitive. The province will support and facilitate the construction and operation of a gas distribution system by the private sector and will ensure that there is regulatory oversight by the Nova Scotia Utility and Review Board to protect the public interest. The government will also develop a plan for early conversion of government buildings to natural gas. This paper described the province's policy on gas distribution in relation to: (1) a province-wide franchise, (2) a supplemental franchise, (3) cost of service/performance based rates, (4) postage stamp rates, (5) a Maritimes and Northeast lateral policy, (6) direct access/bypass, (7) existing direct access user, (8) bundling of gas sales and other products and services, (9) licensing of gas marketers, (10) benefits, (11), regulatory efficiency, (12) municipal taxes, and (13) municipal operating agreements.
V2487 Oph 1998: a post nova in an intermediate polar
Directory of Open Access Journals (Sweden)
Hernanz Margarita
2014-01-01
Full Text Available V2487 Oph (Nova Oph 1998 is a classical nova that exploded in 1998. XMM-Newton observations performed between 2 and 9 years after the explosion showed emission related to restablished accretion, and indicative of a magnetic white dwarf. The spectrum looks like that of a cataclysmic variable of the intermediate polar type. Anyway, we don’t have yet a definitive confirmation of the intermediate polar character, through determination of spin and orbital periods. Although it is not the first nova exploding in a magnetic white dwarf, it is always challenging to reach explosive conditions when a standard accretion disk can’t be formed, because of the magnetic field. In addition, V2487 Oph has been the first nova where a detection of X-rays - in the host binary system – has been reported prior to its eruption, in 1990 with the ROSAT satellite. V2487 Oph has been also detected in hard X-rays with INTEGRAL/IBIS and RXTE/PCA. Last but not least, V2487 Oph has been identified as a recurrent nova in 2008, since a prior eruption in 1900 has been reported through analysis of Harvard photographic plates. Therefore, it is expected to host a massive white dwarf and be a candidate for a type Ia supernova explosion. In a recent study of the progenitors of galactic novae, it has been emphasized that V2487 Oph is an important and interesting object, "intermediate" between the "standard" classical novae and other historical and well-known recurrent novae with shorter recurrence periods. It could be that in the end there’s a continuous distribution of recurrence periods, instead of the common understanding up to now that "classical" and "recurrent" novae were quite apart (with recurrence periods of more than 104 years and less than 100years - approximately - respectively. We present the results of our campaign of several observations with XMM-Newton. The consequences for the understanding of such a puzzling object are discussed.
Constraining Calcium Production in Novae
Tiwari, Pranjal; C. Fry, C. Wrede Team; A. Chen, J. Liang Collaboration; S. Bishop, T. Faestermann, D. Seiler Collaboration; R. Hertenberger, H. Wirth Collaboration
2017-09-01
Calcium is an element that can be produced by thermonuclear reactions in the hottest classical novae. There are discrepancies between the abundance of Calcium observed in novae and expectations based on astrophysical models. Unbound states 1 MeV above the proton threshold affect the production of Calcium in nova models because they act as resonances in the 38 K(p , γ) 39 Ca reaction present. This work describes an experiment to measure the energies of the excited states of 39 Ca . We will bombard a thin target of 40 Ca with a beam of 22 MeV deuterons, resulting in tritons and 39Ca. We will use a Q3D magnetic spectrograph from the MLL in Garching, Germany to momenta analyze the tritons to observe the excitation energies of the resulting 39 Ca states. Simulations have been run to determine the optimal spectrograph settings. We decided to use a chemically stable target composed of CaF2 , doing so resulted in an extra contaminant, Fluorine, which is dealt with by measuring the background from a LiF target. These simulations have led to settings and targets that will result in the observation of the 39 Ca states of interest with minimal interference from contaminants. Preliminary results from this experiment will be presented. National Sciences and Engineering Research Council of Canada and U.S. National Science Foundation.
G+K 1Σ+/sub g/ double-minimum excited state of H2
International Nuclear Information System (INIS)
Glover, R.M.; Weinhold, F.
1977-01-01
We have obtained a Born--Oppenheimer potential curve for the previously uncharacterized third 1 Σ + /sub g/ state of H 2 , using a correlated 20-term wavefunction of generalized James--Coolidge type. We find this potential curve to have a double-minimum character, with the inner (Rydberg-like) and outer (''ionic'') wells having minima at about 1.99 and 3.30 bohr, respectively, and an intervening maximum at 2.76 bohr. Unlike the extensively studied E+F double-minimum state, the outer well here appears to be the deeper, by some 450 cm -1 in our calculation. The inner and outer minima can apparently be associated with spectral lines that in experimental tables have previously been attributed to distinct G and K electronic states. The appropriate spectroscopic term symbol of this combined state is accordingly G+K 1 Σ + /sub g/ (1ssigma3dsigma+2pπ 2 )
Nova Upgrade program: ignition and beyond
International Nuclear Information System (INIS)
Storm, E.; Campbell, E.M.; Hogan, W.J.; Lindl, J.D.
1993-01-01
The Lawrence Livermore National Laboratory (LLNL) Inertial Confinement Fusion (ICF) Program is addressing the critical physics and technology issues directed toward demonstrating and exploiting ignition and propagating burn to high gain with ICF targets for both defense and civilian applications. Nova is the primary U.S. facility employed in the study of the X-ray-driven (indirect drive) approach to ICF. Nova's principal objective is to demonstrate that laser-driven hohlraums can achieve the conditions of driver-target coupling efficiency, driver irradiation symmetry, driver pulseshaping, target preheat, and hydrodynamic stability required by hot-spot ignition and fuel compression to realize a fusion gain. (author)
2012-01-01
Located next to the car park by the flag poles, a few metres from the Main CERN Reception (building 33), a new snack point catered by Novae will open to the public on Wednesday 8 August. More information will be available in the next issue of the Bulletin!
Multicolour photometry and spectroscopy of the slow nova V475 Sct (Nova Scuti 2003)
Czech Academy of Sciences Publication Activity Database
Chochol, D.; Katysheva, N.A.; Pribulla, T.; Schmidtobreick, L.; Shugarov, S.Yu.; Škoda, Petr; Šlechta, Miroslav; Vittone, A.A.; Volkov, I. M.
2006-01-01
Roč. 6, č. 1 (2006), s. 137-142 ISSN 1009-9271 Institutional research plan: CEZ:AV0Z10030501 Keywords : cataclysmic variables * circumstellar matter * stars: novae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.746, year: 2006
Photometric and spectroscopic variability of the slow nova V475 Sct (Nova Scuti 2003)
Czech Academy of Sciences Publication Activity Database
Chochol, D.; Katysheva, N.A.; Pribulla, T.; Schmidtobreick, L.; Shugarov, S.Yu.; Škoda, Petr; Šlechta, Miroslav; Vittone, A.A.; Volkov, I. M.
2005-01-01
Roč. 35, č. 2 (2005), s. 107-129 ISSN 1335-1842 R&D Projects: GA AV ČR KSK2043105 Institutional research plan: CEZ:AV0Z1003909 Keywords : novae * photometry * spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics
Exendin-4, but not dipeptidyl peptidase IV inhibition, increases small intestinal mass in GK rats
DEFF Research Database (Denmark)
Simonsen, Lotte; Pilgaard, Sofie; Orskov, Cathrine
2007-01-01
Long-term treatment with dipeptidyl peptidase IV inhibitors (DPPIV-I) or glucagon-like peptide (GLP)-1 analogs may potentially affect intestinal growth by down- or upregulating the intestinotrophic hormone GLP-2. This study compared the intestinotrophic effects of 12-wk administration of vehicle......, exendin-4 (Ex-4; 5 nmol/kg bid sc), or DPPIV-I (NN-7201, 10 mg/kg qd orally) in GK rats. Some animals were observed additionally for 9 wk after the end of treatment. Both treatments lowered glycated hemoglobin A1c at wk 12 vs. control (Ex-4, -0.8%; DPPIV-I, -0.4%). Body weight was reduced by Ex-4 compared...... with control (361 +/- 4 vs. 399 +/- 5 g; P weight was identical in all groups...
The progenitor of Nova Cygni 2006 (=V2362 Cyg)
Steeghs, D.; Greimel, R.; Drew, J.; Irwin, M.; Gaensicke, B.; Groot, P.J.; Knigge, C.
2006-01-01
We report on the detection of the likely progenitor to Nova Cygni 2006 = V2362 Cyg (IAUC #8697, #8698, ATel #792) using images from the INT Photometric H-Alpha Survey (IPHAS; http://www.iphas.org). The field containing the classical nova was observed as part of our galactic plane survey on Aug. 3rd
Nova Scotia's new gas distribution regime
Energy Technology Data Exchange (ETDEWEB)
MacIsaac, J.B. [Cox Hanson O' Reilly Matheson, Halifax, NS (Canada)
2002-07-01
The most recent amendments to Nova Scotia's gas distribution regime were described in detail. The amended legislation includes: (1) elimination of mandatory service targets, (2) franchise terms of 25 years, (3) a 10 year prohibition on industrial by-pass, (4) gas sales licenses are now required to market gas in Nova Scotia, (5) distributors can offer bundled services, (6) the elimination of province wide uniform tolls for low volume customers, (7) public utilities are permitted to apply for a distribution franchise and to market natural gas, (8) ex-party filing of interim rates, (9) the Pipeline Act applies to the construction of gas distribution systems, (10) socio-economic studies are required for parties seeking a single-end user franchise outside a franchise area, and (11) regulations for underground gas storage have been removed from the legislation. It was noted that these significant changes to the statutory framework of Nova Scotia's delivery of natural gas are sending encouraging signals to parties considering investing in the distribution network in the province. It was also noted, that as in any industry, success of natural gas distribution in Nova Scotia will depend on economics and not on structural changes. 66 refs.
Cross Check of NOvA Oscillation Probabilities
Energy Technology Data Exchange (ETDEWEB)
Parke, Stephen J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States). Dept. of Theoretical Physics; Messier, Mark D. [Indiana Univ., Bloomington, IN (United States). Dept. of Physics
2018-01-12
In this note we perform a cross check of the programs used by NOvA to calculate the 3-flavor oscillation probabilities with a independent program using a different method. The comparison is performed at 6 significant figures and the agreement, $|\\Delta P|/P$ is better than $10^{-5}$, as good as can be expected with 6 significant figures. In addition, a simple and accurate alternative method to calculate the oscillation probabilities is outlined and compared in the L/E range and matter density relevant for the NOvA experiment.
Chomiuk, Laura; Krauss, Miriam I.; Rupen, Michael P.; Nelson, Thomas; Roy, Nirupam; Sokoloski, Jennifer L.; Mukai, Koji; Munari, Ulisse; Mioduszewski, Amy; Weston, Jeninfer;
2012-01-01
We present multi-frequency radio observations of the 2010 nova event in the symbiotic binary V407 Cygni, obtained with the Karl G. Jansky Very Large Array (VLA) and spanning 1.45 GHz and 17.770 days following discovery. This nova.the first ever detected in gamma rays.shows a radio light curve dominated by the wind of the Mira giant companion, rather than the nova ejecta themselves. The radio luminosity grewas the wind became increasingly ionized by the nova outburst, and faded as the wind was violently heated from within by the nova shock. This study marks the first time that this physical mechanism has been shown to dominate the radio light curve of an astrophysical transient. We do not observe a thermal signature from the nova ejecta or synchrotron emission from the shock, due to the fact that these components were hidden behind the absorbing screen of the Mira wind. We estimate a mass-loss rate for the Mira wind of .Mw approximately equals 10(exp -6) Solar mass yr(exp -1). We also present the only radio detection of V407 Cyg before the 2010 nova, gleaned from unpublished 1993 archival VLA data, which shows that the radio luminosity of the Mira wind varies by a factor of 20 even in quiescence. Although V407 Cyg likely hosts a massive accreting white dwarf, making it a candidate progenitor system for a Type Ia supernova, the dense and radially continuous circumbinary material surrounding V407 Cyg is inconsistent with observational constraints on the environments of most Type Ia supernovae.
Exquisite Nova Light Curves from the Solar Mass Ejection Imager (SMEI)
Hounsell, R.; Bode, M. F.; Hick, P. P.; Buffington, A.; Jackson, B. V.; Clover, J. M.; Shafter, A. W.; Darnley, M. J.; Mawson, N. R.; Steele, I. A.; Evans, A.; Eyres, S. P. S.; O'Brien, T. J.
2010-01-01
We present light curves of three classical novae (KT Eridani, V598 Puppis, V1280 Scorpii) and one recurrent nova (RS Ophiuchi) derived from data obtained by the Solar Mass Ejection Imager (SMEI) on board the Coriolis satellite. SMEI provides near complete sky-map coverage with precision visible-light photometry at 102-minute cadence. The light curves derived from these sky maps offer unprecedented temporal resolution around, and especially before, maximum light, a phase of the nova eruption n...
Nova Aql 1918: A nude old nova
International Nuclear Information System (INIS)
Selvelli, P.L.; Cassatella, A.
1981-01-01
IUE observations at high and low resolution of Nova Aql 1918 show neither evidence of outflow nor the presence of nebular lines. This indicates that the shell ejected at the time of the outburst and surrounding the system for many years (Mustel and Boyarchuck, 1970) has by now disappeared. The high excitation spectrum presents rapid variations in the far UV and eclipse effects in the near UV that seem well correlated with the orbital phase. The observations can be interpreted in terms of phenomena occurring in or near the accretion disk surrounding the white dwarf. However, the small inclination of the orbital axis raises serious problems in trying to model the system. (Auth.)
Tourism Development Plan for Nova Lima, MG/BR: A Case Study
Directory of Open Access Journals (Sweden)
Porto Aluisio Finazzi
2014-01-01
Full Text Available The project called “Tourism Development Plan of Nova Lima, MG” was a labor required by the city of Nova Lima, through the Secretary of Municipal Tourism. The municipality of Nova Lima has numerous tourist attractions or potential for them attractive, and is developing a work of public policies aimed at structuring this activity. The objective of this project was to offer to its population, as well as the government and the private sector, the assurance of quality activity according to the international, national and state the assumptions referred to in the Municipal Tourism Plan. All work was developed by Scientific and Technical Research Data Collection, which took into consideration the participation of local stakeholders in the development of tourism through public hearings with the Section for Local Tourism, making use of Information from the Current Municipal Development Plan for Nova Lima and its Secretary of Tourism. We also note that the study was conducted in accordance with the guidelines and considerations of the Municipal Tourism Council (COMTUR of Nova Lima.
Spectroscopic observations of Nova Cygni 1975: The coronal line region revisited
International Nuclear Information System (INIS)
Ferland, G.J.; Lambert, D.L.; Woodman, J.H.
1986-01-01
A synopsis of the McDonald Observatory spectrophotometric observations of Nova Cyg 1975 (V1500 Cyg) is presented. We present these data in a form in which they can be readily accessed in the future, and also study the continous spectrum during the early nebular phase. We show that (1) the remnant probably maintained a luminosity at or above the Eddington limit for at least a year after outburst, (2) free-free emission from the coronal line region made a significant contribution to the optical continuum, and (3) the coronal line region was probably a significant source of ionizing radiation. The energetics of this nova appear to be dominated by the lift-off energy from the white dwarf and radiation from the coronal line region. Thus the light curve of Nova Cyg may tell more about the cooling of the coronal line region than about the decline of the central object. In appendices we discuss the argon abundance of Nova Cyg (less than 8 times solar) and describe how to obtain copies of the McDonald nova data
Tracking the NOvA Detectors' Performance
Psihas, Fernanda; NOvA Collaboration
2016-03-01
The NOvA experiment measures long baseline νμ -->νe oscillations in Fermilab's NuMI beam. We employ two detectors equipped with over 10 thousand sets of data-taking electronics; avalanche photo diodes and front end boards which collect and process the scintillation signal from particle interactions within the detectors. These sets of electronics -as well as the systems which power and cool them- must be monitored and maintained at precise working conditions to ensure maximal data-taking uptime, good data quality and a lasting life for our detectors. This poster describes the automated systems used on NOvA to simultaneously monitor our data quality, diagnose hardware issues, track our performance and coordinate maintenance for the detectors.
Nova Scotia Resources Limited annual report, 1992
International Nuclear Information System (INIS)
1992-01-01
Nova Scotia Resources was established in 1981 by the provincial government to invest in and manage Nova Scotia's participation in petroleum, energy, and mineral development. The company and its subsidiaries hold interests in oil and gas discovery areas and producing fields in the Nova Scotia offshore, and owns producing oil and gas interests in western Canada. In June 1992, oil production began from the Cohasset project, representing Canada's first commercial offshore oil production. Nearly 4 million bbl of crude will be sold in the first production season. Work is continuing on additional producing wells; the production life of the Cohasset project is currently estimated at 6 y. Offshore exploration activity is also continuing under four exploration licenses. For the 12 months ending March 31, 1992, net earnings from western oil and gas production were $369,000. Total gross revenues from oil and gas producing properties for the year were ca $4.8 million. Other 1992 activities include active exploration for salt and potash sites with potential for underground storage of natural gas. Financial statements are included. 14 figs., 2 tabs
Exquisite Nova Light Curves from the Solar Mass Ejection Imager (SMEI)
Hounsell, R.; Bode, M. F.; Hick, P. P.; Buffington, A.; Jackson, B. V.; Clover, J. M.; Shafter, A. W.; Darnley, M. J.; Mawson, N. R.; Steele, I. A.; Evans, A.; Eyres, S. P. S.; O'Brien, T. J.
2010-11-01
We present light curves of three classical novae (CNe; KT Eridani, V598 Puppis, V1280 Scorpii) and one recurrent nova (RS Ophiuchi) derived from data obtained by the Solar Mass Ejection Imager (SMEI) on board the Coriolis satellite. SMEI provides near complete skymap coverage with precision visible-light photometry at 102 minute cadence. The light curves derived from these skymaps offer unprecedented temporal resolution around, and especially before, maximum light, a phase of the eruption normally not covered by ground-based observations. They allow us to explore fundamental parameters of individual objects including the epoch of the initial explosion, the reality and duration of any pre-maximum halt (found in all three fast novae in our sample), the presence of secondary maxima, speed of decline of the initial light curve, plus precise timing of the onset of dust formation (in V1280 Sco) leading to estimation of the bolometric luminosity, white dwarf mass, and object distance. For KT Eri, Liverpool Telescope SkyCamT data confirm important features of the SMEI light curve and overall our results add weight to the proposed similarities of this object to recurrent rather than to CNe. In RS Oph, comparison with hard X-ray data from the 2006 outburst implies that the onset of the outburst coincides with extensive high-velocity mass loss. It is also noted that two of the four novae we have detected (V598 Pup and KT Eri) were only discovered by ground-based observers weeks or months after maximum light, yet these novae reached peak magnitudes of 3.46 and 5.42, respectively. This emphasizes the fact that many bright novae per year are still overlooked, particularly those of the very fast speed class. Coupled with its ability to observe novae in detail even when relatively close to the Sun in the sky, we estimate that as many as five novae per year may be detectable by SMEI.
First Neutrino Oscillation Results from the NOvA experiment
Energy Technology Data Exchange (ETDEWEB)
Sachdev, Kanika [Fermilab
2016-11-29
NOvA is a long-baseline neutrino oscillation experiment on the NuMI muon neutrino beam at Fermilab. It consists of two functionally identical, nearly fully-active liquid-scintillator tracking calorimeters. The Near Detector (ND) at Fermilab is used to study the neutrino beam spectrum and composition before oscillations occur. The Far Detector in northern Minnesota, 810 km away, observes the oscillated beam and is used to extract the oscillation parameters. NOvA is designed to observe oscillations in two channels: disappearance channel ( ν μ → ν μ ) and ν e appearance channel ( ν μ → ν e ). This paper reports the measurements of both these channels based on the first NOvA data taken from February 16, 2014 till May 15, 2015
Spectrophotometry of nova Cygni 1975
International Nuclear Information System (INIS)
Panek, R.J.
1977-01-01
Low-resolution spectrophotometry of nova Cygni 1975 is presented for eight nights in September 1975. Representative spectrum scans from 3600 A to 4500 A (10 A bandpass) and from 6350 A to 6750 A (20 A bandpass) also are shown
Energy Technology Data Exchange (ETDEWEB)
Hoffman, G. [Nova Scotia Petroleum Directorate, Halifax, NS (Canada)
1998-09-01
Opportunities for the local distribution of natural gas in Nova Scotia were reviewed, with special emphasis on franchising. Franchising in Nova Scotia began in 1980, made possible by the passage of the Gas Utilities Act and the Pipeline Act which promised western Canadian natural gas to eastern Canada. However, proposals for franchisees to distribute natural gas in the province were abandoned as the hope for natural gas transmission service to the province faded. The plummeting of world oil prices by the mid-1980s was also a contributory factor. Discovery and development of natural gas facilities around Sable Island led to the September 1997 proclamation of the Gas Distribution Act, which also led to the revival of interest in franchising. The Act provides for the competitive marketing of natural gas as a commodity and the regulation of the gas delivery system under a franchise agreement. Competitive applications are expected early in 1998, with awards of franchises in late 1998. Construction and gas delivery services should begin operations late in 1999.
International Nuclear Information System (INIS)
Hoffman, G.
1998-01-01
Opportunities for the local distribution of natural gas in Nova Scotia were reviewed, with special emphasis on franchising. Franchising in Nova Scotia began in 1980, made possible by the passage of the Gas Utilities Act and the Pipeline Act which promised western Canadian natural gas to eastern Canada. However, proposals for franchisees to distribute natural gas in the province were abandoned as the hope for natural gas transmission service to the province faded. The plummeting of world oil prices by the mid-1980s was also a contributory factor. Discovery and development of natural gas facilities around Sable Island led to the September 1997 proclamation of the Gas Distribution Act, which also led to the revival of interest in franchising. The Act provides for the competitive marketing of natural gas as a commodity and the regulation of the gas delivery system under a franchise agreement. Competitive applications are expected early in 1998, with awards of franchises in late 1998. Construction and gas delivery services should begin operations late in 1999
Energy Technology Data Exchange (ETDEWEB)
Chomiuk, Laura; Krauss, Miriam I.; Rupen, Michael P.; Roy, Nirupam; Mioduszewski, Amy [National Radio Astronomy Observatory, P.O. Box O, Socorro, NM 87801 (United States); Nelson, Thomas [School of Physics and Astronomy, University of Minnesota, 116 Church Street SE, Minneapolis, MN 55455 (United States); Sokoloski, Jennifer L.; Weston, Jennifer [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Mukai, Koji [CRESST and X-ray Astrophysics Laboratory, NASA/GSFC, Greenbelt, MD 20771 (United States); Munari, Ulisse [INAF Astronomical Observatory of Padova, I-36012 Asiago (VI) (Italy); O' Brien, Tim J. [Jodrell Bank Centre for Astrophysics, University of Manchester, Manchester M13 9PL (United Kingdom); Eyres, Stewart P. S. [Jeremiah Horrocks Institute, University of Central Lancashire, Preston PR1 2HE (United Kingdom); Bode, Michael F., E-mail: chomiuk@pa.msu.edu [Astrophysics Research Institute, Liverpool John Moores University, Twelve Quays House, Egerton Wharf, Birkenhead CH41 1LD (United Kingdom)
2012-12-20
We present multi-frequency radio observations of the 2010 nova event in the symbiotic binary V407 Cygni, obtained with the Karl G. Jansky Very Large Array (VLA) and spanning 1-45 GHz and 17-770 days following discovery. This nova-the first ever detected in gamma rays-shows a radio light curve dominated by the wind of the Mira giant companion, rather than the nova ejecta themselves. The radio luminosity grew as the wind became increasingly ionized by the nova outburst, and faded as the wind was violently heated from within by the nova shock. This study marks the first time that this physical mechanism has been shown to dominate the radio light curve of an astrophysical transient. We do not observe a thermal signature from the nova ejecta or synchrotron emission from the shock, due to the fact that these components were hidden behind the absorbing screen of the Mira wind. We estimate a mass-loss rate for the Mira wind of M-dot{sub w} approx. 10{sup -6} M{sub Sun} yr{sup -1}. We also present the only radio detection of V407 Cyg before the 2010 nova, gleaned from unpublished 1993 archival VLA data, which shows that the radio luminosity of the Mira wind varies by a factor of {approx}>20 even in quiescence. Although V407 Cyg likely hosts a massive accreting white dwarf, making it a candidate progenitor system for a Type Ia supernova, the dense and radially continuous circumbinary material surrounding V407 Cyg is inconsistent with observational constraints on the environments of most Type Ia supernovae.
5. Neuromarketing: uma nova disciplina acadêmica?
Eric David Cohen; Gabriela Guimarães Lima; Peter Alexander Bleinroth Schulz
2017-01-01
Através da aplicação de técnicas neurocientíficas, o Neuromarketing busca entender como ocorrem os processos de decisão de compra. Verifica-se que há um grande movimento em torno do Neuromarketing no ambiente empresarial, apontando que o desenvolvimento desta nova área de conhecimento, bem como a sua possível autonomia, estão em desenvolvimento. Por meio de um estudo exploratório, mapeou-se a construção deste campo de conhecimento no tempo, levando à formação de uma possível nova disciplina c...
New studies of nuclear decay γ-rays from novae
International Nuclear Information System (INIS)
Starrfield, S.; Truran, J.W.; Wiescher, M.C.; Sparks, W.M.
1997-01-01
The cause of the nova outburst is a thermonuclear runaway (TNR) in hydrogen rich material transferred by a companion onto a white dwarf. Studies of this phenomenon have shown that the TNR produces large concentrations of the short lived positron unstable isotopes of the CNO nuclei which are transported to the surface by convection so that early in the outburst we expect significant numbers of radioactive decays to occur at the surface. The resulting γ-ray emission may be detectable from nearby novae early in their outbursts. The TNR is also expected to produce substantial amounts of 7 Be and 22 Na. Their decays also yield potentially detectable levels of γ-ray emission for relatively nearby novae. We are also interested in the role played by novae in the production of the ∼2M circle-dot of 26 Al found in the galaxy. In order to improve our predictions of this phenomenon, we have performed a new set of calculations of TNR close-quote s on ONeMg and CO white dwarfs with an updated nuclear reaction network and opacities. copyright 1997 American Institute of Physics
Hohlraum drive and implosion experiments on Nova. Revision 1
International Nuclear Information System (INIS)
Kilkenny, J.D.; Suter, L.J.; Cable, M.D.
1994-01-01
Experiments on Nova have demonstrated hohlraum radiation temperatures up to 300 eV and in lower temperature experiments reproducible time integrated symmetry to 1--2%. Detailed 2-D LASNEX simulations satisfactorily reproduce Nova's drive and symmetry scaling data bases. Hohlraums has been used for implosion experiments achieving convergence ratios (initial capsule radius/final fuel radius) up to 24 with high density glass surrounding a hot gas fill
Infrared and optical observations of Nova Mus 1983
International Nuclear Information System (INIS)
Whitelock, P.A.; Carter, B.S.; Feast, M.W.; Glass, I.S.; Laney, D.; Menzies, J.W.
1984-01-01
Extensive optical (UBVRI) and infrared (JHKL) photometry of Nova Mus 1983 obtained over a period of 300 days is tabulated. Infrared and optical spectra are described. Although by classical definition this was a fast nova its later development was slower than for typical objects of this class. Surprisingly the development of infrared thermal dust emission did not occur. Throughout the period covered, the infrared emission was characteristic of a bound-free plus free-free plasma continuum with emission lines. (author)
Preliminary performance and ICF target experiments with Nova
International Nuclear Information System (INIS)
Drake, R.P.
1985-11-01
In December 1984, the Nova facility fired all ten laser arms, converted the output 1.05 micron energy to 0.35 micron light, and focused the 0.35 micron light through a 4 mm pinhole in the ten-beam target chamber. Since that time, a two-beam target chamber has been added, the performance of the laser evaluated, and preparation has been made for target experiments. This paper summarizes the performance of Nova and describes progress and plans for target experiments
SALT high-resolution spectroscopy of nova PNV J15384000-4744500
Aydi, E.; Buckley, D. A. H.; Mohamed, S.; Whitelock, P. A.
2018-06-01
We report on high-resolution spectroscopy of PNV J15384000-4744500 which was reported as a possible nova by Rob Kaufman (Bright, Victoria, Australia; CBAT follow-up: http://www.cbat.eps.harvard.edu/unconf/followups/J15384000-4744500.html) and confirmed as a classical nova by F. Walter (ATel #11681).
Statistical analysis of dwarf nova outbursts
International Nuclear Information System (INIS)
Gicger, A.
1987-01-01
Correlation between maximum brightness, outburst width, lengths of preceding and following intervals has been studied for 14 dwarf novae (mostly from southern sky). Significant correlations (ρ ≥ 0.4) occur only in 16 per cent of cases, what confirms earlier results of Szkody and Mattei (1984). Global correlations have also been studied between mean photometric parameters and binary system parameters using a sample including over 30 objects. The most interesting result is the strong correlation (ρ = +0.94) between the orbital period and the outburst duration. It implies that the quantity α(z 0 /r) 2 is approximately constant for all dwarf novae. Using typical estimates for z 0 /r we get α = 0.2. 30 refs., 1 figs., 2 tabs. (author)
Neutrino Oscillation Results from NOvA
CERN. Geneva
2016-01-01
NOvA is an accelerator long-baseline neutrino oscillation experiment optimised to measure electron neutrino appearance in a high-purity beam of muon neutrinos from Fermilab. The exciting discovery of the theta13 neutrino mixing angle in 2012 has opened a door to making multiple new measurements of neutrinos. These include leptonic CP violation, the neutrino mass ordering and the octant of theta23. NOvA with its 810km baseline and higher energy beam has about triple the matter effect of T2K which opens a new window on the neutrino mass ordering. With about 20% of our design beam exposure and significant analysis improvements we have recently released updated results. I will present both our disappearance and appearance measurements.
Ten-year literature review of global endometrial ablation with the NovaSure® device
Directory of Open Access Journals (Sweden)
Gimpelson RJ
2014-03-01
Full Text Available Richard J Gimpelson Mercy Clinic, Minimally Invasive Gynecology, Department of Obstetrics and Gynecology, Mercy Hospital St Louis, St Louis, MO, USA Abstract: This review examines the peer-reviewed literature describing prospective studies that report amenorrhea rates, patient satisfaction, and surgical reintervention rates following the NovaSure® endometrial ablation procedure. A search of the English-language literature published from 2000 to 2011 was conducted using PubMed. Ten prospective studies, six single-arm NovaSure trials, and four randomized controlled trials comparing the NovaSure procedure with other global endometrial ablation modalities met the inclusion criteria and were reviewed. The follow-up periods ranged from 6 to 60 months. Amenorrhea rates for the NovaSure procedure ranged from 30.0% to 75.0%. Patients who reported being satisfied with the NovaSure procedure ranged from 85.0% to 94.0%. In randomized controlled trials with other global endometrial ablation modalities, amenorrhea rates at 12 months with the NovaSure procedure ranged from 43.0% to 56.0%, while other modalities ranged from 8% to 24%. In addition, this manuscript reviews the following: the NovaSure technology; use of the NovaSure procedure in the office setting; intraoperative and postoperative pain; effects on premenstrual syndrome (PMS; dysmenorrhea; special circumstances, including presence of uterine disease, history of cesarean delivery, coagulopathy, or use of anticoagulant medication; post-procedure uterine cavity assessment and cancer risk; contraception and pregnancy; and safety. Keywords: abnormal uterine bleeding, menorrhagia, endometrial ablation, NovaSure®
Quasi-periodic luminosity variations in dwarf novae
International Nuclear Information System (INIS)
Robinson, E.L.; Nather, R.E.
1979-01-01
We have identified quasi-periodic oscillations in the light curves of five dwarf novae--U Gem, SS Cyg, RU Peg, KT Per, and VW Hyi-- and in the light curve of the quasi-periodic X-ray source Sco X-1. The mean periods of the quasi-periodic oscillations range from 32 s in SS Cyg to 147 s in KT Per and 165 s in Sco X-l. Their amplitudes are typically 0.005--0.0l mag. The properties of the quasi-periodic oscillations are represented well by a second-order autoregressive process. Use of this representation shows that the length of time over which the quasi-periodic oscillations maintain coherence is very short, typically 3--5 cycles of the oscillations. Thus the quasi-periodic oscillations can be distinguished from the short-period coherent oscillations in dwarf novae, which are usually interpreted as white dwarf pulsations, because t the periods of the quasi-periodic oscillations are 3--4 times longer and their coherence time is much shorter. The quasi-periodic oscillations occur in dwarf novae only during their eruptions and occur in Sco X-l only when the system is bright. The presence of the oscillations does not depend on the subclass to which a dwarf nova belongs or on the morphology of the individual eruptions. We argue that their short periods, their short coherence times, and their presence in Sco X-l require that the quasi-periodic oscillations be produced by the accretion disk, and not by the stars or by the boundary between the a accretion disk and its central star
Hot spot manifestation in eclipsing dwarf nova HT Cassiopeiae
Bakowska, K.; Olech, A.
2014-01-01
We report the detection of the hot spot in light curves of the eclipsing dwarf nova HT Cassiopeiae during its superoutburst in 2010 November. Analysis of eight reconstructed light curves of the hot spot eclipses showed directly that the brightness of the hot spot was changing significantly during the superoutburst. Thereby, detected hot spot manifestation in HT Cas is the newest observational evidence for the EMT model for dwarf novae.
Multi-wavelength observations of novae in outburst
International Nuclear Information System (INIS)
Starrfield, S.; Arizona State Univ., Tempe, AZ
1989-01-01
This review serves as the introduction to the observational studies of novae and I will mention a number of results that will be emphasized by other reviewers. Therefore, I will try to provide the physical framework for multi-wavelength observations as applied to studies of novae. I divide the outburst into phases based on the physical effects that are occurring at that time. The first phase is the rise to bolometric maximum and occurs on a convective time scale. The second phase is the rise to visual maximum and occurs on the time scale for the envelope to expand to ∼10 12 cm. The third phase is the time when the nova is emitting at constant bolometric luminosity, but declining optical magnitude, and it lasts until most of the accreted material has been either exhausted or eroded from the surface of the white dwarf. The fourth and final phase is the return is the return to quiescence (turn-off phase) and it occurs at the time that nuclear burning is ending. I will discuss each of these phases in turn and end with a discussion. 36 refs
Dynamic testing of NOVA laser switchyard tower
International Nuclear Information System (INIS)
Weaver, H.J.; Pastrnak, J.W.; Fields, D.E.
1984-01-01
NOVA is the latest in a series of powerful laser systems designed to study the feasibility of initiating a controlled fusion reaction by concentrating several laser beams on a small fuel target. The laser components, turning mirrors and target chamber are all mounted on large steel frame structures. These structures were first analyzed via finite element models to access their seismic integrity as well as their overall vibrational stability. When construction was completed, a modal analysis was performed on the structures to verify and improve the finite element models. This report discusses the linking of the analytical and experimental studies for the NOVA switchyard tower structure
Terra Nova breaks new ground for alliances
International Nuclear Information System (INIS)
Ghiselin, D.
1996-01-01
This paper reviews the development of alliances to help develop the Terra Nova oil and gas field in the offshore Atlantic areas of Canada. Largely attributed to BP, the strategic alliance concept got its start in the North Sea and on the North Slope of Alaska. BP saw it as the best way to take advantage of economy-of-scale, mitigate risk, and achieve outsourcing goals while retaining their core competencies. This paper reviews the methods of developing the alliances, the developing of a development plan for the Terra Nova field, and how the alliance plans to maximize the profittability of the operation for all involved
Discovery of a Probable Nova in M81 and Photometry of Three M81 Novae
Hornoch, K.; Errmann, R.; Carlisle, Ch.; Vaduvescu, O.
2015-02-01
We report the discovery of a probable nova in M81 on a co-added 1600-s narrow-band H-alpha CCD image taken with the 2.5-m Isaac Newton Telescope (INT) + WFC at La Palma under ~1.6" seeing on 2015 Jan.
SWSex Stars, Old Novae, and the Evolution of Cataclysmic Variables
Directory of Open Access Journals (Sweden)
L. Schmidtobreick
2015-02-01
Full Text Available The population of cataclysmic variables with orbital periods right above the period gap are dominated by systems with extremely high mass transfer rates, the so-called SW Sextantis stars. On the other hand, some old novae in this period range which are expected to show high mass transfer rate instead show photometric and/or spectroscopic resemblance to low mass transfer systems like dwarf novae. We discuss them as candidates for so-called hibernating systems, CVs that changed their mass transfer behaviour due to a previously experienced nova outburst. This paper is designed to provide input for further research and discussion as the results as such are still very preliminary.
a Synoptic Study of AN X-Ray Nova in Outburst
McClintock, Jeffrey
Optical studies of X-ray novae in quiescence have yielded compelling evidence for black holes in binary systems. However, X-ray studies in quiescence are severely constrained by the near absence of high energy emission. Thus, further observational advances in black hole astrophysics require a substantial commitment to observe X-ray novae in outburst in just that spectral range accessible to XTE. We propose an agressive campaign of X-ray observations of the next non-pulsing X-ray nova that rises above 3 Crab at 2-10 keV. We further propose a coordinated and intensive campaign of optical and radio observations covering both hemispheres. The observations will provide a full temporal and spectral view of the outburst cycle.
Status for CASA NOVA konsortiet
DEFF Research Database (Denmark)
Bonke, Sten
1997-01-01
The report reviews the development projects and the results hitherto achieved by the design and build organisation CASA NOVA which is one of four consortia within the R&D programme "Process and Product Development in Building", financed by the Ministry of Industry and the Ministry of Housing....
Non-LTE model atmosphere analysis of Nova Cygni 1992
Hauschildt, P. H.; Starrfield, S.; Austin, S.; Wagner, R. M.; Shore, S. N.; Sonneborn, G.
1994-01-01
We use spherically symmetric non-local thermodynamic equilibrium (non-LTE), line-blanketed, expanding model atmospheres to analyze the International Ultraviolet Explorer (IUE) and optical spectra of Nova Cygni 1992 during the early phases of its outburst. We find that the first IUE spectrum obtained just after discovery on 1992 February 20, is best reproduced by a model atmosphere with a steep density gradient and homologous expansion, whereas the IUE and optical spectra obtained on February 24 show an extended, optically thick, wind structure. Therefore, we distinguish two phases of the early evolution of the nova photosphere: the initial, rapid, 'fireball' phase and the subsequent, much longer, optically thick 'wind' phase. The importance of line-blanketing in nova spectra is demonstrated. Our preliminary abundance analysis implies that hydrogen is depeleted in the ejecta, corresponding to abundance enhancements of Fe by a factor of approximately 2 and of CNO by more than a factor of 10 when compared to solar abundances. The synthetic spectra reproduce both the observed pseudo-continua as well as most of the observed features from the UV to the optical spectral range and demonstrate the importance of obtaining nearly simultaneous UV and optical spectra for performing accurate analyses of expanding stellar atmospheres (for both novae and supernovae).
Joshi, Vishal; Banerjee, D. P. K.; Srivastava, Mudit
2017-12-01
We present a series of near-infrared spectra of Nova Ophiuchus 2017 in the K band that record the evolution of the first overtone CO emission in unprecedented detail. Starting from 11.7 days after maximum, when CO is first detected at great strength, the spectra track the CO emission to +25.6 days by which time it is found to have rapidly declined in strength by almost a factor of ∼35. The cause for the rapid destruction of CO is examined in the framework of different mechanisms for CO destruction, namely, an increase in photoionizating flux, chemical pathways of destruction, or destruction by energetic nonthermal particles created in shocks. From LTE modeling of the CO emission, the 12C/13C ratio is determined to be 1.6 ± 0.3. This is consistent with the expected value of this parameter from nucleosynthesis theory for a nova eruption occuring on a low mass (∼ 0.6 {M}ȯ ) carbon–oxygen core white dwarf. The present 12C/13C estimate constitutes one of the most secure estimates of this ratio in a classical nova.
Soft x-ray emission from classical novae in outburst
International Nuclear Information System (INIS)
Starrfield, S.; Krautter, J.; MacDonald, J.
1989-01-01
Theoretical modeling of novae in outburst predicts that they should be active emitters of radiation at soft x-ray wavelengths twice during their outburst. The first time occurs very early in the outburst when only a very sensitive all sky survey will be able to detect them. This period lasts only a few hours for the very fastest novae. They again become bright in x-rays late in the outburst when the remnant object becomes very hot and is still luminous. Both simulations and observations show that novae can remain very hot for months to years. It is important to observe them at these late times because a measurement both of the flux and temperature can provide information about the mass of the white dwarf, the turn-off time scale, and the energy budget of the outburst. 8 refs., 2 figs
DEFF Research Database (Denmark)
List, K; Jensen, Ole Nørregaard; Bugge, T H
2000-01-01
)-antitrypsin. We suggest that mouse glandular kallikrein mGK-6 is an activator of pro-uPA in the mouse urinary tract in vivo. Since this kallikrein is expressed in a number of tissues and also occurs in plasma, it can also be considered a candidate for a physiological pro-uPA activator in other locations....
A multiwavelength study of superoutbursts in dwarf novae
International Nuclear Information System (INIS)
Woerd, H.J. van der.
1987-01-01
Dwarf novae are stellar systems consisting of two stars which orbit around each other within a few hours. In dwarf novae one of the stars, which is a bit smaller and less massive than our sun, loses matter to a very compact and degenerated star: a white dwarf. This white dwarf has nearly the same mass as our sun but its radius is about a hundred times smaller. The process of mass transport was studied on the basis of observations with the Exosat-satelite (European X-ray Observatory satelite). 397 refs.; 50 figs.; 21 tabs
On the late-type components of slow novae and symbiotic stars
International Nuclear Information System (INIS)
Allen, D.A.
1980-01-01
It is argued that the various types of symbiotic stars and the slow novae are the same phenomena exhibiting a range of associated time-scales, the slow novae being of intermediate speed. Evidence is summarized showing that both types of object contain normal M giants or mira variables. This fact is at odds with currently fashionable single-star models for slow novae, according to which the M star is totally disrupted before the outburst. Spectral types of the late-type components are presented for nearly 80 symbiotic stars and slow novae, derived from 2 μm spectroscopy. It is found that both the intensity of the emission spectrum and the electron density of the gas are functions of the spectral type of the late-type star. Explanations for these correlations are given. On the assumption that the late-type components are normal giants, spectroscopic parallaxes are determined; credible distances are derived which indicate that the known symbiotic stars have been sampled as far afield as the Galactic Centre. Hydrogen shell flashes on a white dwarf accreting gas from the late-type components offer an attractive explanation of the phenomena of slow novae and symbiotic stars, and such models are discussed in the concluding section. (author)
An Emerging Wine Region in Nova Scotia, Canada: Terroir Trials and Tribulations
Cameron, B. I.; Ketter, B. S.; Karakis, S.
2012-12-01
Nova Scotia, strategically located on Canada's east coast, is an emerging wine region, whose distinctive wines are garnering international acclaim. Nova Scotia has a long and rich tradition of growing grapes for wine dating back as far as 1611. Nova Scotia's mesoclimates, glacial soils, and proximity to the Atlantic Ocean form a complex alliance to create a unique and expressive terroir. Tidal Bay is a new appellation wine for Nova Scotia stylistically defined as a fresh, crisp and high-acid blend of white grapes. There are four main wine-growing regions in Nova Scotia, all influenced by the warming effects of the Bay of Fundy and Atlantic Ocean: Malagash Peninsula, Annapolis Valley, Bear River Valley and the South Shore. Nova Scotia currently has 14 producing wineries with many more in the development stage. Nova Scotia grape growers not only have had success developing mature and consistent hybrids, but in recent years several vinifera have flourished in this cool climate area. The white hybrids include L'Acadie Blanc, New York Muscat, Seyval Blanc, and Vidal Blanc. The white vinifera include chardonnay, riesling, pinot gris, and sauvignon blanc. Red hybrids are Baco Noir, Leon Millet, Lucie Kuhlmann, and Marechal Foch, whereas the only red vinifera is pinot noir. Nova Scotia has nearly perfect climatic conditions for making world class icewines and sparkling wines. A preliminary GIS analysis of climate, topographic, geology and soil data helps to define Nova Scotia's terroir. Annual precipiatation varies from 10 to 21.6 cm/year with a vast majority of the wineries located in regions with the lowest rainfall. Daily average temperature ranges from 5.5 to 7.5°C, degree growing days above 5°C from 1382 to 1991, and mean August temperature from 15.6 to 19.3 °C. Wineries cluster in the warmest regions based on these temperature measures to assist grape ripening. Soils in these diverse wine regions can range from silty, sandy and clay loams to more gravel-rich sandy
ASASSN-18gb: Discovery of A Probable Nova in NGC 3109
Brimacombe, J.; Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Brown, J. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.; Holmbo, S.
2018-03-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, we discovered a new transient source, most likely a nova, in the Local Group galaxy NGC 3109.
Spectral and photometric study of the symbiotic nova RS ophiuchus in quiet phase
Kondratyeva, L.; Rspaev, F.; Krugov, M.; Serebryanskiy, A.
2017-07-01
The results of spectral and photometric study of the recurrent Nova RS Ophiuchus are presented and discussed. Observations were carried out in 2009-2016. During these eight years the fluxes of HI and FeII emission lines have slightly decreased by a factor of 3 - 4. Hα and Hβ exhibit double-peaked profiles with a central absorption. The ratio of the blue and red peaks intensities(V/R) varies from 0.3 to 1.0 for Hβ and from 0.4 to 0.7 for Hα. Possible correlations between changes of the ratio and other spectral parameters were investigated. Dependence of V/R on the radial velocity of absorbtion component is found out.
Measurement of Reactions on 30P for Nova Nucleosynthesis
Ma, Z.; Guidry, M. W.; Hix, W. R.; Smith, M. S.
2003-05-01
Replace these paragraphs with your abstract. We encourage you to include a sentence acknowledging your funding agency. In a recent study the 30P(p,gamma)31S rate played a crucial role in the synthesis of heavier nuclear species, from Si to Ca, in nova outbursts on ONe White Dwarfs [1]. The adopted rate of this reaction, based on a Hauser-Feshbach calculation [2], has a large uncertainty and could be as much as a factor of 100 too high or too low [3]. In their study, Jose et al.[1] varied the 30P(p,gamma)31S reaction rate within this uncertainty and found that, when rate is reduced by a factor of 100, the synthesis of elements above Si is lowered by a factor 10 with respect to the values found with the nominal rate. This has important consequences for nova nucleosynthesis, as overproduction of isotopes in the Si to Ca mass region has been observed in the ejecta from some nova explosions (e.g.,[4,5]). While generally valid at higher temperatures, Hauser-Feshbach calculations of the rates at nova temperatures can have large uncertainties. At these temperatures, the rate is more likely dominated by a few individual nuclear resonances. At present there are about 10 31S resonances known above the 30P + p threshold that may contribute to the 30P(p,gamma)31S reaction rate at nova temperatures. The excitation energies of these levels are known but spins and parities (for all but two) are not. We plan to measure the 30P(p,p)30P and 30P(p,gamma)31S reactions at HRIBF to better determine this reaction rate. A detailed description of the experiments will be given. We are also conducting a new nova nucleosynthesis simulation over multiple spatial zones of the exploding envelope to investigate the influence of the 30P(p,gamma)31S reaction rate on nova nucleosynthesis. The results of these calculations will be discussed. 1. Jose , J., Coc, A., Hernanz, M., Astrophys. J., 560, 897(2001). 2. Thielemann, F.-K et al., 1987, Advances in Nuclear Astrophysics, ed. E. Vangioni-Flam ( Gif
Shore, S. N.; Wahlgren, G. M.; Augusteijn, T.; Liimets, T.; Koubsky, P.; Slechta, M.; Votruba, V.
2011-01-01
The nova outburst of V407 Cyg in 2010 Mar. 10 was the first observed for this star but its close resemblance to the well known symbiotic-like recurrent nova RS Oph suggests that it is also a member of this rare type of Galactic novae. The nova was the first detected at gamma-ray energies and is the first known nova explosion for this system. The extensive multiwavelength coverage of this outburst makes it an ideal comparison with the few other outbursts known for similar systems. We extend our previous analysis of the Mira and the expanding shock from the explosion to detail the time development of the photoionized Mira wind, circumstellar medium, and shocked circumstellar environment to derive their physical parameters and how they relate to large scale structure of the environment, extending the previous coverage to more than 500 days after outburst. We use optical spectra obtained at high resolution with the Nordic Optical Telescope (NOT) (R approx. =.45000 to 65000) and medium resolution Ondrejov Observatory (R approx. = 12000) data and compare the line variations with publicly available archival measurements at 30 GHz OVNR and at X-rays with Swift during the first four months of the outburst, through the end of the epoch of strong XR emission. We use nebular diagnostics and high resolution profile variations to derive the densities and locations of the extended emission. We find that the higher the ionization and/or the higher the excitation energy, the more closely the profiles resemble the He II/Ca V-type high velocity shock profile discussed in Paper I. This also accounts for the comparative development of the [N II] and [O III] isoelectronic transitions: the [O III] 4363A profile does not show the low velocity peaks while the excited [N II] 5754A does. If nitrogen is mainly N(+3) or higher in the shock, the upper state of the [N II] nebular lines will contribute but if the oxygen is O(+2) then this line is formed by recombination, masking the nebular
Upgrade of the LLNL Nova laser for inertial confinement fusion
International Nuclear Information System (INIS)
Murray, J.R.; Trenholme, J.B.; Hunt, J.T.; Frank, D.N.; Lowdermilk, W.H.; Storm, E.
1991-01-01
The Lawrence Livermore National Laboratory has proposed to construct an upgrade to the Nova glass laser facility to give an output energy of 1.5-2 megajoules at 350 nanometers wavelength in a nominally 3--5 nanosecond shaped pulse. The Nova Upgrade will be suitable for driving inertial fusion targets to ignition. This paper reviews the design proposed for the laser. 14 refs., 10 figs., 1 tab
UMA NOVA PRIMAVERA PARA A IGREJA
Directory of Open Access Journals (Sweden)
Marcelo Barros
2003-01-01
Full Text Available Nos últimos anos, as Igrejas cristãs vivem um tempo especial de abertura espiritual e humana. Tudo começou por um profundo diálogo com a humanidade. No caso das Igrejas evangélicas e ortodoxas, reunidas no Conselho Mundial de Igrejas, a sua assembléia geral teve como tema “Faço novas todas as coisas” (Ap 21,5. No caso da Igreja Católica, como mandou o Concílio Vaticano II, ela tem procurado renovar “até costumes veneráveis e ancestrais” para adequar-se à humanidade de hoje. Todos, tanto as pessoas favoráveis a este processo, como as que não concordam, percebem a vitalidade espiritual e o empenho com que toda a Igreja, fieís e pastores, confronta sua vida com o Evangelho de Jesus Cristo e se empenha na missão de testemunhar não a si mesma, mas o Reino de Deus. Nos meios de comunicação, entre as pessoas que são para a humanidade referência de autoridade ética e promotores de solidariedade e da paz estão muitos bispos e pastores dos países pobres do mundo.
FAR-ULTRAVIOLET SPECTROSCOPY OF THE NOVA-LIKE VARIABLE KQ MONOCEROTIS: A NEW SW SEXTANTIS STAR?
International Nuclear Information System (INIS)
Wolfe, Aaron; Sion, Edward M.; Bond, Howard E.
2013-01-01
New optical spectra obtained with the SMARTS 1.5 m telescope and archival International Ultraviolet Explorer (IUE) far-ultraviolet (FUV) spectra of the nova-like variable KQ Mon are discussed. The optical spectra reveal Balmer lines in absorption as well as He I absorption superposed on a blue continuum. The 2011 optical spectrum is similar to the KPNO 2.1 m IIDS spectrum we obtained 33 years earlier except that the Balmer and He I absorption is stronger in 2011. Far-ultraviolet IUE spectra reveal deep absorption lines due to C II, Si III, Si IV, C IV, and He II, but no P Cygni profiles indicative of wind outflow. We present the results of the first synthetic spectral analysis of the IUE archival spectra of KQ Mon with realistic optically thick, steady-state, viscous accretion-disk models with vertical structure and high-gravity photosphere models. We find that the photosphere of the white dwarf (WD) contributes very little FUV flux to the spectrum and is overwhelmed by the accretion light of a steady disk. Disk models corresponding to a WD mass of ∼0.6 M ☉ , with an accretion rate of order 10 –9 M ☉ yr –1 and disk inclinations between 60° and 75°, yield distances from the normalization in the range of 144-165 pc. KQ Mon is discussed with respect to other nova-like variables. Its spectroscopic similarity to the FUV spectra of three definite SW Sex stars suggests that it is likely a member of the SW Sex class and lends support to the possibility that the WD is magnetic.
Optical polarimetry and distance estimate for Nova Cygni 1975
Energy Technology Data Exchange (ETDEWEB)
McLean, I S [Glasgow Univ. (UK). Observatory
1976-07-01
Polarization observations of Nova Cygni 1975 were obtained with several passbands in the wavelength interval lambda lambda 4600 to 6700 A before and after maximum light. Special attention was given to the regions of H..cap alpha.. and H..beta.. emission. On average, a precision of +- 0.04 per cent polarization was obtained in these observations. Statistically significant evidence for the presence of an intrinsically-polarized component in the light from the nova is very weak, but such a component is not completely ruled out. Any variability, however, is likely to be less than 0.18 per cent polarization. The observed polarization (1.38 per cent at lambda 5460), is therefore attributed mainly to scattering in the interstellar medium and the amount of polarization is employed to give a rough estimate of the distance of the nova and its absolute magnitude at maximum brightness, namely 1.14 kpc and -10sup(m).1.
International Nuclear Information System (INIS)
Kenyon, S.J.; Truran, J.W.
1983-01-01
We discuss possible conditions under which thermonuclear burning episodes in the hydrogen-rich envelopes of accreting white dwarfs give rise to outbursts similar in nature to those observed in the symbiotic stars AG Peg, RT Ser, RR Tel, AS 239, V1016 Cyg, V1329 Cyg, and HM Sge. In principle, thermonuclear runaways involving low-luminosity white dwarfs accreting matter at low rates produce configurations that evolve into A--F supergiants at maximum visual light and which resemble the outbursts of RR Tel, RT Ser, and AG peg. Very weak, nondegenerage hydrogen shell flashes on white dwarfs accreting matter at high rates (M> or approx. =10 -8 M/sub sun/ yr -1 ) do not produce cool supergiants at maximum, and may explain the outbursts in V1016 Cyg, V1329 Cyg, and HM Sge. The low accretion rates demanded for systems developing strong hydrogen shell flashes on low-luminsoity white dwarfs are not compatible with observations of ''normal'' quiescent symbiotic stars. The extremely slow outbursts of symbiotic novae appear to be typical of accreting white dwarfs in wide binaries, which suggests that the outbursts of classical novae may be accelerated by the interaction of the expanding white dwarf envelope with its close binary companion
The PIP-II Reference Design Report
Energy Technology Data Exchange (ETDEWEB)
Lebedev, Valeri, [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); et al.
2015-06-01
The Proton Improvement Plan-II (PIP-II) is a high-intensity proton facility being developed to support a world-leading neutrino program over the next two decades at Fermilab. PIP-II is an integral part of the U.S. Intensity Frontier Roadmap as described in the Particle Physics Project Prioritization Panel (P5) report of May 2014 [1]. As an immediate goal PIP-II is focused on upgrades to the Fermilab accelerator complex capable of providing a beam power in excess of 1 MW on target at the initiation of LBNF [1,2] operations. PIP-II is a part of a longer-term concept for a sustained campaign of upgrades and improvements to achieve multi-MW capabilities at Fermilab. PIP-II is based on three major thrusts. They are (1) the recently completed upgrades to the Recycler and Main Injector (MI) for the NOvA experiment, (2) the Proton Improvement Plan [3] currently underway, and (3) the Project X Reference Design [4]. Note that: The Proton Improvement Plan (PIP) consolidates a set of improvements to the existing Linac, Booster, and Main Injector (MI) aimed at supporting 15 Hz Booster beam operation. In combination, the NOvA upgrades and PIP create a capability of delivering 700 kW beam power from the Main Injector at 120 GeV; The scope of the Project X Reference Design Report was aimed well beyond PIP. It described a complete concept for a multi-MW proton facility that could support a broad particle physics program based on neutrino, kaon, muon, and nucleon experiments [5,6]. The Project X conceptual design has evolved over a number of years, incorporating continuous input on physics research goals and advances in the underlying technology development programs [7,8,9]. PIP-II, to high degree, inherits these goals as the goals for future developments and upgrades. This document (PIP-II Reference Design Report) describes an initial step in the development of the Fermilab accelerating complex. The plan described in this Report balances the far-term goals of the Laboratory
NuSTAR Observations of Fermi-detected Novae, V339 Delphini and V5668 Sagitarii
Mukai, K.; Nelson, T.; Sokoloski, J.; Chomiuk, L.; Finzell, T.; Linford, J.; Weston, J.; Rupen, M.; Mioduszewski, A.
2017-10-01
Ten Galactic novae have been detected as transient GeV gamma-ray sources with Fermi/LAT to date, presumably due to shock acceleration that produces relativistic particles. This unexpected discovery highlights the complexity of the mass ejection process in novae. It has also added a new class of objects in which particle acceleration can be studied. We can in principle study the same shock in X-rays through their thermal emission and the lower energy extension of the non-thermal emission. Here we present our NuSTAR observations of two Fermi-detected novae, V339 Del and V5668 Sgr, that were carried out while they were being detected with the LAT. We did not detect thermal or non-thermal emissions from these novae. Our results place a tight limit on the properties of the putative shocks in V339 Del and V5668 Sgr. We also compare our results with previous reports of possible detection of non-thermal hard X-rays from novae, and discuss the implications in the context of our current understanding of the complicated process of mass ejection in novae.
High Energy Neutrino Physics with NOvA
Energy Technology Data Exchange (ETDEWEB)
Coan, Thomas [Southern Methodist Univ. , Dallas, TX (United States)
2016-09-09
Knowledge of the position of energy deposition in “hit” detector cells of the NOvA neutrino detector is required by algorithms for pattern reconstruction and particle identification necessary to interpret the raw data. To increase the accuracy of this process, the majority of NOvA's 350 000 far detector cell shapes, including distortions, were measured as they were constructed. Using a special laser scanning system installed at the site of the NOvA far detector in Ash River, MN, we completed algorithmic development and measured shape parameters for the far detector. The algorithm and the measurements are “published” in NOνA’s document database (doc #10389, “Cell Center Finder for the NOνA Far Detector Modules”).
NOVA[R] Spring 2002 Teacher's Guide.
Armstrong, Peter; Ransick, Kristi; Rosene, Dale; Sammons, James
The guide presents lesson plans from "NOVA" which targets middle school and junior high school students and meet the National Science Education Standards. Lessons include: (1) "Neanderthals on Trial"; (2) "Fireworks"; (3) "Secrets, Lies and Atomic Spies"; (4) "Bioterror"; (5) "The Missing…
Theoretical and observational review of results on nova explosions occurring on ONeMg white dwarfs
International Nuclear Information System (INIS)
Starrfield, S.
1986-01-01
The nova outburst is the second most violent explosion that occurs in a galaxy. This review presents the recent observational and theoretical studies that have demonstrated that there exist two classes of nova outburst. One type of nova occurs on a CO white dwarf and the other type of nova occurs on an ONeMg white dwarf. The second class of outbursts are much more violent and occur much more frequently then the first class of outbursts. Hydrodynamic simulations of both kinds of outbursts are in excellent agreement with the observations. 51 refs
James, L. Allan; Phillips, Jonathan D.; Lecce, Scott A.
2017-10-01
This special issue celebrates the centennial of the publication of G.K. Gilbert's (1917) monograph, Hydraulic-Mining Débris in the Sierra Nevada, U.S. Geological Survey Professional Paper 105 (PP105). Reasons to celebrate PP105 are manifold. It was the last of four classic monographs that Gilbert wrote in a career that spanned five decades. The monograph, PP105, introduced several important concepts and provided an integrated view of watersheds that was uncommon in its day. It also provided an extreme, lucid example of anthropogenic changes and legacy sediment and how to approach such large-scale phenomena from an objective, quantitative basis.
Discovery of an old nova shell surrounding the cataclysmic variable V1315 Aql
Sahman, D. I.; Dhillon, V. S.; Littlefair, S. P.; Hallinan, G.
2018-04-01
Following our tentative discovery of a faint shell around V1315 Aql reported in Sahman et al. (2015), we undertook deep Hα imaging and intermediate-resolution spectroscopy of the shell. We find that the shell has its geometric centre located on V1315 Aql. The mass, spectral features and density of the shell are consistent with other nova shells, rather than planetary nebulae or supernova remnants. The radial velocity of the shell is consistent with the systemic velocity of V1315 Aql. We believe this evidence strongly suggests that the shell originates from an earlier nova event. This is the first nova shell discovered around a novalike, and supports the theory of nova-induced cycles in mass transfer rates (hibernation theory) first proposed by Shara et al. (1986).
High density implosion experiments at Nova
International Nuclear Information System (INIS)
Cable, M.D.; Hatchett, S.P.; Nelson, M.B.; Lerche, R.A.; Murphy, T.J.; Ress, D.B.
1994-01-01
Deuterium filled glass microballoons are used as indirectly driven targets for implosion experiments at the Nova Laser Fusion Facility. High levels of laser precision were required to achieve fuel densities and convergences to an ignition scale hot spot. (AIP) copyright 1994 American Institute of Physics
5. Neuromarketing: uma nova disciplina acadêmica?
Directory of Open Access Journals (Sweden)
Eric David Cohen
2017-12-01
Full Text Available Através da aplicação de técnicas neurocientíficas, o Neuromarketing busca entender como ocorrem os processos de decisão de compra. Verifica-se que há um grande movimento em torno do Neuromarketing no ambiente empresarial, apontando que o desenvolvimento desta nova área de conhecimento, bem como a sua possível autonomia, estão em desenvolvimento. Por meio de um estudo exploratório, mapeou-se a construção deste campo de conhecimento no tempo, levando à formação de uma possível nova disciplina científica e acadêmica, assim como verificar a sua origem interdisciplinar. Ademais, apresenta-se a construção de um mapa a partir de dados secundários, de modo a demonstrar a percepção da história e das contribuições potenciais do Neuromarketing, a partir de uma análise da produção científica na área. A partir de um conjunto de dados levantados, conclui-se que existe uma dinâmica de construção do Neuromarketing em torno dos diferentes atores na academia e nos negócios, levando à formulação de hipóteses quanto à maturidade desta nova disciplina acadêmica.
ECONOMIA SOCIAL INCORPORATIVA (e as novas linguagens
Directory of Open Access Journals (Sweden)
Welinton dos Santos
2017-05-01
Full Text Available A inovação tecnológica aliada à interação de comunicação sem limites, chamada de “Economia Social Incorporativa”, sendo uma rede integrada e sociável as populações do mundo. Baseada em uma pesquisa bibliográfica de caráter qualitativo e documental mostrando que a comunicação, informações e tecnologias evoluem surgindo novos materiais em destaque o grafeno, composto por átomos de carbono com alta condutividade térmica e elétrica, flexível e resistente, material que pode substituir o silício e permitir a segunda revolução tecnológica e levando consigo a economia. Com esses feitos tecnológicos a humanidade tende a estar mais do que nunca com uma ligação inseparável das novas tecnologias que vem aparecendo de forma exponencial no mercado estimulando assim mais do que nunca a economia social. O futuro visa uma nova economia que está em transformação, provocando mudanças significativas na política econômica mundial, e por isso, todos os esforços nesta nova dinâmica de conscientização do comportamento social integrativo auxilia numa política estratégica global mais justa e igualitária.
NOVAE WITH LONG-LASTING SUPERSOFT EMISSION THAT DRIVE A HIGH ACCRETION RATE
International Nuclear Information System (INIS)
Schaefer, Bradley E.; Collazzi, Andrew C.
2010-01-01
We identify a new class of novae characterized by the post-eruption quiescent light curve being more than roughly a factor of 10 brighter than the pre-eruption light curve. Eight novae (V723 Cas, V1500 Cyg, V1974 Cyg, GQ Mus, CP Pup, T Pyx, V4633 Sgr, and RW UMi) are separated out as being significantly distinct from other novae. This group shares a suite of uncommon properties, characterized by the post-eruption magnitude being much brighter than before eruption, short orbital periods, long-lasting supersoft emission following the eruption, a highly magnetized white dwarf (WD), and secular declines during the post-eruption quiescence. We present a basic physical picture which shows why all five uncommon properties are causally connected. In general, novae show supersoft emission due to hydrogen burning on the WD in the final portion of the eruption, and this hydrogen burning will be long-lasting if new hydrogen is poured onto the surface at a sufficient rate. Most novae do not have adequate accretion for continuous hydrogen burning, but some can achieve this if the companion star is nearby (with short orbital period) and a magnetic field channels the matter onto a small area on the WD so as to produce a locally high accretion rate. The resultant supersoft flux irradiates the companion star and drives a higher accretion rate (with a brighter post-eruption phase), which serves to keep the hydrogen burning and the supersoft flux going. The feedback loop cannot be perfectly self-sustaining, so the supersoft flux will decline over time, forcing a decline in the accretion rate and the system brightness. We name this new group after the prototype, V1500 Cyg. V1500 Cyg stars are definitely not progenitors of Type Ia supernovae. The V1500 Cyg stars have similar physical mechanisms and appearances as predicted for nova by the hibernation model, but with this group accounting for only 14% of novae.
ASAS-SN Discovery of a Possible Galactic Nova ASASSN-18ix
Stanek, K. Z.; Kochanek, C. S.; Shields, J. V.; Thompson, T. A.; Chomiuk, L.; Strader, J.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Dong, Subo; Stritzinger, M.
2018-04-01
During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from multiple ASAS-SN telescopes, we detect a new bright transient source, possibly a classical nova, but it might also be a young, large amplitude outburst of a cataclysmic variable Object RA (J2000) DEC (J2000) Gal l (deg) Gal b (deg) Disc.
Restablished Accretion in Post-outburst Classical Novae Revealed by X-rays
Hernanz, Margarita; Ferri, Carlo; Sala, Glòria
2009-05-01
Classical novae are explosions on accreting white dwarfs (hereinafter WDs) in cataclysmic variables (hereinafter CVs) a hydrogen thermonuclear runaway on top of the WD is responsible for the outburst. X-rays provide a unique way to study the turn-off of H-burning, because super soft X-rays reveal the hot WD photosphere, but also to understand how accretion is established again in the binary system. Observations with XMM-Newton of some post-outburst novae have revealed such a process, but a coverage up to larger energies -as Simbol-X will provide- is fundamental to well understand the characteristics of the binary system and of the nova ejecta. We present a brief summary of our results up to now and prospects for the Simbol-X mission.
La Dous, Constanze
1991-01-01
IUE observations of dwarf novae at maximum at quiescence and novalike objects at the high brightness state are analyzed for effects of the inclination angle on the emitted continuum and line radiation. A clear pattern in the continuum flux distribution is exhibited only by dwarf novae at maximum where some 80 percent of the non-double-eclipsing systems show essentially identical distributions. This result is not in disagreement with theoretical expectations. All classes of objects exhibit a clear, but in each case different, dependence of the line radiation on the inclination angle.
Role of thermonuclear instability in recent models of nova stars
Energy Technology Data Exchange (ETDEWEB)
Secco, L [Padua Univ. (Italy). Ist. di Astronomia
1981-10-11
In this paper we review models of nova-star explosion based on the original suggestion by Kraft and developed during about ten years (from 1967). We aim at summarizing here the most salient results of those theoretical models and to point out the many aspects of the problems that are still unsettled. In particular, we analyse thermonuclear instabilities both in perfect and electron-degenerate gas, since they seem to be at the base of the nova explosion phenomena.
Detection of Highly-Absorbed X-rays from Nova Mus 2018 with Swift
Nelson, Thomas; Kuin, Paul; Mukai, Koji; Page, Kim; Chomiuk, Laura; Kawash, Adam; Sokoloski, J. L.; Linford, Justin; Rupen, Michael P.; Mioduszewski, Amy
2018-03-01
We report the detection of X-rays from Nova Mus 2018 with the Swift XRT instrument. We have been carrying out weekly monitoring of the nova with Swift since its discovery on 2018 Jan 15 (see ATel #11220), and observations up to 2018 Feb 24 yielded X-ray non-detections.
O rap radical e a "nova classe média"
Directory of Open Access Journals (Sweden)
Ricardo Indig Teperman
2015-04-01
Full Text Available Este artigo discute a recente alteração na posição relativa do rap e dos rappers no campo da produção cultural no Brasil. O grupo Racionais MCs, tão central no campo do rap nacional que acaba por determinar a tendência hegemônica do gênero, vem se afastando do posicionamento revolucionário que marcou seus primeiros anos. Proponho que o aumento do poder de consumo e a democratização do acesso à tecnologia e à educação são aspectos que marcam a experiência da nova geração do rap (a chamada "nova escola", personificada em Emicida, e que provocaram o reposicionamento do Racionais. Recupero uma formulação de Antonio Candido para propor que essa nova posição pode ser considerada "radical".
Province of Nova Scotia Electricity Marketplace Governance Committee First Interim Report
International Nuclear Information System (INIS)
2002-12-01
This report summarizes the group discussions of the Electricity Marketplace Governance Committee's (EMGC) over the past 6 months regarding the implementation of new rules for power competition in Nova Scotia's electricity market. Emphasis has been placed on external influences, defining the size and form of the short-term competitive portion of the Nova Scotia market, and a detailed consideration of the current transmission system and the changes needed to achieve a sustainable, world class energy sector that would enhance the quality of life for Nova Scotians. The report provides recommendations regarding how competition can be encouraged. The main drivers for electricity restructuring have been energy efficiency, risk-allocation, reliability, environmental impact, and consumer protection. The external influences on the Nova Scotia electricity market include: (1) economics of electricity restructuring, (2) the Federal Energy Regulatory Commission, (3) New Brunswick and electricity restructuring, and (4) Nova Scotia and the energy strategy. This report described the market scope and basic market model with reference to bilateral contract market, fully competitive wholesale pool market, and a single buyer market. The transmission issues discussed in this report included the importance of transmission, transmission tariff options, transmission services offered, design issues, and congestion management policies. The EMGC was directed to examine market design issues to accommodate an Open Access Transmission Tariff (OATT). As such, this report identifies some transmission issues that must be resolved to implement tariffs, and conditions of access to the transmission system and its impact on open access market design. The final report is expected to be available in March 2003
Directory of Open Access Journals (Sweden)
Albert Salehi
Full Text Available BACKGROUND: A distinctive feature of type 2 diabetes is inability of insulin-secreting beta-cells to properly respond to elevated glucose eventually leading to beta-cell failure. We have hypothesized that an abnormally increased NO production in the pancreatic islets might be an important factor in the pathogenesis of beta-cell dysfunction. PRINCIPAL FINDINGS: We show now that islets of type 2 spontaneous diabetes in GK rats display excessive NO generation associated with abnormal iNOS expression in insulin and glucagon cells, increased ncNOS activity, impaired glucose-stimulated insulin release, glucagon hypersecretion, and impaired glucose-induced glucagon suppression. Pharmacological blockade of islet NO production by the NOS inhibitor N(G-nitro-L-arginine methyl ester (L-NAME greatly improved hormone secretion from GK islets suggesting islet NOS activity being an important target to inactivate for amelioration of islet cell function. The incretin hormone GLP-1, which is used in clinical practice suppressed iNOS and ncNOS expression and activity with almost full restoration of insulin release and partial restoration of glucagon release. GLP-1 suppression of iNOS expression was reversed by PKA inhibition but unaffected by the proteasome inhibitor MG132. Injection of glucose plus GLP-1 in the diabetic rats showed that GLP-1 amplified the insulin response but induced a transient increase and then a poor depression of glucagon. CONCLUSION: The results suggest that abnormally increased NO production within islet cells is a significant player in the pathogenesis of type 2 diabetes being counteracted by GLP-1 through PKA-dependent, nonproteasomal mechanisms.
Role of thermonuclear instabilities of recent models of nova-stars
Energy Technology Data Exchange (ETDEWEB)
Secco, L [Padua Univ. (Italy). Ist. di Astronomia
1981-10-11
In this paper, a review models of nova-star explosion based on the original suggestion by Kraft and developed during about ten years (from 1967) is presented. The aim is to summarize the most salient results of those theoretical models and to point out the many aspects of the problems that are still unsettled. In particular, thermonuclear instabilities both in perfect and electron-degenerate gas are analyzed, since they seem to be at the base of the nova explosion phenomena.
Por uma 'nova pragmática emancipatória'
Ferreira,Dina Maria Martins; Alencar,Claudiana Nogueira de
2013-01-01
Neste artigo propomos o modus operandi de uma pragmática contra-hegemônica no que tange às teorias do mainstream, ou seja, as internalistas (auto-suficiência da língua como sistema) e as externalistas (aspecto social aliado à língua e não constitutivo da língua). Para tal, constroem-se dois percursos argumentativos para dar conta de uma nova Pragmática emancipatória: (1) nova, que mostra a incompatibilidade conceitual entre a teoria austiniana e a interpretada por seu discípulo Searle; (2) em...
A NOVA EVANGELIZAÇÃO NA EUROPA
Directory of Open Access Journals (Sweden)
Martin Maier
2013-01-01
Full Text Available Neste estudo, o olhar dirige-se em primeiro lugar para a situação religiosa da Europa. Em seguida, resumiremos o conceito da nova evangelização de acordo com os últimos papas. O passo seguinte será perguntar o que as igrejas podem oferecer à Europa. A nova evangelização deve acontecer no horizonte do ecumenismo e da globalização. Importante ponto de conexão para a transmissão da fé é a constante sede de espiritualidade e de experiência espiritual, bem como de conhecimento da religião e da fé. Por fim, desenvolveremos algumas chances que podem relacionar-se com a nova evangelização na Europa. ABSTRACT: In this study, the focus is directed first of ali to the religious situation in Europe. Then we will sum up the concept of the new evangelization according to the recent Popes. The next step will be to ask what the churches can offer to Europe. The new evangelization must happen on the horizon of ecumenism and globalization. An important point of connection to the transmission of the faith is the constant thirst for spirituality and spiritual experience as well as the knowledge of religion and faith. Finally, we will develop some opportunities that can relate to the new evangelization in Europe
CONCURRENT FORMATION OF CARBON AND SILICATE DUST IN NOVA V1280 SCO
Energy Technology Data Exchange (ETDEWEB)
Sakon, Itsuki; Onaka, Takashi; Usui, Fumihiko [Department of Astronomy, Graduate Schools of Science, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Sako, Shigeyuki; Takahashi, Hidenori; Ohsawa, Ryou [Institute of Astronomy, University of Tokyo, 2-21-1 Ohsawa, Mitaka, Tokyo 181-0015 (Japan); Nozawa, Takaya [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Kimura, Yuki [Institute of Low Temperature Science, Hokkaido University, Sapporo 060-0819 (Japan); Fujiyoshi, Takuya [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Shimonishi, Takashi [Frontier Research Institute for Interdisciplinary Sciences, Tohoku University, Aramaki aza Aoba 6-3, Aoba-ku, Sendai 980-8578 (Japan); Arai, Akira [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto, 603-8555 (Japan); Uemura, Makoto [Hiroshima Astrophysical Science Center, Hiroshima University, Kagamiyama 1-3-1, Higashi-Hiroshima 739-8526 (Japan); Nagayama, Takahiro [Department of Physics and Astronomy, Graduate School of Science and Engineering, Kagoshima University, 1-21-35 Korimoto, Kagoshima 890-0065 (Japan); Koo, Bon-Chul [Department of Physics and Astronomy, Seoul National University , 1 Gwanak-ro, Gwanak-gu, Seoul 151-742 (Korea, Republic of); Kozasa, Takashi, E-mail: isakon@astron.s.u-tokyo.ac.jp [Department of Cosmosciences, Graduate School of Science, Hokkaido University, Sapporo 060-0810 (Japan)
2016-02-01
We present infrared multi-epoch observations of the dust-forming nova V1280 Sco over ∼2000 days from the outburst. The temporal evolution of the infrared spectral energy distributions at 1272, 1616, and 1947 days can be explained by the emissions produced by amorphous carbon dust of mass (6.6–8.7) × 10{sup −8} M{sub ⊙} with a representative grain size of 0.01 μm and astronomical silicate dust of mass (3.4–4.3) × 10{sup −7} M{sub ⊙} with a representative grain size of 0.3–0.5 μm. Both of these dust species travel farther away from the white dwarf without apparent mass evolution throughout those later epochs. The dust formation scenario around V1280 Sco suggested from our analyses is that the amorphous carbon dust is formed in the nova ejecta followed by the formation of silicate dust either in the expanding nova ejecta or as a result of the interaction between the nova wind and the circumstellar medium.
Consultation paper : Nova Scotia's renewed energy strategy and climate change action plan
International Nuclear Information System (INIS)
2007-10-01
The Nova Scotia Department of Energy is seeking to create a sustainable and prosperous Nova Scotia that is responsive to climate change. The purpose of this report was to inform public discussion around two upcoming documents, namely the renewed energy strategy focusing on broad energy policy and a climate change action plan for Nova Scotia to reduce greenhouse gas emissions. The report discussed mitigation measures, as it is closely tied with energy use. The consultation process to inform the two documents was to include public forums and direct stakeholder consultation. The report discussed Nova Scotia's strategy for dealing with climate change and the world of energy. Recent changes in energy prices, exploration, awareness, and emerging but uncertain technologies were presented. Long term planning and a review of policy changes were also addressed. The report also presented options for a renewed energy strategy and discussed air quality; energy conservation and efficiency; electricity; natural gas; energy opportunities; government action; and government intervention. Submissions were also sought as input to the discussion paper. refs., tabs., figs., appendices
Perspective : component tracking on the Nova system
International Nuclear Information System (INIS)
MacDonald, S.
1999-01-01
The issue of introducing Component Tracking as a service to natural gas producers, shippers and straddle plant operators was discussed. Approximately 39 companies in the industry were contacted by consultants at Nova Gas Transmission in an effort to assess if introducing this service would add value to individual producers. The numerous implications that may have to be dealt with if Component Tracking is introduced were also described. Component Tracking would provide an equitable approach to the allocation of molecules in the gas stream, and could provide producers with the ability to avoid capital outlay in field plants by alternatively contracting for recovery of the liquids at the straddle plants. Component Tracking is to be voluntary and each shipper would be able to decide whether to utilize the service at each of their receipt points onto the Nova system
Methodological studies on the search for Gravitational Waves and Neutrinos from Type II Supernovae
International Nuclear Information System (INIS)
Casentini, Claudio
2016-01-01
Type II SNe, also called Core-collapse SuperNovae have a neutrino (v) emission, as confirmed by SN 1987A, and are also potential sources of gravitational waves. Neutrinos and gravitational waves from these sources reach Earth almost contemporaneously and without relevant interaction with stellar matter and interstellar medium. The upcoming advanced gravitational interferometers would be sensitive enough to detect gravitational waves signals from close galactic Core-collapse SuperNovae events. Nevertheless, significant uncertainties on theoretical models of emission remain. A joint search of coincident low energy neutrinos and gravitational waves events from these sources would bring valuable information from the inner core of the collapsing star and would enhance the detection of the so-called Silent SuperNovae. Recently a project for a joint search involving gravitational wave interferometers and neutrino detectors has started. We discuss the benefits of a joint search and the status of the search project. (paper)
Data Driven Trigger Design and Analysis for the NOvA Experiment
Energy Technology Data Exchange (ETDEWEB)
Kurbanov, Serdar [Univ. of Virginia, Charlottesville, VA (United States)
2016-01-01
This thesis primarily describes analysis related to studying the Moon shadow with cosmic rays, an analysis using upward-going muons trigger data, and other work done as part of MSc thesis work conducted at Fermi National Laboratory. While at Fermilab I made hardware and software contributions to two experiments - NOvA and Mu2e. NOvA is a neutrino experiment with the primary goal of measuring parameters related to neutrino oscillation. This is a running experiment, so it's possible to provide analysis of real beam and cosmic data. Most of this work was related to the Data-Driven Trigger (DDT) system of NOvA. The results of the Upward-Going muon analysis was presented at ICHEP in August 2016. The analysis demonstrates the proof of principle for a low-mass dark matter search. Mu2e is an experiment currently being built at Fermilab. Its primary goal is to detect the hypothetical neutrinoless conversion from a muon into an electron. I contributed to the production and tests of Cathode Strip Chambers (CSCs) which are required for testing the Cosmic Ray Veto (CRV) system for the experiment. This contribution is described in the last chapter along with a short description of the technical work provided for the DDT system of the NOvA experiment. All of the work described in this thesis will be extended by the next generation of UVA graduate students and postdocs as new data is collected by the experiment. I hope my eorts of have helped lay the foundation for many years of beautiful results from Mu2e and NOvA.
Expanding Pharmacists' Scope of Practice to Include Immunization in Nova Scotia
Directory of Open Access Journals (Sweden)
Beth O'Reilly
2017-07-01
Full Text Available On 10 December 2010 An Act to Amend Chapter 36 of the Acts of 2001, the Pharmacy Act (Bill 7 received Royal Assent in Nova Scotia, including an amendment that enabled an expanded scope of pharmacy practice. Expanding pharmacists' scope of practice came about from recommendations by various federal and provincial government bodies as an attempt to improve accessibility to health care and decrease costs. In 2013, pharmacists in Nova Scotia began administering the influenza vaccine as part of the publicly funded program in attempts to improve vaccine coverage rates. Preliminary evaluation in Nova Scotia has shown an increase in influenza vaccination coverage. Although pharmacist administration of influenza vaccination may improve vaccination coverage and reduce demand on physician time, there may be tension created among the professions, which needs to be addressed and managed.
Energy Technology Data Exchange (ETDEWEB)
Flumerfelt, Eric Lewis [Univ. of Tennessee, Knoxville, TN (United States)
2015-08-01
The NOvA (NuMI Off-axis ve [nu_e] Appearance) Experiment is a long-baseline accelerator neutrino experiment currently in its second year of operations. NOvA uses the Neutrinos from the Main Injector (NuMI) beam at Fermilab, and there are two main off-axis detectors: a Near Detector at Fermilab and a Far Detector 810 km away at Ash River, MN. The work reported herein is in support of the NOvA Experiment, through contributions to the development of data acquisition software, providing an accurate, absolute-scale energy calibration for electromagnetic showers in NOvA detector elements, crucial to the primary electron neutrino search, and through an initial evaluation of the cosmic background rate in the NOvA Far Detector, which is situated on the surface without significant overburden. Additional support work for the NOvA Experiment is also detailed, including DAQ Server Administration duties and a study of NOvA’s sensitivity to neutrino oscillations into a “sterile” state.
Nova Scotia Energy Strategy : progress report
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-02-01
Nova Scotia's energy strategy addresses all aspects of energy production and use, from offshore oil and gas to electricity and coal, to climate change and renewable resources. It also encompasses energy conservation and efficiency. This progress report highlights the efforts that the province has made to promote exploration, improve efficiency of regulations and approval processes and promote the oil and natural gas sector. Efforts have also been made to support local businesses, address climate change issues and protect the environment. The strategy demonstrates how new energy resources can be used to build a more prosperous and self-reliant province. The progress report focuses on the following 3 themes: powering the economy; improving the environment; and, securing Nova Scotia's future. The report emphasizes that the growing oil and gas industry brings many opportunities for new jobs and a stronger economy. In the next 12 to 18 months, about 8 to 10 offshore exploration wells will be drilled, which is more than in the last decade. Funding will be provided to extend pipeline systems beyond franchise areas approved by the Nova Scotia Utility and Review Board. In May 2002, the Electricity Marketplace Governance Committee was formed to make recommendations on how competition can be introduced into the province's electricity market. The Department of Energy has been working to implement initiatives to increase the use of renewable energy sources such as solar and wind power. In October 2002, new wind turbines began producing electricity in 3 communities on Cape Breton Island. A key priority is to respond to climate change and reduce greenhouse gas emissions as well as emissions of mercury, sulphur, nitrogen, and ozone. The energy strategy also identifies the need to provide competitive taxation regimes.
Strategies of design, development and activation of the Nova control system
International Nuclear Information System (INIS)
Holloway, F.W.
1983-01-01
Nova and Novette are large complex experimental laser facilities which require extensive and sophisticated control systems for their successful operation. Often, in major controls projects, certain invisible aspects of the project, such as overall strategy, management, resources and historical constraints, have a more profound effect upon success than any specific hardware/software design. The design and performance of the Nova/Novette laser control system will be presented with special emphasis upon these often controversial aspects
Strategies of design, development and activation of the Nova control system
Energy Technology Data Exchange (ETDEWEB)
Holloway, F.W.
1983-06-30
Nova and Novette are large complex experimental laser facilities which require extensive and sophisticated control systems for their successful operation. Often, in major controls projects, certain invisible aspects of the project, such as overall strategy, management, resources and historical constraints, have a more profound effect upon success than any specific hardware/software design. The design and performance of the Nova/Novette laser control system will be presented with special emphasis upon these often controversial aspects.
Mayer, A. S.; Vye, E.
2016-12-01
The Michigan Tech GlobalWatershed GK-12 Fellowship program bridges the gap between K-12 learning institutions and the scientific community with a focus on watershed research. Michigan Tech graduate students (fellows) work in tandem with teachers on the development of relevant hands-on, inquiry based lesson plans and activities based on their doctoral research projects in watershed science. By connecting students and teachers to state of the art academic research in watershed science, teachers are afforded a meaningful way in which to embed scientific research as a component of K-12 curricula, while mentoring fellows on the most pertinent and essential topics for lesson plan development. Fellows fulfill their vital responsibility of communicating their academic research to a broader public while fostering improved teaching and communication skills. A goal of the project is to increase science literacy among students so they may understand, communicate and participate in decisions made at local, regional, and global levels. The project largely works with schools located in Michigan's western Upper Peninsula but also partners with K-12 systems in Sonora, Mexico. While focusing on local and regional issues, the international element of the project helps expand student, teacher, and fellow worldviews and global awareness of watershed issues and creates meaningful partnerships. Lesson plans are available online and teacher workshops are held regularly to disseminate the wealth of information and resources available to the broader public. Evaluation results indicate that fellows' skill and confidence in their ability to communicate science increased as a results of their participation of the program, as well as their desire to communicate science in their future careers. Teachers' confidence in their capacity to present watershed science to their students increased, along with their understanding of how scientific research contributes to understanding of water
The Convolutional Visual Network for Identification and Reconstruction of NOvA Events
Energy Technology Data Exchange (ETDEWEB)
Psihas, Fernanda [Indiana U.
2017-11-22
In 2016 the NOvA experiment released results for the observation of oscillations in the vμ and ve channels as well as ve cross section measurements using neutrinos from Fermilab’s NuMI beam. These and other measurements in progress rely on the accurate identification and reconstruction of the neutrino flavor and energy recorded by our detectors. This presentation describes the first application of convolutional neural network technology for event identification and reconstruction in particle detectors like NOvA. The Convolutional Visual Network (CVN) Algorithm was developed for identification, categorization, and reconstruction of NOvA events. It increased the selection efficiency of the ve appearance signal by 40% and studies show potential impact to the vμ disappearance analysis.
SAITO, Mikako; KANEDA, Asako; SUGIYAMA, Tae; IIDA, Ryousuke; OTOKUNI, Keiko; KABURAGI, Misako; MATSUOKA, Hideaki
2015-01-01
Exon II of glucokinase (Gk) was deleted to produce a systemic heterozygous Gk knockout (Gk+/−) mouse. The relative expression levels of Gk in the heart, lung, liver, stomach, and pancreas in Gk+/− mice ranged from 0.41–0.68 versus that in wild (Gk+/+) mice. On the other hand, its expression levels in the brain, adipose tissue, and muscle ranged from 0.95–1.03, and its expression levels in the spleen and kidney were nearly zero. Gk knockout caused no remarkable off-target effect on the expression of 7 diabetes causing genes (Shp, Hnf1a, Hnf1b, Irs1, Irs2, Kir6.2, and Pdx1) in 10 organs. The glucose tolerance test was conducted to determine the blood glucose concentrations just after fasting for 24 h (FBG) and at 2 h after high-glucose application (GTT2h). The FBG-GTT2h plots obtained with the wild strain fed the control diet (CD), Gk+/− strain fed the CD, and Gk+/− strain fed the HFD were distributed in separate areas in the FBG-GTT2h diagram. The respective areas could be defined as the normal state, prediabetes state, and diabetes state, respectively. Based on the results, the criteria for prediabetes could be defined for the Gk+/− strain developed in this study. PMID:25765873
Event Reconstruction in the NOvA Experiment
Energy Technology Data Exchange (ETDEWEB)
Behera, Biswaranjan [Indian Inst. Tech., Hyderabad; Davies, Gavin [Indiana U.; Psihas, Fernanda [Indiana U.
2017-10-10
The NOvA experiment observes oscillations in two channels (electron-neutrino appearance and muon-neutrino disappearance) using a predominantly muon-neutrino NuMI beam. The Near Detector records multiple overlapping neutrino interactions in each event and the Far Detector has a large background of cosmic rays due to being located on the surface. The oscillation analyses rely on the accurate reconstruction of neutrino interactions in order to precisely measure the neutrino energy and identify the neutrino flavor and interaction mode. Similarly, measurements of neutrino cross sections using the Near Detector require accurate identification of the particle content of each interaction. A series of pattern recognition techniques have been developed to split event records into individual spatially and temporally separated interactions, to estimate the interaction vertex, and to isolate and classify individual particles within the event. This combination of methods to achieve full event reconstruction in the NOvA detectors has discussed.
White dwarf heating and the ultraviolet flux in dwarf novae
International Nuclear Information System (INIS)
Pringle, J.E.
1988-01-01
An investigation is made of the heating of the outer layers of the white dwarf which is likely to occur during a dwarf nova outburst. It is shown that the decline in IUE flux, observed during quiescent intervals in the dwarf novae VW Hydri and WX Hydri, may be due to the outer layers cooling off once the heat source is removed. The calculations here assume uniformity of the heat source over the white dwarf surface. This is unlikely to be realized from disc accretion, and we discuss that further calculations are required. (author)
Further X-ray observations of Nova Del 2013 with Swift
Nelson, T.; Mukai, K.; Chomiuk, L.; Sokoloski, J.; Weston, J.; Zheng, Y.; Rupen, M.; Mioduszewski, A.; Linford, J.; Finzell, T.
2013-08-01
We observed Nova Del 2013 (see CBET #3628) with the Swift satellite on 2013-08-18, four days after discovery (see also ATEL #5283). The exposures were carried out between 0.0 and 15.7 UT, and are therefore coincident with the first appearance of gamma-ray emission from this nova as seen with the Fermi-LAT (ATEL #5302). The XRT instrument was operated in Window Timing (WT) in order to mitigate the impact of optical loading on the CCD, and the total exposure time was 4522s.
Nova target diagnostics control system
International Nuclear Information System (INIS)
Severyn, J.R.
1985-01-01
During the past year the Nova target diagnostics control system was finished and put in service. The diagnostics loft constructed to the north of the target room provides the environmental conditions required to collect reliable target diagnostic data. These improvements include equipment cooling and isolation of the power source with strict control of instrumentation grounds to eliminate data corruption due to electromagnetic pulses from the laser power-conditioning system or from target implosion effects
2015-01-01
Tallinna Ülikooli Balti Filmi- ja Meediakooli õppehoone "Nova" Narva maantee 27, valminud 2012. Arhitektuuri sihtkapitali arhitektuuripreemia 2012 ja Arhitektuuri sihtkapitali sisearhitektuuripreemia 2013. Arhitektid Maarja Kask, Karli Luik, Ralf Lõoke, Pelle-Sten Viiburg (Salto Arhitektid). Sisearhitektid Ville Lausmäe, Kadi Karmann (VLS). Mööbel Ville Lausmäe, Tõnis Kalve. Konstruktor Jaanus Natka (EA Reng)
Modal testing and analysis of NOVA laser structures
International Nuclear Information System (INIS)
Burdick, R.B.; Weaver, H.J.; Pastrnak, J.W.
1984-09-01
NOVA, currently the world's most powerful laser system, is an ongoing project at the Lawrence Livermore National Laboratory in California. The project seeks to develop a feasible method of achieving controlled fusion reaction, initiated by multiple laser beams targeted on a tiny fuel pellet. The NOVA system consists of several large steel framed structures, the largest of which is the Target Chamber Tower. In conjunction with design engineers, the tower was first modelled and analyzed by sophisticated finite element techniques. A modal test was then conducted on the tower structure to evaluate its vibrational characteristics and seismic integrity as well as for general comparison to the finite element results. This paper will discuss the procedure used in the experimental modal analysis and the results obtained from that test
Madsen, J.; Skalak, K.; Watson, G.; Scantlebury, K.; Allen, D.; Quillen, A.
2006-12-01
With funding from the National Science Foundation, the University of Delaware (UD) in partnership with the New Castle County Vocational Technical School District (NCCoVoTech) in Delaware has initiated a GK-12 Program. In each of year this program, nine full time UD graduate students in the sciences, who have completed all or most of their coursework, will be selected to serve as fellows. Participation in the GK-12 program benefits the graduate fellows in many ways. In addition to gaining general insight into current issues of science education, the fellows enhance their experience as scientific researchers by directly improving their ability to effectively communicate complex quantitative and technical knowledge to an audience with multiple and diverse learning needs. In the first year of this project, fellows have been paired with high school science teachers from NCCoVoTech. These pairs, along with the principal investigators (PIs) of this program have formed a learning community that is taking this opportunity to examine and to reflect on current issues in science education while specifically addressing critical needs in teaching science in vocational technical high schools. By participating in summer workshops and follow-up meetings facilitated by the PIs, the fellows have been introduced to a number of innovative teaching strategies including problem-based learning (PBL). Fellow/teacher pairs have begun to develop and teach PBL activities that are in agreement with State of Delaware science standards and that support student learning through inquiry. Fellows also have the opportunity to engage in coteaching with their teacher partner. In this "teaching at the elbow of another", fellows will gain a better understanding of and appreciation for the complexities and nuances of teaching science in vocational technical high schools. While not taught as a stand-alone course in NCCoVoTech high schools, earth science topics are integrated into the science curriculum at
A theoretical study of problems in classical nova evolution
International Nuclear Information System (INIS)
Shankar, A.
1990-01-01
Three distinct issues in classical nova evolution are addressed with the aid of one- and two-dimensional numerical hydrodynamics. The effects of convection on nova outbursts are examined within the confines of the mixing length theory. It is found that increasing the efficiency of convection enhances the violence of the thermonuclear runaway (TNR). This also relates to the question of the feasibility of obtaining nova outbursts on magnetic white dwarfs among the AM Her systems. The effects of a strong magnetic field on the TNR are explored. The field interferes with the development of convection during the TNR, which results in lower ejection velocities. However, for field strengths typical of cataclysmic variables, the violence of strong outbursts is affected only moderately. The conditions necessary for the production of strong TNR's in the hibernation model of cataclysmic binary evolution are also examined. The feasibility of obtaining strong nova outbursts is investigated when the accretion rate during hibernation is decreased. It is found that a reduction (by a factor of 100) for periods of longer than a couple thousand years, is sufficient to ensure violent outbursts, even in the presence of large pre-outburst accretion rates. The effects of a common envelope phase (CEP) on the outburst are discussed. The motion of the secondary through an expanding common envelope is resisted by frictional drag. This dissipates both energy and angular momentum from the orbit inducing hydrodynamic motion. Significant departures are found to occur in the manner in which mass is lost when the effects of drag are taken into account. Specifically, a CEP is found to accelerate and enhance mass loss. Ejection is found to be concentrated in the orbital plane, with velocities of a few thousand km/sec
Message Correlation Analysis Tool for NOvA
International Nuclear Information System (INIS)
Lu Qiming; Biery, Kurt A; Kowalkowski, James B
2012-01-01
A complex running system, such as the NOvA online data acquisition, consists of a large number of distributed but closely interacting components. This paper describes a generic real-time correlation analysis and event identification engine, named Message Analyzer. Its purpose is to capture run time abnormalities and recognize system failures based on log messages from participating components. The initial design of analysis engine is driven by the data acquisition (DAQ) of the NOvA experiment. The Message Analyzer performs filtering and pattern recognition on the log messages and reacts to system failures identified by associated triggering rules. The tool helps the system maintain a healthy running state and to minimize data corruption. This paper also describes a domain specific language that allows the recognition patterns and correlation rules to be specified in a clear and flexible way. In addition, the engine provides a plugin mechanism for users to implement specialized patterns or rules in generic languages such as C++.
Message Correlation Analysis Tool for NOvA
CERN. Geneva
2012-01-01
A complex running system, such as the NOvA online data acquisition, consists of a large number of distributed but closely interacting components. This paper describes a generic realtime correlation analysis and event identification engine, named Message Analyzer. Its purpose is to capture run time abnormalities and recognize system failures based on log messages from participating components. The initial design of analysis engine is driven by the DAQ of the NOvA experiment. The Message Analyzer performs filtering and pattern recognition on the log messages and reacts to system failures identified by associated triggering rules. The tool helps the system maintain a healthy running state and to minimize data corruption. This paper also describes a domain specific language that allows the recognition patterns and correlation rules to be specified in a clear and flexible way. In addition, the engine provides a plugin mechanism for users to implement specialized patterns or rules in generic languages such as C++.
Message correlation analysis tool for NOvA
Energy Technology Data Exchange (ETDEWEB)
Lu, Qiming [Fermilab; Biery, Kurt A. [Fermilab; Kowalkowski, James B. [Fermilab
2012-01-01
A complex running system, such as the NOvA online data acquisition, consists of a large number of distributed but closely interacting components. This paper describes a generic real-time correlation analysis and event identification engine, named Message Analyzer. Its purpose is to capture run time abnormalities and recognize system failures based on log messages from participating components. The initial design of analysis engine is driven by the data acquisition (DAQ) of the NOvA experiment. The Message Analyzer performs filtering and pattern recognition on the log messages and reacts to system failures identified by associated triggering rules. The tool helps the system maintain a healthy running state and to minimize data corruption. This paper also describes a domain specific language that allows the recognition patterns and correlation rules to be specified in a clear and flexible way. In addition, the engine provides a plugin mechanism for users to implement specialized patterns or rules in generic languages such as C++.
Superoutburst of a New Sub-Period-Minimum Dwarf Nova CSS130418 in Hercules
Directory of Open Access Journals (Sweden)
D. Chochol
2015-02-01
Full Text Available Multicolour photometry of a new dwarf nova CSS130418 in Hercules, which underwent superoutburst on April 18, 2013, allow to classified it as a WZ Sge-type dwarf nova. The phase light curves for different stages of superoutburst are presented. The early superhumps were used to determine the orbital period Porb = 64.84(1 minutes, which is shorter than the period minimum ~78 minutes for normal hydrogen-rich cataclysmic variables. We found the mean period of ordinary superhumps Psh = 65.559(1 minutes. The quiescent spectrum is rich in helium, showing double peaked emissionlines of H I and He I from accretion disk, so the dwarf nova is in a late stage of stellar evolution.
V2676 Oph: Estimating Physical Parameters of a Moderately Fast Nova
Raj, A.; Pavana, M.; Kamath, U. S.; Anupama, G. C.; Walter, F. M.
2018-03-01
Using our previously reported observations, we derive some physical parameters of the moderately fast nova V2676 Oph 2012 #1. The best-fit Cloudy model of the nebular spectrum obtained on 2015 May 8 shows a hot white dwarf source with TBB≍1.0×105 K having a luminosity of 1.0×1038 erg/s. Our abundance analysis shows that the ejecta are significantly enhanced relative to solar, He/H=2.14, O/H=2.37, S/H=6.62 and Ar/H=3.25. The ejecta mass is estimated to be 1.42×10-5 M⊙. The nova showed a pronounced dust formation phase after 90 d from discovery. The J-H and H-K colors were very large as compared to other molecule- and dust-forming novae in recent years. The dust temperature and mass at two epochs have been estimated from spectral energy distribution fits to infrared photometry.
THE EXPANDING BIPOLAR SHELL OF THE HELIUM NOVA V445 PUPPIS
International Nuclear Information System (INIS)
Woudt, P. A.; Warner, B.; Steeghs, D.; Marsh, T. R.; Karovska, M.; Roelofs, G. H. A.; Groot, P. J.; Nelemans, G.; Nagayama, T.; Smits, D. P.; O'Brien, T.
2009-01-01
From multi-epoch adaptive optics imaging and integral field unit spectroscopy, we report the discovery of an expanding and narrowly confined bipolar shell surrounding the helium nova V445 Puppis (Nova Puppis 2000). An equatorial dust disc obscures the nova remnant, and the outflow is characterized by a large polar outflow velocity of 6720 ± 650 km s -1 and knots moving at even larger velocities of 8450 ± 570 km s -1 . We derive an expansion parallax distance of 8.2 ± 0.5 kpc and deduce a pre-outburst luminosity of the underlying binary of log L/L sun = 4.34 ± 0.36. The derived luminosity suggests that V445 Puppis probably contains a massive white dwarf accreting at high rate from a helium star companion making it part of a population of binary stars that potentially lead to supernova Ia explosions due to accumulation of helium-rich material on the surface of a massive white dwarf.
The Expanding Bipolar Shell of the Helium Nova V445 Puppis
Woudt, P. A.; Steeghs, D.; Karovska, M.; Warner, B.; Groot, P. J.; Nelemans, G.; Roelofs, G. H. A.; Marsh, T. R.; Nagayama, T.; Smits, D. P.; O'Brien, T.
2009-11-01
From multi-epoch adaptive optics imaging and integral field unit spectroscopy, we report the discovery of an expanding and narrowly confined bipolar shell surrounding the helium nova V445 Puppis (Nova Puppis 2000). An equatorial dust disc obscures the nova remnant, and the outflow is characterized by a large polar outflow velocity of 6720 ± 650 km s-1 and knots moving at even larger velocities of 8450 ± 570 km s-1. We derive an expansion parallax distance of 8.2 ± 0.5 kpc and deduce a pre-outburst luminosity of the underlying binary of log L/L sun = 4.34 ± 0.36. The derived luminosity suggests that V445 Puppis probably contains a massive white dwarf accreting at high rate from a helium star companion making it part of a population of binary stars that potentially lead to supernova Ia explosions due to accumulation of helium-rich material on the surface of a massive white dwarf.
Breaking the Habit: The Peculiar 2016 Eruption of the Unique Recurrent Nova M31N 2008-12a
Henze, M.; Darnley, M. J.; Williams, S. C.; Kato, M.; Hachisu, I.; Anupama, G. C.; Arai, A.; Boyd, D.; Burke, D.; Ciardullo, R.; Chinetti, K.; Cook, L. M.; Cook, M. J.; Erdman, P.; Gao, X.; Harris, B.; Hartmann, D. H.; Hornoch, K.; Horst, J. Chuck; Hounsell, R.; Husar, D.; Itagaki, K.; Kabashima, F.; Kafka, S.; Kaur, A.; Kiyota, S.; Kojiguchi, N.; Kučáková, H.; Kuramoto, K.; Maehara, H.; Mantero, A.; Masci, F. J.; Matsumoto, K.; Naito, H.; Ness, J.-U.; Nishiyama, K.; Oksanen, A.; Osborne, J. P.; Page, K. L.; Paunzen, E.; Pavana, M.; Pickard, R.; Prieto-Arranz, J.; Rodríguez-Gil, P.; Sala, G.; Sano, Y.; Shafter, A. W.; Sugiura, Y.; Tan, H.; Tordai, T.; Vraštil, J.; Wagner, R. M.; Watanabe, F.; Williams, B. F.; Bode, M. F.; Bruno, A.; Buchheim, B.; Crawford, T.; Goff, B.; Hernanz, M.; Igarashi, A. S.; José, J.; Motta, M.; O’Brien, T. J.; Oswalt, T.; Poyner, G.; Ribeiro, V. A. R. M.; Sabo, R.; Shara, M. M.; Shears, J.; Starkey, D.; Starrfield, S.; Woodward, C. E.
2018-04-01
Since its discovery in 2008, the Andromeda galaxy nova M31N 2008-12a has been observed in eruption every single year. This unprecedented frequency indicates an extreme object, with a massive white dwarf and a high accretion rate, which is the most promising candidate for the single-degenerate progenitor of a Type Ia supernova known to date. The previous three eruptions of M31N 2008-12a have displayed remarkably homogeneous multiwavelength properties: (i) from a faint peak, the optical light curve declined rapidly by two magnitudes in less than two days, (ii) early spectra showed initial high velocities that slowed down significantly within days and displayed clear He/N lines throughout, and (iii) the supersoft X-ray source (SSS) phase of the nova began extremely early, six days after eruption, and only lasted for about two weeks. In contrast, the peculiar 2016 eruption was clearly different. Here we report (i) the considerable delay in the 2016 eruption date, (ii) the significantly shorter SSS phase, and (iii) the brighter optical peak magnitude (with a hitherto unobserved cusp shape). Early theoretical models suggest that these three different effects can be consistently understood as caused by a lower quiescence mass accretion rate. The corresponding higher ignition mass caused a brighter peak in the free–free emission model. The less massive accretion disk experienced greater disruption, consequently delaying the re-establishment of effective accretion. Without the early refueling, the SSS phase was shortened. Observing the next few eruptions will determine whether the properties of the 2016 outburst make it a genuine outlier in the evolution of M31N 2008-12a.
Deep Convolutional Networks for Event Reconstruction and Particle Tagging on NOvA and DUNE
CERN. Geneva
2017-01-01
Deep Convolutional Neural Networks (CNNs) have been widely applied in computer vision to solve complex problems in image recognition and analysis. In recent years many efforts have emerged to extend the use of this technology to HEP applications, including the Convolutional Visual Network (CVN), our implementation for identification of neutrino events. In this presentation I will describe the core concepts of CNNs, the details of our particular implementation in the Caffe framework and our application to identify NOvA events. NOvA is a long baseline neutrino experiment whose main goal is the measurement of neutrino oscillations. This relies on the accurate identification and reconstruction of the neutrino flavor in the interactions we observe. In 2016 the NOvA experiment released results for the observation of oscillations in the ν μ → ν e channel, the first HEP result employing CNNs. I will also discuss our approach at event identification on NOvA as well as recent developments in the application of CNN...
Munari, U.; Banerjee, D. P. K.
2018-03-01
Pre-outburst 2MASS and WISE photometry of Nova Sco 2014 (V1534 Sco) has suggested the presence of a cool giant at the location of the nova in the sky. The spectral evolution recorded for the nova did not, however, support a direct partnership because no flash-ionized wind and no deceleration of the ejecta were observed, contrary to the behaviour displayed by other novae which erupted within symbiotic binaries like V407 Cyg or RS Oph. We have therefore obtained 0.8-2.5 μm spectra of the remnant of Nova Sco 2014 in order to ascertain if a cool giant is indeed present and if it is physically associated with the nova. The spectrum shows the presence of a M6III giant, reddened by E(B - V) = 1.20, displaying the typical and narrow emission-line spectrum of a symbiotic star, including He I 1.0830 μm with a deep P-Cyg profile. This makes Nova Sco 2014 a new member of the exclusive club of novae that erupt within a symbiotic binary. Nova Sco 2014 shows that a nova erupting within a symbiotic binary does not always come with a deceleration of the ejecta, contrary to the common belief. Many other similar systems may lay hidden in past novae, especially in those that erupted prior to the release of the 2MASS all-sky infrared survey, which could be profitably cross-matched now against them.
Differences in strength and speed demands between 4v4 and 8v8 small-sided football games
DEFF Research Database (Denmark)
Rebelo, António Natal Campos; Silva, Pedro; Rago, Vincenzo
2016-01-01
The aims of this study were (i) to characterise the acceleration demands of two different formats of small-sided game (SSG), i.e., 4v4 + goalkeepers (4v4 + GK) and 8v8 + goalkeepers (8v8 + GK); (ii) to analyse the correlation between performance in power-based tests and acceleration-based physica...... to repetitions and fatigue development of muscle power-based actions than 8v8 + GK. It may therefore be logical to use the former type of SSG to target development of power-related football actions....
Optical components for the Nova laser
International Nuclear Information System (INIS)
Wallerstein, E.P.; Baker, P.C.; Brown, N.J.
1982-01-01
In addition to its other characteristics, the Nova Laser Fusion facility may well be the largest precision optical project ever undertaken. Moreover, during the course of construction, concurrent research and development has been successfully conducted, and has resulted in significant advances in various technical areas, including manufacturing efficiency. Although assembly of the first two beams of Nova is just commencing, the optical production, including construction of the special facilities required for many of the components, has been underway for over three years, and many phases of the optical manufacturing program for the first 10 beams will be completed within the next two years. On the other hand, new requirements for second and third harmonic generation have created the need to initiate new research and development. This work has been accomplished through the enormous cooperation DOE/LLNL has received from commercial industry on this project. In many cases, industry, where much of the optical component research and development and virtually all of the manufacturing is being done, has made substantial investment of its own funds in facilities, equipment, and research and development, in addition to those supplied by DOE/LLNL
The Nova-Canton Trough and the Late Cretaceous evolution of the central Pacific
Joseph, Devorah; Taylor, Brain; Shor, Alexander N.; Yamazaki, Toshitsugu
Free-air gravity anomalies derived from satellite altimetry data show that the major Pacific fracture zones, from the Pau to Marquesas, are co-polar about an Euler pole located at 150.5°W, 34.6°S for the period preceding chron 33 and including a large portion of the Cretaceous Normal Superchron. They also show continuity of the Clipperton Fracture Zone through the Line Islands to the Nova-Canton ridge and trough; this Canton-Clipperton trend is co-polar to the same pole. Sidescan-sonar and bathymetry data in the Nova-Canton Trough region reveal N140°E-striking abyssal hill topography south of the N70°E-striking structures of the Nova-Canton Trough and crustal fabric striking normal to the trough (N160°E) to the north. We conclude that the Nova-Canton Trough is the Middle Cretaceous extension of the Clipperton Fracture Zone. We propose that the anomalous depths (7000-8400 m) of the trough between 167°30'-168°30'W are the result of a complex plate reorganization. Conjugate magnetic anomaly lineations M1-M3 in the Phoenix lineations between the Central Pacific Fracture Zone and the Phoenix Fracture Zone and the absence of lineations younger than anomaly M3 west of the Phoenix Fracture Zone suggest that spreading may have gradually ceased along the Pacific-Phoenix system from west to east. We infer that the remaining active segment of the Pacific-Phoenix spreading system after anomaly M1 time was the easternmost section of the Phoenix lineations. At ˜M0 time, the Pacific-Phoenix spreading axis stretched from lineated bathymetric depressions lying between 180°W and the Phoenix Islands to ˜168°W and included the western deep of the Nova-Canton Trough. We hypothesize that accretion terminated on the Pacific-Phoenix spreading axis shortly after M0 time and that the absence of an M0 isochron in the region between the eastern Phoenix lineations and the Nova-Canton Trough, or along the Nova-Canton Trough itself, may be due to a decrease in spreading rate prior to
Three-dimensional simulations of Nova capsule implosion experiments
International Nuclear Information System (INIS)
Marinak, M.M.; Tipton, R.E.; Landen, O.L.
1995-01-01
Capsule implosion experiments carried out on the Nova laser are simulated with the three-dimensional HYDRA radiation hydrodynamics code. Simulations of ordered near single mode perturbations indicate that structures which evolve into round spikes can penetrate farthest into the hot spot. Bubble-shaped perturbations can burn through the capsule shell fastest, however, causing even more damage. Simulations of a capsule with multimode perturbations shows spike amplitudes evolving in good agreement with a saturation model during the deceleration phase. The presence of sizable low mode asymmetry, caused either by drive asymmetry or perturbations in the capsule shell, can dramatically affect the manner in which spikes approach the center of the hot spot. Three-dimensional coupling between the low mode shell perturbations intrinsic to Nova capsules and the drive asymmetry brings the simulated yields into closer agreement with the experimental values
International Nuclear Information System (INIS)
1997-12-01
Petro-Canada applied to the Canada-Newfoundland Offshore Petroleum Board (the Board) for approval of its plan for the development of the Terra Nova oil and gas field of the Jeanne d'Arc Formation located about 35 km southeast of the Hibernia oilfield. Petro-Canada also submitted a benefits plan. The Board established the Terra Nova Project Environmental Assessment Panel to conduct a public review of the application and to ensure that the potential effects of the project upon the natural environment would be minimal. The Panel recommended approval of the application, subject to 75 recommendations. The Board considered the recommendations of the Panel and approved the Benefits Plan and the Development Plan subject to certain conditions being met. This document provides the details of the application, the bases for the Board's decision, the conditions imposed, and the 75 recommendations made by the Environmental Assessment Panel. . 6 tabs., 6 figs
A PREDICTION FORMULA OF SUPERSOFT X-RAY PHASE OF CLASSICAL NOVAE
International Nuclear Information System (INIS)
Hachisu, Izumi; Kato, Mariko
2010-01-01
On the basis of the recently developed universal decline law of classical novae, we propose prediction formulae for supersoft X-ray on and off times, i.e., t X-on = (10 ± 1.8)t 3 days and t X-off = (5.3 ± 1.4)(t 3 ) 1.5 days for 8 ∼ 3 ∼ 3 is the newly proposed 'intrinsic' decay time during which the brightness drops by 3 mag from optical maximum along our universal decline law fitted with observation. We have determined the absolute magnitude of our free-free emission model light curves and derived maximum magnitude versus rate of decline (MMRD) relations. Our theoretical MMRD relations are governed by two parameters, one is the white dwarf (WD) mass and the other is the initial envelope mass at a nova outburst; this second parameter explains the scatter of MMRD points of individual novae. Our theoretical MMRD relations are also in good agreement with the well-known empirical formulae. We also show another empirical relation of M V (15) ∼ -5.7 ± 0.3 based on the absolute magnitude of our model light curves, i.e., the absolute magnitude at 15 days after optical maximum is almost common among various novae. We analyzed 10 nova light curves, in which a supersoft X-ray phase was detected, and estimated their WD masses. The models best simultaneously reproducing the optical and supersoft X-ray observations are ONeMg WDs with 1.28 ± 0.04 M sun (V598 Pup), 1.23 ± 0.05 M sun (V382 Vel), 1.15 ± 0.06 M sun (V4743 Sgr), 1.13 ± 0.06 M sun (V1281 Sco), 1.2 ± 0.05 M sun (V597 Pup), 1.06 ± 0.07 M sun (V1494 Aql), 1.04 ± 0.07 M sun (V2467 Cyg), 1.07 ± 0.07 M sun (V5116 Sgr), 1.05 ± 0.05 M sun (V574 Pup), and a CO WD with 0.93 ± 0.08 M sun (V458 Vul). The newly proposed relationships are consistent with the emergence or decay epoch of the supersoft X-ray phase of these 10 novae. Finally, we discuss the mechanism of shock-origin hard X-ray component in relation to the emergence of companion star from the WD envelope.
Directory of Open Access Journals (Sweden)
Luiz Fernando Coutinho de Oliveira
2007-09-01
Full Text Available
A importância de mapear as áreas suscetíveis à erosão hídrica nos municípios de Caldas Novas, Nova América e Rio Quente deve-se ao fato de que eles apresentaram os maiores índices de precipitação pluviométrica e pelo potencial que os mesmos representam para o estado de Goiás, principalmente o turístico. Na elaboração desses mapas, estabeleceram-se preliminarmente os planos de informação referentes às classes de solo, à declividade e ao uso do solo através de digitalização, empregando o software SGI/INPE, e a espacialização da intensidade de precipitação com duração de 30 minutos sobre a base cartográfica dos municípios, obtendo assim os mapas temáticos. Através do cruzamento dos mapas temáticos, foram classificadas e mapeadas as áreas suscetíveis à erosão hídrica. A metodologia empregada mostrou-se satisfatória, permitindo gerar os mapas temáticos das áreas suscetíveis à erosão hídrica nos municípios estudados que servirão de orientação para os trabalhos de campo.
PALAVRAS-CHAVE: Erosão; sistema de informação geográfica; conservação do solo.
The importance of mapping the erosion susceptible areas of Caldas Novas, Nova América and Rio Quente is that these municipalities present high rainfall rates and the potential they represent for the Goiás state, mostly for tourism. As a preliminary to elaborate these maps the soil type, slope and use of classes information were planned through digitalization using the SGI/INPE software, and a spatialization of the 30 minutes rainfall intensity over the municipalities cartographic base, obtaining the thematic maps. Through thematic maps crossing, the erosion susceptible areas were classified and mapped. The methodology used was considered satisfactory and generated the thematic
ORF Alignment: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEM 60 ... Query: 236 VGTMTE-KSLSRGERKRLAFACEILTDPPILFC...DEPTSGLDSFMSHQVIKALRQLTIEGK 294 ... +G ... K LS GERKRLAFA E LTDPP+L CDEPTSGLDSF +H V++ L++L+ +GK Sbjct: 121 IGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGK 180 ...
Gas distribution regulations (Nova Scotia)
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-03
A consolidation of Nova Scotia`s gas distribution regulations made under subsection 42(1) of the Gas Distribution Act S.N.S. 1997, c4 - O.I.C. 1998-576 (November 10, 1998), N.S. Reg. 86/98 are presented. The consolidation is issued for reference purposes only, and while it has no official sanction, it is considered useful in providing an interpretation of the regulation, explaining franchise evaluation, the granting of franchises, and exemptions from application requirements. 1 tab.
Tiago Oliveira Nicoloso
2006-01-01
O presente trabalho busca analisar a importância dos saberes tradicionais e do modo de vida camponês como elementos para a compreensão de uma nova forma de organização camponesa a partir do exemplo de Nova Pádua/RS. Para tanto, é fundamental buscar no processo de colonização italiana no Rio Grande do Sul e, conseqüentemente, na história de formação de Nova Pádua, os fatores que permitem compreender os vínculos culturais com a Itália manifestos ainda hoje de forma tão intensa. Da mesma forma, ...
NuMI Flux Predictions for NOvA and MINERvA
Aliaga Soplin, Leonidas; Nova Collaboration; Minerva Collaboration
2017-01-01
The determination of the neutrino flux in any conventional neutrino beam presents a challenge for the current and future short and long baseline neutrino experiments. The uncertainties associated with the production and attenuation of the hadrons in the beamline materials along with those associated with the beam optics have a big effect in the knowledge of the flux. For experiments like MINERvA and NOvA, understanding the flux is crucial since it enters directly into every neutrino-nucleus cross-section measurement. The majority of this work involves predicting the neutrino flux using dedicated hadron production measurements from hadron-nucleus collisions. The predictions at the MINERvA and NOvA near detectors are presented as well as the results of incorporating in-situ MINERvA data that can provide additional constraints. These results have been fully implemented in MINERvA and they are currently use for its cross-section analysis. The implementation for NoVA is underway. The procedure and conclusions of this work will have a big impact on future hadron production experiments and on determining the flux for the upcoming DUNE experiment.
Graizer, Vladimir;; Kalkan, Erol
2016-01-01
We present a revised ground‐motion prediction equation (GMPE) for computing medians and standard deviations of peak ground acceleration (PGA) and 5% damped pseudospectral acceleration (PSA) response ordinates of the horizontal component of randomly oriented ground motions to be used for seismic‐hazard analyses and engineering applications. This GMPE is derived from the expanded Next Generation Attenuation (NGA)‐West 1 database (see Data and Resources; Chiou et al., 2008). The revised model includes an anelastic attenuation term as a function of quality factor (Q0) to capture regional differences in far‐source (beyond 150 km) attenuation, and a new frequency‐dependent sedimentary‐basin scaling term as a function of depth to the 1.5 km/s shear‐wave velocity isosurface to improve ground‐motion predictions at sites located on deep sedimentary basins. The new Graizer–Kalkan 2015 (GK15) model, developed to be simple, is applicable for the western United States and other similar shallow crustal continental regions in active tectonic environments for earthquakes with moment magnitudes (M) 5.0–8.0, distances 0–250 km, average shear‐wave velocities in the upper 30 m (VS30) 200–1300 m/s, and spectral periods (T) 0.01–5 s. Our aleatory variability model captures interevent (between‐event) variability, which decreases with magnitude and increases with distance. The mixed‐effect residuals analysis reveals that the GK15 has no trend with respect to the independent predictor parameters. Compared to our 2007–2009 GMPE, the PGA values are very similar, whereas spectral ordinates predicted are larger at T<0.2 s and they are smaller at longer periods.
ULF fluctuations at Terra Nova Bay (Antarctica
Directory of Open Access Journals (Sweden)
A. Meloni
2000-06-01
Full Text Available ULF geomagnetic field measurements in Antarctica are a very important tool for better understanding the dynamics of the Earths magnetosphere and its response to the variable solar wind conditions. We review the results obtained in the last few years at the Italian observatory at Terra Nova Bay
Coalfields west half Cumberland County, Nova Scotia
Energy Technology Data Exchange (ETDEWEB)
Copeland, M J
1958-01-01
A geologic survey of the coal fields of the western half of Cumberland County, Nova Scotia was performed including studies of the structural geology, stratigraphy, and paleontology of the area. One part of this survey included a spectrographic analysis of 55 coals for 23 elements. These analyses are presented in tabular form.
King, Lionel Bradley
This dissertation investigates local attempts to use technology as a force for regional rehabilitation in the economically-depressed Maritime region of Canada. At the time of Confederation in 1867, the Maritime province of Nova Scotia was prosperous, progressive, and cultured. By the end of the 1910s, the province had entered a long period of economic and social decline. Recent historiography has shown that, far from passively accepting their fate, Nova Scotians and other Maritimers, actively resisted marginalization with political, cultural, or social action. The thesis expands upon that literature by exploring technology-based strategies of provincial rehabilitation using Thomas P. Hughes's systems perspective and David E. Nye's semiotic approach. In doing so, it applies methods from the social constructivist school of the history of technology to the larger concerns of Maritime Canadian historiography. In large part, the North American culture of technology determined the ways in which Nova Scotians applied technological solutions to provincial concerns. Technology has long been central to the Western idea of progress. As the "high technology" of the late nineteenth and early twentieth centuries, electricity reinforced that view: its ephemeral nature and silent efficiency led people to endow it with transformative, even mystical, powers. As a result, Nova Scotians, adopted a program of electrical modernization in the late 1910s as a remedy for regional disparity. The Nova Scotia government's first step was the creation of an Ontario-style hydroelectric commission designed to bring order to the province's fragmented and inefficient electrical network. Over the next few decades, the Nova Scotia Power Commission implemented rural electrification, home modernization, and regional system-building models that had already proven successful in Ontario and the United States. The system-building philosophies behind these programs were adapted to local conditions and
New sidescan sonar and gravity evidence that the Nova-Canton Trough is a fracture zone
Joseph, Devorah; Taylor, Brian; Shor, Alexander N.
1992-05-01
A 1990 sidescan sonar survey in the eastern region of the Nova-Canton Trough mapped 138°-striking abyssal-hill fabric trending into 70°-striking trough structures. The location and angle of intersection of the abyssal hills with the eastern Nova-Canton Trough effectively disprove a spreading-center origin of this feature. Free-air gravity anomalies derived from satellite altimetry data show continuity, across the Line Islands, of the Nova-Canton Trough with the Clipperton Fracture Zone. The Canton-Clipperton trend is copolar, about a pole at 30°S, 152°W, with other coeval Pacific-Farallon fracture-zone segments, from the Pau to Marquesas fracture zones. This copolarity leads us to postulate a Pacific-Farallon spreading pattern for the magnetic quiet zone region north and east of the Manihiki Plateau, with the Nova-Canton Trough originating as a transform fault in this system.
NEAR-IR STUDIES OF RECURRENT NOVA V745 SCORPII DURING ITS 2014 OUTBURST
International Nuclear Information System (INIS)
Banerjee, D. P. K.; Joshi, Vishal; Venkataraman, V.; Ashok, N. M.; Raj, A.; Marion, G. H.; Hsiao, E. Y.
2014-01-01
The recurrent nova V745 Scorpii underwent its third known outburst on 2014 February 6. Infrared monitoring of the eruption on an almost daily basis, starting from 1.3 days after discovery, shows the emergence of a powerful blast wave generated by the high velocity nova ejecta exceeding 4000 km s –1 plowing into its surrounding environment. The temperature of the shocked gas is raised to a high value exceeding 10 8 K immediately after outburst commencement. The energetics of the outburst clearly surpass those of similar symbiotic systems like RS Oph and V407 Cyg which have giant secondaries. The shock does not show a free-expansion stage but rather shows a decelerative Sedov-Taylor phase from the beginning. Such strong shock fronts are known to be sites for γ-ray generation. V745 Sco is the latest nova, apart from five other known novae, to show γ-ray emission. It may be an important testbed to resolve the crucial question of whether or not all novae are generically γ-ray emitters by virtue of having a circumbinary reservoir of material that is shocked by the ejecta rather than γ-ray generation being restricted to only symbiotic systems with a shocked red giant (RG) wind. The lack of a free-expansion stage favors V745 Sco to have a density enhancement around the white dwarf (WD), above that contributed by a RG wind. Our analysis also suggests that the WD in V745 Sco is very massive and a potential progenitor for a future SN Ia explosion
Muon Neutrino Disappearance in NOvA with a Deep Convolutional Neural Network Classifier
Energy Technology Data Exchange (ETDEWEB)
Rocco, Dominick Rosario [Minnesota U.
2016-03-01
The NuMI Off-axis Neutrino Appearance Experiment (NOvA) is designed to study neutrino oscillation in the NuMI (Neutrinos at the Main Injector) beam. NOvA observes neutrino oscillation using two detectors separated by a baseline of 810 km; a 14 kt Far Detector in Ash River, MN and a functionally identical 0.3 kt Near Detector at Fermilab. The experiment aims to provide new measurements of Δm2 and θ23 and has potential to determine the neutrino mass hierarchy as well as observe CP violation in the neutrino sector. Essential to these analyses is the classification of neutrino interaction events in NOvA detectors. Raw detector output from NOvA is interpretable as a pair of images which provide orthogonal views of particle interactions. A recent advance in the field of computer vision is the advent of convolutional neural networks, which have delivered top results in the latest image recognition contests. This work presents an approach novel to particle physics analysis in which a convolutional neural network is used for classification of particle interactions. The approach has been demonstrated to improve the signal efficiency and purity of the event selection, and thus physics sensitivity. Early NOvA data has been analyzed (2.74×1020 POT, 14 kt equivalent) to provide new best- fit measurements of sin2(θ23) = 0.43 (with a statistically-degenerate compliment near 0.60) and |Δm2 | = 2.48 × 10-3 eV2.
Report on terrestrial biology research and logistics at Baia Terra Nova Station
Directory of Open Access Journals (Sweden)
Satoshi Imura
1999-11-01
Full Text Available From December 4,1998 to January 15,1999,the author stayed at Baia Terra Nova Station (Italy in Antarctica, as an exchange scientist. To compare the biodiversity between Syowa Station and the Baia Terra Nova Station area, many samples of mosses, lichens, algae and micro animals in the soil were collected, and the structure of moss vegetation was studied in various fields around the station. Some characteristic features of logistics at the station were also researched.
Nova performance at ultra high fluence levels
International Nuclear Information System (INIS)
Hunt, J.T.
1986-01-01
Nova is a ten beam high power Nd:glass laser used for interial confinement fusion research. It was operated in the high power high energy regime following the completion of construction in December 1984. During this period several interesting nonlinear optical phenomena were observed. These phenomena are discussed in the text. 11 refs., 5 figs
Early X- and HE γ-ray emission from the symbiotic recurrent novae V745 Sco & RS Oph.
Delgado, L.; Hernanz, M.
2017-10-01
RS Oph was the first nova for which evidence of particle acceleration during its 2006 outburst was found. In recent years, several nova explosions - eight classical and two symbiotic recurrent novae - have been detected by Fermi/LAT at E>100 MeV. In most cases, this emission has been observed early after the explosion, around the optical maximum, and for a short period of time. The high-energy γ-ray emission is a consequence of π^{0} decay and/or Inverse Compton, which are related to particle (p and e^{-}) acceleration in the strong shock between the nova ejecta and the circumstellar matter. Our aim is to understand the acceleration process through the analysis of contemporaneous X-ray emission, and in particular, through the evolution of the shock wave. A deep analysis of early X-ray observations of the symbiotic recurrent novae V745 Sco (2014) by Swift/XRT, Chandra/HETG and NuStar, and RS Oph (2006) by XMM-Newton/EPIC and RGS, Swift/XRT and BAT and RXTE/PCA is presented taking into account the contemporaneous information from the IR and radio observations. This provides for the first time a global view of the early evolution of a nova remnant and its relationship with particle acceleration.
Test bench for measurements of NOvA scintillator properties at JINR
Velikanova, D. S.; Antoshkin, A. I.; Anfimov, N. V.; Samoylov, O. B.
2018-04-01
The NOvA experiment was built to study oscillation parameters, mass hierarchy, CP- violation phase in the lepton sector and θ23 octant, via vɛ appearance and vμ disappearance modes in both neutrino and antineutrino beams. These scientific goals require good knowledge about NOvA scintillator basic properties. The new test bench was constructed and upgraded at JINR. The main goal of this bench is to measure scintillator properties (for solid and liquid scintillators), namely α/β discrimination and Birk's coefficients for protons and other hadrons (quenching factors). This knowledge will be crucial for recovering the energy of the hadronic part of neutrino interactions with scintillator nuclei. α/β discrimination was performed on the first version of the bench for LAB-based and NOvA scintillators. It was performed again on the upgraded version of the bench with higher statistic and precision level. Preliminary result of quenching factors for protons was obtained. A technical description of both versions of the bench and current results of the measurements and analysis are presented in this work.
Thermal stress in the edge cladding of Nova glass laser disks
International Nuclear Information System (INIS)
Pitts, J.H.; Kong, M.K.; Gerhard, M.A.
1987-01-01
We calculated thermal stresses in Nova glass laser disks having light-absorbing edge cladding glass attached to the periphery with an epoxy adhesive. Our closed-form solutions indicated that, because the epoxy adhesive is only 25 μm across, it does not significantly affect the thermal stress in the disk or cladding glass. Our numerical results showed a peak tensile stress in the cladding glass of 24 MPa when the cladding glass had a uniform absorption coefficient of 7.5 cm -1 . This peak value is reduced to 19 MPa if surface parasitic oscillation heating is eliminated by tilting the disk edges. The peak tensile stresses exceed the typical 7 to 14-MPa working stress for glass; however, we have not observed any disk or cladding glass failures at peak Nova fluences of 20 J/cm 2 . We have observed delamination of the epoxy adhesive bond at fluences several times that which would occur on Nova. Replacement laser disks will incorporate cladding with a reduced absorption coefficient of 4.5 cm -1 . Recent experiments show that this reduced absorption coefficient is satisfactory
International Nuclear Information System (INIS)
Suski, G.J.; Holloway, F.W.; Duffy, J.M.
1983-01-01
This paper explores the impact of an HOL on the development of the distributed computer control system for Nova laser fusion facility. As the world's most powerful glass laser, Nova will generate 150 trillion watt pulses of infrared light focused onto fusion targets a few millimeters in diameter. It will perform experiments designed to explore the feasibility of fusion as an energy source of the future. Nova will utilize fifty microcomputers and four VAX-11/780's in a distributed process control computer system architecture
MASTER-ICATE constraints on the outburst time of OGLE-2012-NOVA-002
Levato, H.; Saffe, C.; Mallamaci, C.; Lopez, C.; Denisenko, F. Podest D.; Gorbovskoy, E.; Lipunov, V.; Balanutsa, P.; Tiurina, N.; Kornilov, V.; Belinski, A.; Shatskiy, N.; Chazov, V.; Kuznetsov, A.; Zimnukhov, D.; Krushinsky, V.; Zalozhnih, I.; Popov, A.; Bourdanov, A.; Punanova, A.; Ivanov, K.; Yazev, S.; Budnev, N.; Konstantinov, E.; Chuvalaev, O.; Poleshchuk, V.; Gress, O.; Parkhomenko, A.; Tlatov, A.; Dormidontov, D.; Senik, V.; Yurkov, V.; Sergienko, Y.; Varda, D.; Sinyakov, E.; Shumkov, V.; Shurpakov, S.; Podvorotny, P.
2012-10-01
MASTER-ICATE very wide field camera (72-mm f/1.2 lens + 11 Mpx CCD) located at Observatorio Astronomico Felix Aguilar (OAFA) near San Juan, Argentina, has observed the position of possible Nova OGLE-2012-NOVA-002 reported by L. Wyrzykowski et al. (ATel #4483) several times before 2012 May 20 and then again after 2012 July 03. MASTER-WFC is continuously imaging the areas of sky (24x16 sq. deg. field of view) with 5-sec unfiltered exposures.
Study of an instability of the PEP-II positron beam (Ohmi effect and Multipactoring)
Energy Technology Data Exchange (ETDEWEB)
Heifets, S A [Stanford Linear Accelerator Center, Menlo Park, CA (United States)
1996-08-01
The processes defining the density distribution of the photoelectrons are quite complicated. In this study, a simplified model of the instability was used to get a quick estimate of the growth rate of the instability and the relative importance of the parameters, as has been done in Ohmi`s paper. The production rate and dynamics of the photoelectrons are studied for the PEP-II parameters. The growth rate of the transverse instability driven by the primary photoelectrons is of the order of 0.7 msec for the PEP-II parameters. The multipactoring at resonance currents cannot produce large electron density due to the final energy spread caused by the finite bunch length and the intrinsic energy spread of the secondary electrons. Production of the secondary electrons may lead to large average densities. The ion can be produced in electron collisions with the residual gas with density of the order of the electron density. (G.K.)
Contribution of 194.1 keV Resonance to 17O(p, alpha) 14N Reaction Rate using R Matrix Code
International Nuclear Information System (INIS)
Chafa, A.; Messili, F.Z.; Barhoumi, S.
2009-01-01
Knowledge of the 17 O(p, alpha ) 14 N reaction rates is required for evaluating elemental abundances in a number of hydrogen - burning stellar sites. This reaction is specifically very important for nucleosynthesis of the rare oxygen isotope 17 O. Classical novae are thought to be a major source of 17 O in the Galaxy and produce the short-live radioisotope 18 F whose + decay is followed by a gamma ray emission which could be observed with satellites such as the Integral observatory. As the 17 O(p, alpha) 14 N and 17 O(p, alpha ) 18 F reactions govern the destruction of 17 O and the formation of 1 '8F, their rates are decisive in determining the final abundances of these isotopes. Stellar temperatures of primary importance for nucleosynthesis are typically in the ranges T = 0.01-0.1 GK for red giant, AGB, and massive stars, and T 0.01-0.4 GK for classical nova explosions In recent work, we observed, for the first time, a resonance a 183.3 keV corresponding to level in 18 F at Ex 5789.8 ± 0.3 keV. A new astrophysical parameters of this resonance are found. In this work we study this reaction using numerical code based on R matrix method including the new values of level energy and parameters of 183.3 keV resonance in order to show his contribution to 17 O(p, alpha) 14 N reaction rates. We also use old parameters values of this resonance given in Keiser work for comparison. We show that this resonance predominate the reaction rates in all range of stellar temperature for classical nova explosions. This is in good agreement with our work with experimental method. We also study cross section and differential cross section 17 O(p, alpha ) 14 N reaction with R matrix method
Starrfield, Sumner; Drake, Jeremy
2001-09-01
V1494 Aql (Nova Aql 1999 No. 2) was discovered on 2 December 1999. It reached Vmax ~4 making it the brightest northern hemisphere nova since V1500 Cyg erupted in 1975. Our early optical spectra showed that it was an ``Fe II'' class nova (Williams, R.E. AJ, 104, 725, 1992). We activated our CHANDRA Target of Opportunity proposal for bright novae in outburst and obtained ACIS-I spectra on 15 April and 7 June 2000 which showed only emission lines. Our third observation, on 6 August, showed that its spectrum had evolved into that characteristic of a Super Soft X-ray Source (at low resolution it resembled an ``emission'' line with a peak ~ 0.5 keV). We obtained HRC-S+LETG spectra on 28 September (8 ksec) and 1 October 2000 (17 ksec). These spectra qualitatively resembled those of CAL 83 obtained with XMM (Paerels, F., et al. 2001, A&A, 365, L308) and demonstrated that we were observing the atmosphere of a hot white dwarf which was probably still undergoing nuclear burning near the surface. An abundance analysis of the X-ray spectrum is in progress using new Non-LTE stellar atmospheres. We then analyzed the X-ray light curve of our grating observations and, to our surprise, found that we had discovered both a short time scale ``burst'' and that the nova was oscillating. Neither of these phenomena have ever been seen in the light curve of a nova in outburst. The ``burst'' was a factor of 6 rise in X-ray counts near the middle of the second observation which lasted about 1000 sec and exhibited at least two peaks plus other structure. Currently, we have no explanation for the cause of this burst. Our time series analysis of the combined 25 ksec observation showed a peak at 2500 sec which was present in independent analyses of both the zeroth order image and the dispersed spectrum. We also analyzed the light curves of the HRC-S+LETG observations of HZ 43, Sirius B, and V382 Vel (Nova Vel 1999) and found no sign of any periodic behavior in the data which implied that the
Directory of Open Access Journals (Sweden)
Norma Urban Gomes
2010-05-01
Full Text Available Resumo: Este trabalho tem como objetivo, mostrar a relação intrínseca entre o trânsito e o turismo na cidade de Caldas Novas – GO. Deste modo, para estudarmos o trânsito e seus elementos, bem como todos os fatores positivos e negativos do mesmo na cidade teremos necessariamente que falar a respeito do turismo, pois é partir dessa premissa que se molda a questão da Geografia dos Transportes em Caldas Novas,cidade esta que se destaca pelo apelo turístico de suas águas termais. A Geografia se preocupa com o inter-relacionamento ambiental e humano em um contexto espacial, e Geografia dos Transportes é o estudo dos sistemas de transportes e seus impactos espaciais. Os meios de transporte são essenciais em uma cidade turística, pois o fluxo de pessoas, bens e serviços dependem substancialmente da condição de circulação. Esse trabalho justifica-se pela necessidade de compreender e avaliar a situação do trânsito na cidade de Caldas Novas nos períodos de alta temporada, quando a cidade sofre intensa movimentação turística,causando um grande acumulo de veículos e pessoas nas vias de circulação. Isso dificulta além obviamente da circulação das pessoas como a circulação de bens e serviços essenciais para que a atividade turística se desenvolva satisfatoriamente. O estudo dos transportes é, sobretudo, multidisciplinar por natureza, e algumas vezes também interdisciplinar.
UBV photometry of dwarf novae in the brightness minimum
International Nuclear Information System (INIS)
Voloshina, I.B.; Lyutyj, V.M.
1983-01-01
Photoelectric one-night observations of the dwarf novae SS Cyg at minimum light evidence for the existence of eclipses in this system at the moments of conjuctions. The orbital inclination of the system is estimated to be i approximately 70 deg C. The components of this system are low-massive (white and red dwarf stars) and low-luminous objects. As the optical luminosity of the dwarf novae at the minimum light is dependent on the accretion disk and hot spot at its periphery, where the substance jet run out from a nondegenerated component falls, eclipses should be associated with the disk and hot spot. The white dwarf star contributes greatly to the luminosity at the minimum light, but its eclipses are possible only at i approximately 90 deg
Psicologia Positiva: uma nova abordagem para antigas questões
Directory of Open Access Journals (Sweden)
Simone dos Santos Paludo
2007-04-01
Full Text Available Historicamente, a Psicologia preocupou-se em investigar patologias, negligenciado os aspectos saudáveis dos seres humanos. Mas, a partir de 1998, assumindo a presidência da American Psychological Association, Seligman iniciou movimento denominado Psicologia Positiva, que visa oferecer nova abordagem às potencialidades e virtudes humanas, estudando as condições e processos que contribuem para a prosperidade dos indivíduos e comunidades. Este artigo apresenta e discute essa nova proposta científica, que promete melhorar a qualidade de vida dos indivíduos e prevenir patologias; também as lacunas existentes nas investigações em Ciências Humanas, as contribuições teóricas e empíricas e as possíveis aplicações desse conhecimento.
Safety and Effectiveness of NovaSure® Endometrial Ablation After Placement of Essure® Micro-Inserts.
Basinski, Cindy M; Price, Pamela; Burkhart, Jamie; Johnson, Jamie
2012-04-01
Objective: In-office NovaSure ® after Essure ® is a clinical paradigm for which physicians are seeking information. A PubMed search (July 2011) revealed no peer-reviewed articles describing this treatment sequence. To address the paucity of data on this topic, patients who had undergone Essure followed by NovaSure in a private practice office between July 1, 2008 and December 31, 2009 were evaluated. The objective was to evaluate safety and feasibility of in-office NovaSure after Essure, and to determine if the effectiveness of either procedure was altered by this treatment sequence. Design: This was a retrospective cohort study of 117 women (ages 24-52). Methods: Patients underwent Essure followed by NovaSure in two in-office sessions, separated by a median of 14 days. All patients had menorrhagia and desired permanent sterilization. A postprocedure patient questionnaire was administered to assess satisfaction and perceived effectiveness. Results: Among patients who underwent Essure followed by NovaSure, 83/117 (71%) returned for a 3-month hysterosalpingogram (HSG). Satisfactory placement and tubal occlusion were noted in 79/83 (95%) of these patients. Amenorrhea or spotting was observed in 72/97 (74%) of patients, 22/97 (23%) reported a satisfactory decrease in menstrual flow, and 3/97 (3%) reported ablation failure. Essure followed by NovaSure did not decrease the effectiveness of either procedure, and no adverse events were attributed to the combination of the two procedures. Patients reported high levels of satisfaction with both procedures. Conclusions: In women seeking permanent birth control and menorrhagia reduction, in-office Essure followed by NovaSure appeared to be safe, effective, and associated with high patient satisfaction. (J GYNECOL SURG 28:1).
Energy Technology Data Exchange (ETDEWEB)
Suski, G.J.; Holloway, F.W.; Duffy, J.M.
1983-05-10
This paper explores the impact of an HOL on the development of the distributed computer control system for Nova laser fusion facility. As the world's most powerful glass laser, Nova will generate 150 trillion watt pulses of infrared light focused onto fusion targets a few millimeters in diameter. It will perform experiments designed to explore the feasibility of fusion as an energy source of the future. Nova will utilize fifty microcomputers and four VAX-11/780's in a distributed process control computer system architecture.
Long-term Spot-Coverage Variations of 13 BY Dra G-K Dwarfs
Alekseev, I. Yu.; Kozhevnikova, A. V.
2018-06-01
The results of spot-coverage modeling for 13 active G-K dwarf stars based on many-year photometric observations are presented. The results of UBV RI observations of eight stars performed at the Crimean Astrophysical Observatory were used together with data from the literature in this analysis. The spot-coverage parameters for 13 selected BY Dra active red dwarfs have been redetermined to improve the zonal spot-coverage model for the stellar photospheres, which currently allows for the presence of two active longitudes. Time variations of the spot-activity characteristics of these systems were analyzed with the aim of searching for possible cyclic variations. All the stars, with the exception of OU Gem and BE Cet, show fairly strong correlations between variations in the spot latitudes and spot areas, with absolute values of the correlation coefficients, R(, S), ranging from 0.38 to 0.92. For five stars, an anti-correlation between the mean latitude and area of the spots was found ( R(, S) from-0.24 to-0.73). This behavior may reflect the drift of spots toward the equator in the course of their development. Eight stars feature positive correlations, i.e. the spots drift towards the pole as their areas increase. Nine stars demonstrate activity cycles, which are reflected in photometric variations as well as variations of the spot areas and mean latitudes. The periods of the latitude drift of the spots are found for five stars; the magnitudes of the spot-latitude drift rates are lower than the corresponding value for sunspots by a factor of 1.5-3.
Discovery of an Apparent Nova in M81
Hornoch, K.; Alfaro, M. Diaz; Ordonez-Etxeberria, I.; Vaduvescu, O.
2015-01-01
We report the discovery of an apparent nova in M81 on a co-added 1600-s narrow-band H-alpha CCD image taken with the 2.5-m Isaac Newton Telescope (INT) + WFC at La Palma under ~2.4" seeing on 2015 Jan. 15.126 UT.
Nova target chamber decontamination study
International Nuclear Information System (INIS)
1979-05-01
An engineering study was performed to determine the most effective method for decontamination of the Nova target chamber. Manual and remote decontamination methods currently being used were surveyed. In addition, a concept that may not require in-situ decontamination was investigated. Based on the presently available information concerning material and system compatibility and particle penetration, it is recommended that a system of removable aluminum shields be considered. It is also recommended that a series of tests be performed to more precisely determine the vacuum compatibility and penetrability of other materials discussed in this report
Determining Data Quality for the NOvA Experiment
Murphy, Ryan; NOvA Collaboration Collaboration
2016-03-01
NOvA is a long-baseline neutrino oscillation experiment with two liquid scintillator filled tracking calorimeter detectors separated by 809 km. The detectors are located 14.6 milliradians off-axis of Fermilab's NuMI beam. The NOvA experiment is designed to measure the rate of electron-neutrino appearance out of the almost-pure muon-neutrino NuMI beam, with the data measured at the Near Detector being used to accurately determine the expected rate of the Far Detector. It is therefore very important to have automated and accurate monitoring of the data recorded by the detectors so any hardware, DAQ or beam issues arising in the 0.3 million (20k) channels of the far (near) detector which could effect this extrapolation technique are identified and the affected data removed from the physics analysis data set. This poster will cover the techniques and efficiency of selecting good data, describing the selections placed on different data and hardware levels.
Processos globais e mercado de trabalho: novas dinâmicas no setor automotivo no Brasil - anos 2000
Directory of Open Access Journals (Sweden)
Garcia, Sandro Ruduit
2007-01-01
Full Text Available O artigo tenta identificar novas dinâmicas no mercado de trabalho, face aos processos globais, a partir do que vem ocorrendo no setor automotivo brasileiro nos anos 2000, focando particularmente o caso do pólo de Gravataí (RS. O argumento central da análise é de que a constituição de processos globais promove novas dinâmicas em mercados de trabalho regionais. A abertura de mercados de produtos, as composições entre capitais nacionais e estrangeiros e os investimentos em novas plantas industriais expressam processos globais que poderiam criar novas atividades e funções produtivas, empresas e empregos, assim como estimular capacidades e conhecimentos. Por outro lado, a competitividade, instabilidade e interdependência do sistema global reforçariam a seletividade social nos mercados de trabalho regionais, constituindo novos riscos e ansiedades para segmentos econômicos e sociais vulneráveis. Isso tenderia a mobilizar instituições no esforço de tentar reparar distorções face à nova complexidade do mercado de trabalho
Directory of Open Access Journals (Sweden)
Enide Luciana Lima Belmont
2012-09-01
Full Text Available Leptohyphidae (Insecta, Ephemeroptera do Estado do Amazonas, Brasil: novos registros, nova combinação, nova espécie e chave de identificação para estágios ninfais. Os seguintes gêneros de Leptohyphidae ocorrem no estado do Amazonas: Amanahyphes Salles & Molineri, Leptohyphes Eaton, Tricorythodes Ulmer e Tricorythopsis Traver. A distribuição das espécies de Leptohyphidae no Estado do Amazonas é apresentada. Uma espécie nova, Tricorythodes yapekuna sp. nov., é descrita e pode ser diferenciada de outros Tricorythodes pelas (1 garras tarsais com um par de dentículos submarginais e sem dentículos marginais; (2 palpo maxilar biarticulado; (3 brânquia opercular uniformemente preta com exceção da margem apical; (4 fórmula branquial 2/3/3/3/2; e (5 margem lateral do abdome expandida nos segmentos III_VI. Uma combinação nova, Tricorythopsis rondoniensis (Dias, Cruz & Ferreira, 2009 comb. nov., é proposta e constitui o primeiro registro dessa espécie para o Estado do Amazonas. Uma chave dicotômica ilustrada para identificar ninfas de gêneros e espécies ocorrentes no Amazonas também é apresentada.
Cijepani litički materijal s prapovijesnog nalazišta Slavča, Nova Gradiška
Šošić, Rajna; Karavanić, Ivor
2005-01-01
SUMMARY TECHNOLOGICAL AND TYPOLOGICAL ANALYSIS OF THE CHIPPED STONE ARTIFACTS FROM THE PREHISTORIC SITE OF SLAV^A, NOVA GRADI[KA The site of Slav~a is situated on the south flanks of Psunj Mountain, in the town of Nova Gradi{ ka, Western Slavonia. The site has been continuosly excavated since 1997 by the City Museum of Nova Gradi{ka. A total number of 1655 chipped stone artifacts have been analyised, classified to the Sopot, Kostolac and Lasinja cultures, in effect a peri...
Nova pulse power system description and status
International Nuclear Information System (INIS)
Holloway, R.W.; Whitham, K.; Merritt, B.T.; Gritton, D.G.; Oicles, J.A.
1981-01-01
The Nova laser system is designed to produce critical data in the nation's inertial confinement fusion effort. It is the world's largest peak power laser and presents various unique pulse power problems. In this paper, pulse power systems for this laser are described, the evolutionary points from prior systems are pointed out, and the current status of the hardware is given
THE RED NOVA-LIKE VARIABLE IN M31-A BLUE CANDIDATE IN QUIESCENCE
International Nuclear Information System (INIS)
Shara, Michael M.; Zurek, David; Prialnik, Dina; Yaron, Ofer; Kovetz, Attay
2010-01-01
M31-RV was an extraordinarily luminous (∼10 6 L sun ) eruptive variable, displaying very cool temperatures (roughly 1000 K) as it faded. While this object's peak luminosity matched or exceeded those of the brightest known classical novae, its red colors and cool spectra were very different from those of classical novae. The photometric behavior of M31-RV (and several other very red novae, i.e., luminous eruptive red variables) has led to several models of this apparently new class of astrophysical object. We list these models, which predict very red eruptions and very red remnants decades after the eruptions. One of the most detailed models is that of 'mergebursts'. Mergebursts are (hypothetical) mergers of close binary stars, predicted to rival or exceed the brightest classical novae in luminosity, but to be much cooler and redder than classical novae, and to become slowly hotter and bluer as they age. This prediction suggests two stringent and definitive tests of the mergeburst hypothesis. First, there should always be a cool red remnant, and NOT a hot blue remnant at the site of such an outburst. Second, the inflated envelope of a mergeburst event should be slowly contracting; hence, it must display a slowly rising effective temperature. We have searched the location of M31-RV in multiple observatory archives. Our search revealed a luminous, UV-bright object within 0.''4 (1.5σ of the astrometric position) of M31-RV in archival WFPC2 images taken 10 years after the outburst. Recent Hubble imagery, 20 years after the outburst, determines that this object is still hot and fading; it remains much too hot to be a mergeburst. Furthermore, the effective temperature of this object is declining, contrary to the prediction for mergebursts. If we have correctly identified M31-RV's remnant, it cannot be a mergeburst-but its behavior is consistent with theoretical nova models which erupt on a low-mass white dwarf. Future Hubble UV and visible images could determine if the
VLBI detection of the internal shocks in nova V959 Mon
Yang, J.; Paragi, Z.; O'Brien, T.; Chomiuk, L.; Linford, J. D.
V959 Mon is a classical nova detected at GeV gamma-ray wavelengths on 2012 June 19. While classical novae are now routinely detected in gamma-rays, the origin of the shocks that produce relativistic particles has remained unknown. We carried out electronic European VLBI Network (e-EVN) observations that revealed a pair of compact synchrotron emission features in V959 Mon on 2012 Sep 18. Since synchrotron emission requires strong shocks as well, we identify these features as the location where the gamma rays were produced. We also detected the extended ejecta in the follow-up EVN observations. They expanded much faster in East-West direction than the compact knots detected in the aforementioned e-EVN measurements. By comparing the VLBI results with lower resolution images obtained using e-MERLIN and the VLA - as reported by Chomiuk et al. (2014) - it appears that 1) influenced by the binary orbit, the nova ejecta was highly asymmetric with a dense and slow outflow in the equatorial plane and low-density and faster ejecta along the poles; and 2) the VLBI knots were related to shocks formed in the interaction region of these outflows.
ORF Alignment: NC_002935 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Haloarcula marismortui ATCC 43049] ... Length = 295 ... Query: 24 ... KPFIAIWEVTRACGLVCQHCRADAQH...EPHPEQLTTEQGKQLLSDLASYERPKPLVVLTGG 83 ... +P++ IWEVT+AC L C+HCRADAQ ... HP++...L+T +GK LL D AS ... LVVL+GG Sbjct: 3 ... QPLVLIWEVTQACELACKHCRADAQPRRHPDELSTAEGKALL-DQASEFGDGQLVVLSGG 61 ... Que
Traditional and alternative nonlinear models for estimating the growth of Morada Nova sheep
Directory of Open Access Journals (Sweden)
Laaina de Andrade Souza
2013-09-01
Full Text Available In the present study, alternative and traditional nonlinear models to describe growth curves of Morada Nova sheep reared in the state of Bahia, Brazil, were applied. The nonlinear models were: Schnute, Mitscherlich, Gompertz, Logistic, Meloun I Meloun II, III Meloun, Gamito and Meloun IV. The model adjustment was evaluated by using: Adjusted Coefficient of Determination (R²aj, Akaike Information Criterion (AIC, Bayesian Information Criterion (BIC, Mean Squared Error of Prediction (MEP and Coefficient of Determination of Prediction (R²p. The selection of the best model was based on cluster analysis, using the evaluators as variables. Six out of the nine tested models converged, while Meloun I and Meloun IV were equally effective in explaining animal growth, without significant influence of sex or type of parturition over the curve parameters. The models Meloun I and IV have the best adjustment and reveal a remarkable reduction of weight gain after 150 days of age, which indicates special attention should be given to feeding at this stage.
Evaluation of petroleum products pricing regulation in Nova Scotia : a 2 year review
International Nuclear Information System (INIS)
2008-11-01
Gasoline price regulation was introduced in Nova Scotia on July 1st, 2006. This report presented the findings and recommendations of a review of the first two years of the gasoline price regulation in Nova Scotia. The regulations had three main objectives. This review examined whether, and to what extent, they were achieved. The objectives were to stabilize price, maintain industry infrastructure, and minimize cost to consumers. The report described the rationale for the regulation, study objectives, and approach taken to gasoline regulation in Nova Scotia, including the objectives and technical aspects of how regulation works. The gasoline market in Nova Scotia was examined, including the market structure and competitive behaviour in an unregulated market. The report also provided some theoretical perspectives on how regulation was likely to affect industry structure and competitive behaviour. The extent to which the regulation was meeting its objectives was then assessed and perspectives on the regulation from consumers, retailers and wholesalers were offered. Last, the report provided a review of the findings in terms of the key elements of regulatory design and set out recommendations for improving the system. It was recommended that in order to improve certainty, particularly given the regulated price differences amongst grades, the regulations should be amended to include grade specifications referencing octane ratings. tabs., figs
Energy Technology Data Exchange (ETDEWEB)
Sauter, H.; Meyder, R.; Philipp, P.; Samstag, M.
1995-08-01
The NOVA program was continued with turbulent, vertical, upward two-phase flow experiments. The development of a local gas distribution along the test section was visualized by X-ray tomography. (orig.)
Directory of Open Access Journals (Sweden)
Zhang Shunchuan
2010-09-01
Full Text Available Abstract Duck virus enteritis (DVE is an acute, contagious herpesvirus infection of ducks, geese, and swans, which has produced significant economic losses in domestic and wild waterfowl. With the purpose of decreasing economic losses in the commercial duck industry, studying the unknown glycoprotein K (gK of DEV may be a new method for preferably preventing and curing this disease. So this is the first time to product and purify the rabbit anti-tgK polyclonal antibody. Through the western blot and ELISA assay, the truncated glycoprotein K (tgK has good antigenicity, also the antibody possesses high specificity and affinity. Meanwhile the rabbit anti-tgK polyclonal antibody has the potential to produce subunit vaccines and the functions of neutralizing DEV and anti-DEV infection because of its neutralization titer. Indirect immunofluorescent microscopy using the purified rabbit anti-tgK polyclonal antibody as diagnostic antibody was susceptive to detect a small quantity of antigen in tissues or cells. This approach also provides effective experimental technology for epidemiological investigation and retrospective diagnose of the preservative paraffin blocks.
Centralized computer-based controls of the Nova Laser Facility
International Nuclear Information System (INIS)
Krammen, J.
1985-01-01
This article introduces the overall architecture of the computer-based Nova Laser Control System and describes its basic components. Use of standard hardware and software components ensures that the system, while specialized and distributed throughout the facility, is adaptable. 9 references, 6 figures
International Nuclear Information System (INIS)
Sparks, W.M.; Kutter, G.S.
1980-01-01
The rapid coherent oscillation during a dwarf nova outburst is attributed to an accretion-driven wave going around the white dwarf component of the binary system. The increase and decrease in the period of this oscillation is due to the change in the velocity of the wave as it is first being driven and then damped. Qualitatively, a large number of observations can be explained with such a model. The beginnings of a mathematical representation of this model are developed. (orig.)
Review of the classical nova outburst
International Nuclear Information System (INIS)
Starrfield, S.; Sparks, W.M.
1986-06-01
Observational studies have not only identified a new class of novae but theoretical simulations of this class have been found to be in excellent agreement with the observations. This new class consists of outbursts occurring on ONeMg white dwarfs in close binar systems in contrast to the other outbursts which are occurring on CO white dwarfs. We also review the effects of the β + -unstable nuclei and show how their presence has a major effect on the evolution. 77 refs
NOvA Event Building, Buffering and Data-Driven Triggering From Within the DAQ System
International Nuclear Information System (INIS)
Fischler, M; Rechenmacher, R; Green, C; Kowalkowski, J; Norman, A; Paterno, M
2012-01-01
The NOvA experiment is a long baseline neutrino experiment design to make precision probes of the structure of neutrino mixing. The experiment features a unique deadtimeless data acquisition system that is capable acquiring and building an event data stream from the continuous readout of the more than 360,000 far detector channels. In order to achieve its physics goals the experiment must be able to buffer, correlate and extract the data in this stream with the beam-spills that occur that Fermilab. In addition the NOvA experiment seeks to enhance its data collection efficiencies for rare class of event topologies that are valuable for calibration through the use of data driven triggering. The NOvA-DDT is a prototype Data-Driven Triggering system. NOvA-DDT has been developed using the Fermilab artdaq generic DAQ/Event-building toolkit. This toolkit provides the advantages of sharing online software infrastructure with other Intensity Frontier experiments, and of being able to use any offline analysis module-unchanged-as a component of the online triggering decisions. We have measured the performance and overhead of NOvA-DDT framework using a Hough transform based trigger decision module developed for the NOvA detector to identify cosmic rays. The results of these tests which were run on the NOvA prototype near detector, yielded a mean processing time of 98 ms per event, while consuming only 1/16th of the available processing capacity. These results provide a proof of concept that a NOvA-DDT based processing system is a viable strategy for data acquisition and triggering for the NOvA far detector.
Creating Cohesive Community Through Shared Reading: A Case Study of One Book Nova Scotia
Directory of Open Access Journals (Sweden)
Alyssa Harder
2015-06-01
Full Text Available One Book Nova Scotia is described on the program’s website as “a province-wide community reading event for adults.” Formally programmed events have included the book announcement and launch, a series of author readings, and book discussions, both face to face and through Twitter. This paper analyzes the success of the One Book Nova Scotia program in achieving its goals of developing a reading culture and community in the province of Nova Scotia based on the findings of a participant survey, distributed in both 2012 and 2013, and an analysis of the 2013 Twitter discussion. This analysis reveals that participants tended to be well-educated females, aged 50-59, and often employed in libraries, bookselling or publishing, or news media. The goal of developing or participating in a reading community was a compelling motivator for many respondents. Although many respondents indicated their desire to be part of a reading community, Twitter was not proven to be an effective forum for fostering conversation or debate related to One Book Nova Scotia. Building on the analysis, the paper concludes with some recommendations to improve the effectiveness of future programs. These recommendations include the selection of a book with strong regional connections, an expansion of publicity methods, an increase in lead time between the announcement of the book title and the start of programming, and a more strategic use of Twitter as a discussion forum. Although these recommendations arise from the specific analysis of the One Book Nova Scotia reading program, they are general enough to apply to other One Book, One Community programs.
Pan-chromatic observations of the remarkable nova Large Magellanic Cloud 2012
Energy Technology Data Exchange (ETDEWEB)
Schwarz, Greg J. [American Astronomical Society, 2000 Florida Ave., Nw, Suite 300, DC 20009-1231 (United States); Shore, Steven N. [Dipartimento di Fisica “Enrico Fermi,” Universita di Pisa, and INFN-Sezione Pisa, Largo B. Pontecorvo 3, I-56127, Pisa (Italy); Page, Kim L.; Osborne, Julian P.; Beardmore, Andrew P. [X-Ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, Leicester, LE1 7RH (United Kingdom); Walter, Frederick M. [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY, 11794-3800 (United States); Bode, Michael F. [Astrophysics Research Institute, IC2 Liverpool Science Park, 146 Brownlow Hill, L3 5RF (United Kingdom); Drake, Jeremy J. [Smithsonian Astrophysical Observatory, MS-3, 60 Garden Street, Cambridge, MA 02138 (United States); Ness, Jan-Uwe [European Space Astronomy Centre, P.O. Box 78, E-28691 Villanueva de la Canada, Madrid (Spain); Starrfield, Sumner [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Rossum, Daniel R. Van [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Woodward, Charles E., E-mail: Greg.Schwarz@aas.org [Minnesota Institute for Astrophysics, University of Minnesota, 116 Church S., SE, Minneapolis, MN 55455 (United States)
2015-03-01
We present the results of an intensive multiwavelength campaign on nova LMC 2012. This nova evolved very rapidly in all observed wavelengths. The time to fall two magnitudes in the V band was only 2 days. In X-rays the super soft phase began 13 ± 5 days after discovery and ended around day 50 after discovery. During the super soft phase, the Swift/XRT and Chandra spectra were consistent with the underlying white dwarf (WD) being very hot, ∼1 MK, and luminous, ∼10{sup 38} erg s{sup −1}. The UV, optical, and near-IR photometry showed a periodic variation after the initial and rapid fading had ended. Timing analysis revealed a consistent 19.24 ± 0.03 hr period in all UV, optical, and near-IR bands with amplitudes of ∼0.3 mag which we associate with the orbital period of the central binary. No periods were detected in the corresponding X-ray data sets. A moderately high inclination system, i = 60 ± 10{sup ∘}, was inferred from the early optical emission lines. The HST/STIS UV spectra were highly unusual with only the N v (1240 Å) line present and superposed on a blue continuum. The lack of emission lines and the observed UV and optical continua from four epochs can be fit with a low mass ejection event, ∼10{sup −6} M{sub ⊙}, from a hot and massive WD near the Chandrasekhar limit. The WD, in turn, significantly illuminated its subgiant companion which provided the bulk of the observed UV/optical continuum emission at the later dates. The inferred extreme WD characteristics and low mass ejection event favor nova LMC 2012 being a recurrent nova of the U Sco subclass.
Pan-chromatic observations of the remarkable nova Large Magellanic Cloud 2012
International Nuclear Information System (INIS)
Schwarz, Greg J.; Shore, Steven N.; Page, Kim L.; Osborne, Julian P.; Beardmore, Andrew P.; Walter, Frederick M.; Bode, Michael F.; Drake, Jeremy J.; Ness, Jan-Uwe; Starrfield, Sumner; Rossum, Daniel R. Van; Woodward, Charles E.
2015-01-01
We present the results of an intensive multiwavelength campaign on nova LMC 2012. This nova evolved very rapidly in all observed wavelengths. The time to fall two magnitudes in the V band was only 2 days. In X-rays the super soft phase began 13 ± 5 days after discovery and ended around day 50 after discovery. During the super soft phase, the Swift/XRT and Chandra spectra were consistent with the underlying white dwarf (WD) being very hot, ∼1 MK, and luminous, ∼10 38 erg s −1 . The UV, optical, and near-IR photometry showed a periodic variation after the initial and rapid fading had ended. Timing analysis revealed a consistent 19.24 ± 0.03 hr period in all UV, optical, and near-IR bands with amplitudes of ∼0.3 mag which we associate with the orbital period of the central binary. No periods were detected in the corresponding X-ray data sets. A moderately high inclination system, i = 60 ± 10 ∘ , was inferred from the early optical emission lines. The HST/STIS UV spectra were highly unusual with only the N v (1240 Å) line present and superposed on a blue continuum. The lack of emission lines and the observed UV and optical continua from four epochs can be fit with a low mass ejection event, ∼10 −6 M ⊙ , from a hot and massive WD near the Chandrasekhar limit. The WD, in turn, significantly illuminated its subgiant companion which provided the bulk of the observed UV/optical continuum emission at the later dates. The inferred extreme WD characteristics and low mass ejection event favor nova LMC 2012 being a recurrent nova of the U Sco subclass.
Que Modelo de Militar para a Nova Arte de Guerra e Paz?
Vieira, Guilherme Belchior
2001-01-01
A pós-modernidade militar, surgida com o final da Guerra Fria, tem decorrido num ambiente internacional caracterizado pelo declínio das guerras entre estados e o deflagrar de guerras prolongadas no interior dos estados (as “novas guerras”), nomeadamente na África subsariana e no coração da Europa, provocadas por diferenças étnicas, tribais, religiosas ou políticas e deixando na sua esteira populações em situações de extrema carência. As operações de apoio à paz (as “novas missões”) p...
The accreting white dwarfs in VY Scl nova-like variables
International Nuclear Information System (INIS)
Sion, Edward M; Mizusawa, Trisha; Ballouz, Ronald-Louis
2009-01-01
Accurate distances for nova-like variables offer the possibility of extracting information on nova-like accretion rates during high states of optical brightness and on their underlying accretion-heated white dwarfs during intermediate and low brightness states. The modeling technique which is employed is discussed and a representative example, the novalike variable KR Aur, is presented. Although KR Aur was in a fainter high state when its far ultraviolet spectrum was obtained, roughly one-half of its FUV radiation is due to the light of an accretion disk and the other half is contributed by a hot white dwarf with T eff = 29, 000±2, 000K. However, this best-fit solution corresponds to a distance of 180 pc which was an early distance estimate due to Patterson (1984).
Characterization of X-ray streak cameras for use on Nova
International Nuclear Information System (INIS)
Kalantar, D.H.; Bell, P.M.; Costa, R.L.; Hammel, B.A.; Landen, O.L.; Orzechowski, T.J.; Hares, J.D.; Dymoke-Bradshaw, A.K.L.
1996-09-01
There are many different types of measurements that require a continuous time history of x-ray emission that can be provided with an x-ray streak camera. In order to properly analyze the images that are recorded with the x-ray streak cameras operated on Nova, it is important to account for the streak characterization of each camera. We have performed a number of calibrations of the streak cameras both on the bench as well as with Nova disk target shots where we use a time modulated laser intensity profile (self-beating of the laser) on the target to generate an x-ray comb. We have measured the streak camera sweep direction and spatial offset, curvature of the electron optics, sweep rate, and magnification and resolution of the electron optics
Fast optical shutters for Nova, a high power fusion laser
International Nuclear Information System (INIS)
Bradley, L.P.; Gagnon, W.L.; Carder, B.M.
1977-01-01
Preliminary design and performance test results for fast optical shutters intended for use in the Nova high power fusion laser system are briefly described. Both an opening shutter to protect the pellet target from amplified spontaneous emission (ASE), and a closing shutter to protect the laser from light reflected back from the target are discussed. Faraday rotators, synchronized by a 400 Hz oscillator, provide an opening shutter mechanism with an opening time of approximately 10 μs. A plasma closing shutter, employing electrical sublimation of a foil, provide a shutter closing time of 70 ns +- 20 ns. Energy for foil sublimation is provided by discharge of a 42 J capacitor bank. Implementation of these shutter techniques in the Nova system is anticipated to improve laser output power and efficiency
deVille, Barry, Ed.
This is a preliminary examination of the present status and future prospects of educational technology in Nova Scotian schools. It is aimed at developing a plan to enhance the quality of educational technology by concentrating on systems which will be conducive to realizing educational goals at a reasonable cost. An overview of the institutional…
Multiwavelength monitoring of the dwarf nova VW Hydri
International Nuclear Information System (INIS)
Pringle, J.E.; Bateson, F.M.; Hassall, B.J.M.
1987-01-01
The results of a prolonged and coordinated set of observations of the dwarf nova VW Hydri spanning optical to X-ray wavelengths are described in this and four subsequent papers. In this paper an overview is given of the data set as a whole, with particular reference to its implications for an understanding of the object. (author)
Novas tecnologias na aula de Matemática
Ponte, João Pedro da
1995-01-01
As novas tecnologias computacionais (NT) assumiram um papel de primeiro plano no ensino da Matemática na última década. Este artigo ilustra o partido que se pode tirar, em diferentes níveis de ensino, de materiais já perfeitamente testados, largamente disponíveis e susceptíveis de generalizada utilização.
International Nuclear Information System (INIS)
Yu, Yun-Wei; Zhang, Bing; Gao, He
2013-01-01
A massive millisecond magnetar may survive the merger of a neutron star (NS) binary, which would continuously power the merger ejecta. We develop a generic dynamic model for the merger ejecta with energy injection from the central magnetar. The ejecta emission (the m erger-nova ) powered by the magnetar peaks in the UV band and the peak of the light curve, progressively shifts to an earlier epoch with increasing frequency. A magnetar-powered merger-nova could have an optical peak brightness comparable to a supernova, which is a few tens or hundreds times brighter than the radioactive-powered merger-novae (the so-called macro-nova or kilo-nova). On the other hand, such a merger-nova would peak earlier and have a significantly shorter duration than that of a supernova. An early collapse of the magnetar could suppress the brightness of the optical emission and shorten its duration. Such millisecond-magnetar-powered merger-novae may be detected from NS-NS merger events without an observed short gamma-ray burst, and could be a bright electromagnetic counterpart for gravitational wave bursts due to NS-NS mergers. If detected, it suggests that the merger leaves behind a massive NS, which has important implications for the equation-of-state of nuclear matter
High resolution time- and 2-dimensional space-resolved x-ray imaging of plasmas at NOVA
International Nuclear Information System (INIS)
Landen, O.L.
1992-01-01
A streaked multiple pinhole camera technique, first used by P. Choi et al. to record time- and 2-D space-resolved soft X-ray images of plasma pinches, has been implemented on laser plasmas at NOVA. The instrument is particularly useful for time-resolved imaging of small sources ( 2.5 key imaging, complementing the existing 1--3 key streaked X-ray microscope capabilities at NOVA
Target area for Nova upgrade: Containing ignition and beyond
International Nuclear Information System (INIS)
Tobin, M.T.; Smith, J.R.; Campbell, D.; Wong, D.K.; Sullivan, J.A.; Pendergrass, J.; Weinstein, B.; Klein, M.
1991-01-01
The Lawrence Livermore National Laboratory (LLNL) is developing a conceptual design for upgrading the Nova laser from ∼ 50 kJ to ∼ 1.8 MJ of laser energy at a wavelength of 351 nm. Anticipated target performance includes achieving ignition and possibly fusion yields to 20 MJ. The target area design represents a unique challenge since it will be operating in a regime where first wall ablation and optics damage are major issues for the first time in an ICF facility. Here we describe potential performance criteria for the facility and anticipated yield-dependent x-ray, neutron, shrapnel, and debris environments. We also briefly describe the different systems that make up the target area and discuss some of the design issues. The insignificant environmental impact Nova Upgrade (NU) operations is anticipated to have on the laboratory and surrounding area is discussed. Finally, alternate design options are described along with their potential benefits
Development Application - Terra Nova Development - Canada-Newfoundland Benefits Plan
International Nuclear Information System (INIS)
1996-01-01
The Canada-Newfoundland Benefits Plan, part of the overall application to develop the Terra Nova Field off the coast of Newfoundland details the benefits to Canadians, but most particularly to residents of Newfoundland and Labrador that a vibrant petroleum industry is expected to bring. In this document the proponents commit themselves to a course of action designed to enhance the opportunities for Canadian and Newfoundland participation in the development, in accordance with the Atlantic Accord legislation. In terms of this legislation, the project proponents are obliged to perform development functions from Newfoundland, acquire goods and services for the Terra Nova Development on a 'best value' basis, but consistent with the procurement policies and procedures for benefits. The proponents must consider Canadian and, in particular, Newfoundland benefits as one of the factors in the procurement of goods and services, and require contactors and subcontractors to adhere to the development's benefits principles, objectives and commitments. A 7-page glossary is also included
The native perennial New England aster (Symphyotrichum novae-angliae; syn.=Aster novae-anglicae) is ubiquitous throughout most of the United States, as they self-seed and are well-adapted to many environments. New England asters are valued for their prominent dense clusters of purple flowers that at...
Amburgy, Patricia; Soucy, Donald
1989-01-01
Examines the relationship between romantic idealism and vocational goals of art education in nineteenth-century Nova Scotia, Canada. Compares these ideas with those of John Ruskin concerning art and morality. Discusses the views of the Nova Scotian educators relative to issues of contemporary art education. (KO)
The SSS classical nova V5116 Sgr
Sala, G.; Ness, J.; Greiner, J.; Hernanz, M.
2017-10-01
XMM-Newton observed the nova V5116 Sgr during its supersoft phase (SSS). V5116 Sgr showed a decrease of the flux by a factor around 8 during 2/3 of the orbital period. The broad band EPIC spectra remain unchanged during the different flux phases, suggesting an occultation of the central source in a high inclination system. While the global SED does not change significantly, the RGS spectrum is changing between the high and the low flux phases. The non-occultation phase shows a typical white dwarf atmosphere spectrum, dominated by absorption lines. During the low flux periods an extra component of emission lines is superimposed to the soft X-ray continuum. This supports the picture of V5116 Sgr as the clearest example of a system switching between the SSa class of SSS novae, with spectra dominated by absorption lines, and the SSe class, showing an emission lines component. In addition, the simultaneous OM images allow us to find a phase solution for the X-ray light-curve. A thick rim of the accretion disk as the one developed for the SSSs CAL 87, RX J0019.8, and RX J0513.9 could provide a plausible model both for the optical and the X-ray light curve of V5116 Sgr.
A randomized trial of three copper IUDs (MLCu250, MLCu375 and Nova-T).
Bratt, H; Skjeldestad, F E; Cullberg Valentin, K
1988-01-01
A randomized prospective trial of three copper IUDs, Nova-T, MLCu375 and MLCu250, including 200 of each, is presented. Insertion was done at the hospital outpatient clinic on normally menstruating women and on women in puerperio. Follow-up was scheduled after 12, 24 and 36 months. Pregnancy rates were low for all 3 models. Pearl indices after 3 years were 0.5, 0.9 and 0.8 for Nova-T, MLCu375 and MLCu250 respectively (NS). Abnormal bleeding and/or pain was the most frequent termination cause. Minor differences in the termination rates because of abnormal bleeding and/or pain were found and are discussed. The continuation rates based on all medically relevant IUD removals were 74%, 73% and 81% after 3 years for Nova-T, MLCu375 and MLCu250 respectively. No important difference in clinical performance between the three copper IUDs could be demonstrated.
High-energy Emission from Nonrelativistic Radiative Shocks: Application to Gamma-Ray Novae
Vurm, Indrek; Metzger, Brian D.
2018-01-01
The observation of GeV gamma-rays from novae by Fermi/LAT demonstrates that the nonrelativistic radiative shocks in these systems can accelerate particles to energies of at least ∼10 GeV. The low-energy extension of the same nonthermal particle distribution inevitably gives rise to emission in the hard X-ray band. Above ≳ 10 {keV}, this radiation can escape the system without significant absorption/attenuation, and can potentially be detected by NuSTAR. We present theoretical models for hard X-ray and gamma-ray emission from radiative shocks in both leptonic and hadronic scenarios, accounting for the rapid evolution of the downstream properties due to the fast cooling of thermal plasma. We find that due to strong Coulomb losses, only a fraction of {10}-4{--}{10}-3 of the gamma-ray luminosity is radiated in the NuSTAR band; nevertheless, this emission could be detectable simultaneously with the LAT emission in bright gamma-ray novae with a ∼50 ks exposure. The spectral slope in hard X-rays is α ≈ 0 for typical nova parameters, thus serving as a testable prediction of the model. Our work demonstrates how combined hard X-ray and gamma-ray observations can be used to constrain properties of the nova outflow (velocity, density, and mass outflow rate) and particle acceleration at the shock. A very low X-ray to gamma-ray luminosity ratio ({L}{{X}}/{L}γ ≲ 5× {10}-4) would disfavor leptonic models for the gamma-ray emission. Our model can also be applied to other astrophysical environments with radiative shocks, including SNe IIn and colliding winds in massive star binaries.
The ambient air quality accounts for the Nova Scotia Genuine Progress Index
International Nuclear Information System (INIS)
Monette, A.; Colman, R.
2004-01-01
The Nova Scotia Genuine Progress Index (GPI) is a measure of sustainable development which provides a complete and accurate picture of our well-being as a society. The GPI assigns explicit values to environmental quality, population health, livelihood security, equity, free time, and educational attainment. The Nova Scotia GPI includes 22 social, economic and environmental components, including ambient air quality. This report investigates Nova Scotia's ambient air concentrations and emissions of carbon monoxide (CO), total particulate matter (PM), sulphur dioxide (SO 2 ), nitrogen oxides (NOx), and volatile organic compounds (VOC). The costs of damages caused by the these key air pollutants are also examined. Exposure to these pollutants results in negative impacts on human health, damage to materials, agricultural crops and changes in forest productivity. From 1979 to 1996, national ambient concentrations of each of these pollutants decreased significantly. However, the national average concentration of ground-level ozone increased by 34 per cent during the same time period. In Nova Scotia, concentrations of CO, PM and SO 2 have declined dramatically since 1979, but the trends for NO 2 and ground-level ozone do not show significant declines. On a per capita basis, SOx emissions from electric power generation in the province are more than 8 times the Canadian average. The province also had higher per capita emissions of CO, PM, SOx and VOCs than all reporting OECD countries. Electric power generation is the greatest source of fuel combustion emissions in the province, followed by industrial and transportation sources. This report also described some individual actions that can be taken to reduce air pollutant emissions. 174 refs., 37 tabs., 60 figs
NOVA integrated alignment/diagnostic sensors
International Nuclear Information System (INIS)
1978-01-01
Under Contract 3772003 to the Lawrence Livermore Laboratory, Aerojet ElectroSystems Company has investigated a number of alignment system design topics for the NOVA and SHIVA upgrade lasers. Prior reports dealt with the Main Beam Alignment System, and with Multipass Amplifier Alignment Concepts. This report, which completes the contract, examines ways in which the Return Beam Diagnostic (RBD) package and Incident Beam Diagnostic (IBD) packages may be reconfigured to a more integrated package. In particular, the report shows that the RBD optics may be directly integrated in the Pointing Focus and Centering (PFC) sensor, and that the IBD optics may use the same basic common configuration as the PFC/RBD package
Ocean and Coastal Acidification off New England and Nova Scotia
New England coastal and adjacent Nova Scotia shelf waters have a reduced buffering capacity because of significant freshwater input, making the region’s waters potentially more vulnerable to coastal acidification. Nutrient loading and heavy precipitation events further acid...
TV review: Nova scienceNOW - Season 2, Episode 4
Lasser, Josh
2007-01-01
"Sitting down to watch the fourth episode of the second season of Nova ScienceNOW I'm mainly struck by one thought: why have they only put out four epidoses nearly nine months into their second season? The second story is all about CERN and the LHC. (2 pages)
Mechanical construction of the 22 Nova laser
International Nuclear Information System (INIS)
Hurley, C.A.; Frick, F.A.; Patton, H.G.; Bradley, G.; Martos, A.
1983-01-01
The Nova laser system for Inertial Confinement Fusion studies at Lawrence Livermore National Laboratory is under construction and will be completed October 1984 with first operations scheduled for 1985. This system is the largest precision opto-mechanical engineering system ever built. Major engineering and subsystems are mechanical, optical, and electrical power. A series of system technologies include alignment, diagnostics, target, frequency conversion, and controls. This paper will only discuss the mechanical system
Proceedings of Nova Scotia's 2006 energy research and development forum
International Nuclear Information System (INIS)
2006-01-01
The Nova Scotia 2006 energy research and development forum provided a venue for experts from industry, research institutions and government to discuss how research and development will shape the future of energy in the province. The forum was divided into 3 sessions: (1) building knowledge about the marine environment, (2) building knowledge about geoscience, and (3) building knowledge about sustainable energy. A wide ranges of issues related to the Nova Scotia region included whale identification; fisheries mapping; the commercialization of hydrocarbon discoveries; carbon capture and storage and petroleum system analysis and prospect evaluation. Keynote addresses were presented on produced water in Norway; deepwater exploration in Morocco; renewable energy and Canada's role as an energy superpower. The conference featured more than 57 presentations, of which 4 have been catalogued separately for inclusion in this database. refs., tabs., figs
Study of the Quasi-Elastic Scattering in the NOvA Detector Prototype
Energy Technology Data Exchange (ETDEWEB)
Betancourt, Minerba [Univ. of Minnesota, Minneapolis, MN (United States)
2013-06-01
NOvA is a 810 km long base-line neutrino oscillation experiment with two detectors (far 14 KTon and near detector 300 Ton) currently being installed in the NUMI o -axis neutrino beam produced at Fermilab. A 222 Ton prototype NOvA detector (NDOS) was built and operated in the neutrino beam for over a year to understand the response of the detector and its construction. The goal of this thesis is to study the muon neutrino interaction data collected in this test, specifically the identification of quasi-elastic charged-current interactions and measure the behavior of the quasi-elastic muon neutrino cross section.
The Shape of Long Outbursts in U Gem Type Dwarf Novae from AAVSO Data
Cannizzo, John K.
2012-01-01
We search the American Association of Variable Star Observers (AAVSO) archives of the two best studied dwarf novae in an attempt to find light curves for long out bursts that are extremely well-characterized. The systems are U Gem and S8 Cyg. Our goal is to search for embedded precursors such as those that have been found recently in the high fidelity Kepler data for superoutbursts of some members of the 8U UMa subclass of dwarf novae. For the vast majority of AAV80 data, the combination of low data cadence and large errors associated with individual measurements precludes one from making any strong statement about the shape of the long outbursts. However, for a small number of outbursts, extensive long term monitoring with digital photometry yields high fidelity light curves. We report the finding of embedded precursors in two of three candidate long outbursts. This reinforces van Paradijs' finding that long outbursts in dwarf novae above the period gap and superoutbursts in systems below the period gap constitute a unified class. The thermal-tidal instability to account for superoutbursts in the SU UMa stars predicts embedded precursors only for short orbital period dwarf novae, therefore the presence of embedded precursors in long orbital period systems - U Gem and SS Cyg - argues for a more general mechanism to explain long outbursts.
As novas tecnologias da informação e o consumismo em saúde
Directory of Open Access Journals (Sweden)
Paulo Roberto Vasconcellos-Silva
2010-08-01
Full Text Available Uma ampliação dos conceitos de consumo tem se deslocado na direção de processos sociais até agora não contemplados por categorias tradicionais. A presente revisão analisa a aplicação dos conceitos clássicos sobre consumismo às práticas recentemente identificadas no campo da saúde, como o fenômeno da cibercondria. O desafio teórico se refere à dificuldade de extrapolação das perspectivas econômicas do consumismo às questões do auto-cuidado no contexto das tecnologias de informação e comunicação (TICs. Procura-se compreender o fenômeno da mercadorização do cuidar-de-si sob o imperativo da auto-responsabilização em saúde. São identificadas e descritas as novas identidades consumidoras em vista das inauditas questões acerca dos aprimoramentos técnicos a modificar a natureza do auto-cuidado. Conclui-se que a saúde é consumida como vitalidade decomposta em artefatos de comercializar no contexto de uma nova bioeconomia - não mais ligada à idéia de emulação e posse, e sim a novas formas de perceber-se e cuidar-se perante múltiplos riscos e novas definições do que é ser humano.
Scordalakes, Constantine; delRosario, Robert; Shimer, Andrew; Stankiewicz, Russell
2018-01-01
Compare amenorrhea rate, menstrual symptoms, patient satisfaction, and adverse events in women who underwent endometrial ablation with the NovaSure versus the Minerva radiofrequency ablation systems. We surveyed 189 premenopausal women (mean 40.8±6.2 years old) who underwent endometrial ablation for abnormal uterine bleeding using the NovaSure (n=97) or Minerva (n=92) systems, at four private US gynecology clinics, and whose procedure date was after July 2015 with follow-up ≥3 months. Women were surveyed an average of 11.3±3.9 months (range 137-532 days) after ablation. The subject-reported amenorrhea rate was 52% higher in NovaSure subjects than Minerva subjects (64% and 42%, respectively; p =0.004). Age and bleeding cyclicity did not affect amenorrhea rate in either group. Normal-to-no bleeding was reported by >90% of subjects after either treatment. NovaSure was significantly more effective than Minerva at reducing pad/tampon use in women with any residual bleeding (2.4±5.2 items/day versus 4.7±5.5 items/day, p =0.049). NovaSure was significantly more effective than Minerva at reducing premenstrual syndrome (PMS) symptoms ( p =0.019) and menstrual pain ( p =0.003), and more NovaSure subjects (94%) than Minerva subjects (78%) were satisfied with clinical outcomes ( p =0.003). Adverse events did not differ by treatment; three women in each group progressed to hysterectomy. While overall bleeding reduction in premenopausal women with abnormal uterine bleeding was excellent with either endometrial ablation system, NovaSure treatment resulted in a higher patient-reported 1-year amenorrhea rate, and women with residual bleeding used fewer pads and tampons than Minerva-treated women. Additionally, NovaSure subjects reported better menstrual-related life quality and PMS symptom alleviation, and greater satisfaction with outcomes than Minerva-treated women.
Modeling the classical nova outburst. I. Exploring the physics of a new mechanism
International Nuclear Information System (INIS)
Kutter, G.S.; Sparks, W.M.
1989-01-01
Model calculations were performed to describe a mechanism that produces classical nova outbursts on white dwarfs of 1 solar mass or less and for accretion rates of 4 x 10 to the -10th solar mass/yr or greater, i.e., the parameters corresponding to observed data of nova systems. Calculations point to four factors that can induce nuclear runaways of sufficient strength to eject about 0.0001 solar mass at speeds of several hundred to a few thousand km per second, as is observed in classical novae. These are (1) the effects of storage of angular momentum in the star's envelope during the accretion phase; (2) the reduction of centrifugal forces in the star's outer layers during the early nuclear runaway phase, through the inward transport of angular momentum; (3) the inward movement of the zone of peak nuclear burning through the convectively induced shear instability during the runaway phase; and (4) the mixing of original CO stellar matter and H-rich matter, also through the convectively induced shear instability. 58 refs
Nova Mus 2018 (PNV J11261220-6531086) Is Forming Dust
Walter, Frederick M.
2018-02-01
Nova Mus 2018 (PNV J11261220-6531086) was discovered by R Kaufman on 2018 Jan 14.486, and reported by P. Schmeer in vsnet-alert 21772. The first detection was 2018 Jan 3.24 (ASAS-SN, reported in the TOCP).
NOvA Short-Baseline Tau Neutrino Appearance Search
Energy Technology Data Exchange (ETDEWEB)
Keloth, Rijeesh [Cochin U.; Aurisano, Adam [Cincinnati U.; Sousa, Alexander [Cincinnati U.; Davies, Gavin S [Indiana U.; Suter, Louise [Fermilab; Plunkett, Robert K [Fermilab
2017-10-01
Standard three-flavor neutrino oscillations have well explained by a wide range of neutrino experiments. However, the anomalous results, such as electron-antineutrino excess seen by LSND and MiniBooNE do not fit the three-flavor paradigm. This can be explained by an additional fourth flavor sterile neutrino at a larger scale than the existing three flavor neutrinos. The NOvA experiment consists of two finely segmented, liquid scintillator detectors operating 14 .6 mrad off-axis from the NuMI muon-neutrino beam. The Near Detector is located on the Fermilab campus, 1 km from the NuMI target, while the Far Detector is located at Ash River, MN, 810 km from the NuMI target. The NOvA experiment is primarily designed to measure electron-neutrino appearance at the Far Detector using the Near Detector to control systematic uncertainties; however, the Near Detector is well suited for searching for anomalous short-baseline oscillations. This poster will present a novel method for selecting tau neutrino interactions with high purity at the Near Detector using a convolutional neural network. Using this method, the sensitivity to anomalous short-baseline tau-neutrino appearance due to sterile neutrino oscillations will be presented.
Dramatic change of the recurrence time and outburst parameters of the intermediate polar GK Persei
Šimon, V.
2002-02-01
This analysis has shown that the intermediate polar GK Per experienced a very striking evolution. Its outbursts became wider and brighter in the last five decades. These changes were accompanied by striking variations of the recurrence time T_C, from 385 days within the years 1948-1967 to 890 days in 1970. Nowadays, T_C displays a strong trend of linear increase. Decrease of irradiation of the disk by the WD, combined with the decrease of viscosity, offers a plausible explanation. It is argued that variations of the mass transfer rate are unlikely to play a major role. The morphology of the outburst light curves in the optical and the X-ray region is also studied. The decay branch in the optical remains remarkably similar for all the events while the largest changes of the light curve occur in the rising branch. This can be explained if the thermal instability may start at different distances from the disk center. The quiescent level of brightness does not display any secular trend in recent decades but a wave on the time scale of about 30 years with the full amplitude of 0.3 m_v, probably due to activity of the cool star, is detected. This research has made use of the AFOEV database, operated at CDS, France, and the observations provided by the ASM/RXTE team.
Can households earning minimum wage in Nova Scotia afford a nutritious diet?
Williams, Patricia L; Johnson, Christine P; Kratzmann, Meredith L V; Johnson, C Shanthi Jacob; Anderson, Barbara J; Chenhall, Cathy
2006-01-01
To assess the affordability of a nutritious diet for households earning minimum wage in Nova Scotia. Food costing data were collected in 43 randomly selected grocery stores throughout NS in 2002 using the National Nutritious Food Basket (NNFB). To estimate the affordability of a nutritious diet for households earning minimum wage, average monthly costs for essential expenses were subtracted from overall income to see if enough money remained for the cost of the NNFB. This was calculated for three types of household: 1) two parents and two children; 2) lone parent and two children; and 3) single male. Calculations were also made for the proposed 2006 minimum wage increase with expenses adjusted using the Consumer Price Index (CPI). The monthly cost of the NNFB priced in 2002 for the three types of household was 572.90 dollars, 351.68 dollars, and 198.73 dollars, respectively. Put into the context of basic living, these data showed that Nova Scotians relying on minimum wage could not afford to purchase a nutritious diet and meet their basic needs, placing their health at risk. These basic expenses do not include other routine costs, such as personal hygiene products, household and laundry cleaners, and prescriptions and costs associated with physical activity, education or savings for unexpected expenses. People working at minimum wage in Nova Scotia have not had adequate income to meet basic needs, including a nutritious diet. The 2006 increase in minimum wage to 7.15 dollars/hr is inadequate to ensure that Nova Scotians working at minimum wage are able to meet these basic needs. Wage increases and supplements, along with supports for expenses such as childcare and transportation, are indicated to address this public health problem.
TV photometry of the Nova Cygni 1975 (V1500 Cyg)
International Nuclear Information System (INIS)
Pavlenko, E.P.
1983-01-01
About 1800 TV pictures of Nova Cygni 1975 during 60 hours were obtained in 1979-1980 at the Crimean Astrophysical observatory. The observations were carried out in V and sometimes - similtaneously in B and V colour systems. The period of brightness Variations 0sUp(d).279226 remains constant after it has stabilized in 1978, but the amplitude and mean brightness of the individual light curves change from cycle to cycle. The mean light curves are asymmetrical. The depth of primary and secondary minima is sporadically increasing from year to year and reached 1sup(m).2 in 1980. The mean curves obtained in V system in 1980 and in continuum in 1976-1977 are similar. It is supposed that 6,7-hour varia. tions of brightness appear as a resUlt of partial eclipses in close binary system Nova Cygni with orbit inclination i=60 deg
Suzaku Observation of the Dwarf Nova V893 Scorpii: The Discovery of a Partial X-Ray Eclipse
Mukai, Koji; Zietsman, E.; Still, M.
2008-01-01
V893 Sco is an eclipsing dwarf nova that had attracted little attention from X-ray astronomers until it was proposed as the identification of an RXTE all-sky slew survey (XSS) source. Here we report on the po inted X-ray observations of this object using Suzaku. We confirm V893 Sco to be X-ray bright, whose spectrum is highly absorbed for a dwar f nova. We have also discovered a partial X-ray eclipse in V893 Sco. This is the first time that a partial eclipse is seen in Xray light c urves of a dwarf nova. We have successfully modeled the gross features of the optical and X-ray eclipse light curves using a boundary layer geometry of the X-ray emission region. Future observations may lead to confirmation of this basic picture, and allow us to place tight co nstraints on the size of the X-ray emission region. The partial X-ray eclipse therefore should make V893 Sco a key object in understanding the physics of accretion in quiescent dwarf nova.
Directory of Open Access Journals (Sweden)
Belén Picatoste
Full Text Available BACKGROUND: Myocardial fibrosis is a key process in diabetic cardiomyopathy. However, their underlying mechanisms have not been elucidated, leading to a lack of therapy. The glucagon-like peptide-1 (GLP-1 enhancer, sitagliptin, reduces hyperglycemia but may also trigger direct effects on the heart. METHODS: Goto-Kakizaki (GK rats developed type-II diabetes and received sitagliptin, an anti-hyperglycemic drug (metformin or vehicle (n=10, each. After cardiac structure and function assessment, plasma and left ventricles were isolated for biochemical studies. Cultured cardiomyocytes and fibroblasts were used for in vitro assays. RESULTS: Untreated GK rats exhibited hyperglycemia, hyperlipidemia, plasma GLP-1 decrease, and cardiac cell-death, hypertrophy, fibrosis and prolonged deceleration time. Moreover, cardiac pro-apoptotic/necrotic, hypertrophic and fibrotic factors were up-regulated. Importantly, both sitagliptin and metformin lessened all these parameters. In cultured cardiomyocytes and cardiac fibroblasts, high-concentration of palmitate or glucose induced cell-death, hypertrophy and fibrosis. Interestingly, GLP-1 and its insulinotropic-inactive metabolite, GLP-1(9-36, alleviated these responses. In addition, despite a specific GLP-1 receptor was only detected in cardiomyocytes, GLP-1 isoforms attenuated the pro-fibrotic expression in cardiomyocytes and fibroblasts. In addition, GLP-1 receptor signalling may be linked to PPARδ activation, and metformin may also exhibit anti-apoptotic/necrotic and anti-fibrotic direct effects in cardiac cells. CONCLUSIONS: Sitagliptin, via GLP-1 stabilization, promoted cardioprotection in type-II diabetic hearts primarily by limiting hyperglycemia e hyperlipidemia. However, GLP-1 and GLP-1(9-36 promoted survival and anti-hypertrophic/fibrotic effects on cultured cardiac cells, suggesting cell-autonomous cardioprotective actions.
Tracking Detector Performance and Data Quality in the NOvA Experiment
Energy Technology Data Exchange (ETDEWEB)
Behera, Biswaranjan [Fermilab
2017-10-10
NOvA is a long-baseline neutrino oscillation experiment. It uses the NuMI beam from Fermilab and two sampling calorimeter detectors located off-axis from the beam. The NOvA experiment measures the rate of electron-neutrino appearance in the almost pure muon-neutrino NuMI beam, with the data measured at the Near Detector being used to accurately determine the expected rate at the Far Detector. It is very important to have automated and accurate monitoring of the data recorded by the detectors so any hardware, DAQ or beam issues arising in the 344k (20k) channels of the Far (Near) detector which could affect the quality of the data taking are determined. This paper will cover the techniques and detector monitoring systems in various stages of data taking.
Hydrodynamic instability experiments on the Nova laser
International Nuclear Information System (INIS)
Remington, B.A.; Glendinning, S.G.; Kalantar, D.H.
1996-08-01
Hydrodynamic instabilities in compressible plasmas play a critical role in the fields of inertial confinement fusion (ICF), astrophysics, and high energy-density physics. We are, investigating hydrodynamic instabilities such as the Rayleigh-Taylor (RT) instability, at high compression at the Nova laser in a series of experiments, both in planar and in spherical geometry. In the indirect drive approach, a thermal x-ray drive is generated by focusing the Nova laser beams into a Au cylindrical radiation cavity (hohlraum). Issues in the instability evolution that we are examining are shock propagation and foil compression, RT growth of 2D versus 3D single-mode perturbations, drive pulse shape, perturbation location at the ablation front versus at an embedded interface, and multimode perturbation growth and nonlinear saturation. The effects of convergence on RT growth are being investigated both with hemispherical implosions of packages mounted on the hohlraum wall and with spherical implosions of capsules at the center of the hohlraum. Single-mode perturbations are pre-imposed at the ablation front of these capsules as a seed for the RT growth. In our direct drive experiments, we are investigating the effect of laser imprinting and subsequent RT growth on planar foils, both at λ Laser = 1/3 μm and 1/2 μm. An overview is given describing recent progress in each of these areas
The January 2015 outburst of a red nova in M31
Czech Academy of Sciences Publication Activity Database
Kurtenkov, A.A.; Pessev, P.; Tomov, T.; Barsukova, E.A.; Fabrika, S.; Vida, K.; Hornoch, Kamil; Ovcharov, E.P.; Goranskij, V.P.; Valeev, A.F.; Molnár, L.; Sárneczky, K.; Kostov, A.; Nedialkov, P.; Valenti, S.; Geier, S.; Wiersema, K.; Henze, M.; Shafter, A.W.; Dimitrova, R.V.M.; Popov, V.N.; Stritzinger, M.
2015-01-01
Roč. 578, June (2015), L10/1-L10/5 ISSN 0004-6361 Institutional support: RVO:67985815 Keywords : novae * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
Recent Evolution of the Offline Computing Model of the NOvA Experiment
Habig, Alec; Norman, A.
2015-12-01
The NOvA experiment at Fermilab is a long-baseline neutrino experiment designed to study νe appearance in a νμ beam. Over the last few years there has been intense work to streamline the computing infrastructure in preparation for data, which started to flow in from the far detector in Fall 2013. Major accomplishments for this effort include migration to the use of off-site resources through the use of the Open Science Grid and upgrading the file-handling framework from simple disk storage to a tiered system using a comprehensive data management and delivery system to find and access files on either disk or tape storage. NOvA has already produced more than 6.5 million files and more than 1 PB of raw data and Monte Carlo simulation files which are managed under this model. The current system has demonstrated sustained rates of up to 1 TB/hour of file transfer by the data handling system. NOvA pioneered the use of new tools and this paved the way for their use by other Intensity Frontier experiments at Fermilab. Most importantly, the new framework places the experiment's infrastructure on a firm foundation, and is ready to produce the files needed for first physics.
Recent Evolution of the Offline Computing Model of the NOvA Experiment
International Nuclear Information System (INIS)
Habig, Alec; Group, Craig; Norman, A.
2015-01-01
The NOvA experiment at Fermilab is a long-baseline neutrino experiment designed to study νe appearance in a ν μ beam. Over the last few years there has been intense work to streamline the computing infrastructure in preparation for data, which started to flow in from the far detector in Fall 2013. Major accomplishments for this effort include migration to the use of off-site resources through the use of the Open Science Grid and upgrading the file-handling framework from simple disk storage to a tiered system using a comprehensive data management and delivery system to find and access files on either disk or tape storage. NOvA has already produced more than 6.5 million files and more than 1 PB of raw data and Monte Carlo simulation files which are managed under this model. The current system has demonstrated sustained rates of up to 1 TB/hour of file transfer by the data handling system. NOvA pioneered the use of new tools and this paved the way for their use by other Intensity Frontier experiments at Fermilab. Most importantly, the new framework places the experiment's infrastructure on a firm foundation, and is ready to produce the files needed for first physics. (paper)
Progress of the Charged Pion Semi-Inclusive Neutrino Charged Current Cross Section in NOvA
Energy Technology Data Exchange (ETDEWEB)
Tsaris, Aristeidis [Fermilab
2017-10-09
The NOvA experiment is a long-baseline neutrino oscillation experiment designed to measure the rates of electron neutrino appearance and muon neutrino disappearance. The NOvA near detector is located at Fermilab, 800 m from the primary target and provides an excellent platform to measure and study neutrino-nucleus interactions. We present the status of the measurement of the double differential cross section with respect to muon kinematics for interactions involving charged pions in the final state, $\
Sterile Neutrino Search in the NOvA Far Detector
Energy Technology Data Exchange (ETDEWEB)
Edayath, Sijith [Cochin U.; Aurisano, Adam [Cincinnati U.; Sousa, Alexandre [Cincinnati U.; Davies, Gavin [Indiana U.; Suter, Louise [Fermilab; Yang, Shaokai [Cincinnati U.
2017-10-03
The majority of neutrino oscillation experiments have obtained evidence for neutrino oscillations that are compatible with the three-flavor model. Explaining anomalous results from short-baseline experiments, such as LSND and MiniBooNE, in terms of neutrino oscillations requires the existence of sterile neutrinos. The search for sterile neutrino mixing conducted in NOvA uses a long baseline of 810 km between Near Detector (ND) at Fermilab and Far Detector (FD) in Minnesota. The signal for sterile neutrino oscillations is a deficit of neutral-current neutrino interactions at the FD with respect to the ND prediction. In this document, We will present the analysis improvements that we are implementing for future NC sterile neutrino searches with NOvA. These include: improved modelling of our detector response; the inclusion of NC 2p2h interaction modelling; implementing a better energy reconstruction techniques; and including possible oscillation due to sterile neutrinos in the ND . This improvements enable us to do a simultaneous ND-FD shape fit of the NC energy spectrum covering a wider sterile mass range than previous analyses.
Broadband and short (10-ps) pulse generation on Nova
International Nuclear Information System (INIS)
Perry, M.D.; Browning, D.; Bibeau, C.; Patterson, F.G.; Wilcox, R.; Henesian, M.
1990-01-01
The ability to produce high power broadband pulses for purposes of focal spot beam smoothing has recently become an important issue in inertial confinement fusion (ICF). As the first step toward the generation and propagation of such pulses on Nova, the authors have performed a series of experiments with 10-ps pulses. Aside from the inherently broad bandwidth, these short pulses have important applications in ICF experiments and x-ray laser research. The author's experimental results are discussed. The short pulses were produced by diffraction grating pulse compression of chirped pulses formed from self-phase modulation in a single-mode 10-m fused silica fiber. Use of such a short fiber produces a nonlinearly chirped spectrum of 0.74 nm. The central nearly linearly chirped 0.26 nm is selected by polarization discrimination and compressed using 1800-line/mm diffraction gratings to a nearly Gaussian pulse of 10 ps FWHM with an energy contrast ratio of 20:1. This 1-nJ pulse is injected into a Nova amplifier chain with selected amplifiers unfired
Guerra do Golfo: a crise da nova ordem mundial
Directory of Open Access Journals (Sweden)
Virgílio Caixeta Arraes
2004-06-01
Full Text Available Este artigo, tomando como ponto de partida as Guerras do Golfo, traça o perfil da nova ordem mundial formada com a derrocada da União Soviética e o fim da Guerra Fria, e a ascensão dos Estados Unidos como única superpotência no século XXI. O autor também afirma que a nova ordem mundial, proclamada com vistas à promoção permanente do desenvolvimento e da paz, residiria no binômio político-econômico da democracia neoliberal.This article, taking as a starting point the Gulf Wars, traces the profile of the new world order that took shape with the end of Cold War and the Soviet Union, and the raise of the United States as the major power in the 21st century. The author also affirms that the new world order, proclaimed in order to promote permanent development and peace, combines the economic-politic binomial of the neo-liberal democracy.
Evaluation of the Nova StatSensor® XpressTM Creatinine Point-Of-Care Handheld Analyzer
Kosack, Cara Simone; de Kieviet, Wim; Bayrak, Kubra; Milovic, Anastacija; Page, Anne Laure
2015-01-01
Creatinine is a parameter that is required to monitor renal function and is important to follow in patients under treatment with potentially toxic renal drugs, such as the anti-HIV drug Tenofovir. A point of care instrument to measure creatinine would be useful for patients monitoring in resource-limited settings, where more instruments that are sophisticated are not available. The StatSensor Xpress Creatinine (Nova Biomedical Cooperation, Waltham, MA, USA) point of care analyzer was evaluated for its diagnostic performance in indicating drug therapy change. Creatinine was measured in parallel using the Nova StatSensor Xpress Creatinine analyzer and the Vitros 5,1FS (Ortho Clinical Diagnostics, Inc, Rochester, USA), which served as reference standard. The precision (i.e., repeatability and reproducibility) and accuracy of the StatSensor Xpress Creatinine analyzer were calculated using a panel of specimens with normal, low pathological and high pathological values. Two different Nova StatSensor Xpress Creatinine analyzers were used for the assessment of accuracy using repeated measurements. The coefficient of variation of the StatSensor Xpress Creatinine analyzers ranged from 2.3 to 5.9% for repeatability and from 4.2 to 9.0% for between-run reproducibility. The concordance correlation agreement was good except for high values (>600 µmol/L). The Bland-Altman analysis in high pathological specimens suggests that the Nova StatSensor Xpress Creatinine test tends to underestimate high creatinine values (i.e., >600 µmol/L). The Nova StatSensor Xpress Creatinine analyzers showed acceptable to good results in terms of repeatability, inter-device reproducibility and between-run reproducibility over time using quality control reagents. The analyzer was found sufficiently accurate for detecting pathological values in patients (age >10 year) and can be used with a moderate risk of misclassification. PMID:25886375
Evaluation of the Nova StatSensor® Xpress(TM) Creatinine point-of-care handheld analyzer.
Kosack, Cara Simone; de Kieviet, Wim; Bayrak, Kubra; Milovic, Anastacija; Page, Anne Laure
2015-01-01
Creatinine is a parameter that is required to monitor renal function and is important to follow in patients under treatment with potentially toxic renal drugs, such as the anti-HIV drug Tenofovir. A point of care instrument to measure creatinine would be useful for patients monitoring in resource-limited settings, where more instruments that are sophisticated are not available. The StatSensor Xpress Creatinine (Nova Biomedical Cooperation, Waltham, MA, USA) point of care analyzer was evaluated for its diagnostic performance in indicating drug therapy change. Creatinine was measured in parallel using the Nova StatSensor Xpress Creatinine analyzer and the Vitros 5,1FS (Ortho Clinical Diagnostics, Inc, Rochester, USA), which served as reference standard. The precision (i.e., repeatability and reproducibility) and accuracy of the StatSensor Xpress Creatinine analyzer were calculated using a panel of specimens with normal, low pathological and high pathological values. Two different Nova StatSensor Xpress Creatinine analyzers were used for the assessment of accuracy using repeated measurements. The coefficient of variation of the StatSensor Xpress Creatinine analyzers ranged from 2.3 to 5.9% for repeatability and from 4.2 to 9.0% for between-run reproducibility. The concordance correlation agreement was good except for high values (>600 µmol/L). The Bland-Altman analysis in high pathological specimens suggests that the Nova StatSensor Xpress Creatinine test tends to underestimate high creatinine values (i.e., >600 µmol/L). The Nova StatSensor Xpress Creatinine analyzers showed acceptable to good results in terms of repeatability, inter-device reproducibility and between-run reproducibility over time using quality control reagents. The analyzer was found sufficiently accurate for detecting pathological values in patients (age >10 year) and can be used with a moderate risk of misclassification.
Observation of Electron Neutrino Appearance in the NuMI Beam with the NOvA Experiment
Energy Technology Data Exchange (ETDEWEB)
Niner, Evan David [Indiana Univ., Bloomington, IN (United States)
2015-01-01
NOvA is a long-baseline neutrino oscillation experiment that uses two functionally identical detectors separated by 810 kilometers at locations 14 milliradians off-axis from the NuMI muon neutrino beam at Fermilab. At these locations the beam energy peaks at 2 GeV. This baseline is the longest in the world for an accelerator-based neutrino oscillation experiment, which enhances the sensitivity to the neutrino mass ordering. The experiment studies oscillations of the muon neutrino and anti-neutrino beam that is produced. Both detectors completed commissioning in the summer of 2014 and continue to collect data. One of the primary physics goals of the experiment is the measurement of electron neutrino appearance in the muon neutrino beam which yields measurements of the oscillation parameters sin22θ13, δ , and the neutrino mass ordering within the standard model of neutrino oscillations. This thesis presents the analysis of data collected between February 2014 and May 2015, corresponding to 3.52 X 1020 protons-on-target. In this first analysis NOvA recorded 6 electron neutrino candidates, which is a 3.3σ observation of electron neutrino appearance. The T2K experiment performs the same measurement on a baseline of 295 kilometers and has a 1 σ preference for the normal mass ordering over the inverted ordering over the phase space of the CP violating parameter δ, which is also weakly seen in the NOvA result. By the summer of 2016 NOvA will triple its statistics due to increased beam power and a completed detector. If electron neutrinos continue to be observed at the current rate NOvA will be able to establish a mass ordering preference at a similar confidence level to T2K.
Figueira, Joana; José, Jordi; García-Berro, Enrique; Campbell, Simon W.; García-Senz, Domingo; Mohamed, Shazrene
2018-05-01
Context. Classical novae are thermonuclear explosions hosted by accreting white dwarfs in stellar binary systems. Material piles up on top of the white dwarf star under mildly degenerate conditions, driving a thermonuclear runaway. The energy released by the suite of nuclear processes operating at the envelope, mostly proton-capture reactions and β+-decays, heats the material up to peak temperatures ranging from 100 to 400 MK. In these events, about 10-3-10-7 M⊙, enriched in CNO and, sometimes, other intermediate-mass elements (e.g., Ne, Na, Mg, and Al) are ejected into the interstellar medium. Aims: To date, most of the efforts undertaken in the modeling of classical nova outbursts have focused on the early stages of the explosion and ejection, ignoring the interaction of the ejecta, first with the accretion disk orbiting the white dwarf and ultimately with the secondary star. Methods: A suite of 3D, smoothed-particle hydrodynamics (SPH) simulations of the interaction between the nova ejecta, accretion disk, and stellar companion were performed to fill this gap; these simulations were aimed at testing the influence of the model parameters—that is, the mass and velocity of the ejecta, mass and the geometry of the accretion disk—on the dynamical and chemical properties of the system. Results: We discuss the conditions that lead to the disruption of the accretion disk and to mass loss from the binary system. In addition, we discuss the likelihood of chemical contamination of the stellar secondary induced by the impact with the nova ejecta and its potential effect on the next nova cycle. Movies showing the full evolution of several models are available online at http://https://www.aanda.org and at http://www.fen.upc.edu/users/jjose/Downloads.html
Melostelis gen. nov., espécies novas e notas complementares sobre Anthidiini (Hymenoptera, Apidae
Directory of Open Access Journals (Sweden)
Danúncia Urban
2011-06-01
Full Text Available Melostelis gen. nov., espécies novas e notas complementares sobre Anthidiini (Hymenoptera, Apidae. Melostelis gen. nov. é proposto para um novo Anthidiini cleptoparasita. São descritas e ilustradas duas espécies novas: Melostelis amazonensis sp. nov. de Manaus, Amazonas e Larocanthidium chacoense sp. nov. de Porto Murtinho, Mato Grosso do Sul. São dados a conhecer os machos de Epanthidium bolivianum Urban, 1995 e Epanthidium araranguense Urban, 2006 e, registrados pela primeira vez no Brasil, na sub-região do chaco, Ketianthidium zanolae Urban, 2000 e Epanthidium bolivianum.
Nova isolates noise to quieten stations
International Nuclear Information System (INIS)
Milner, G.J.; Frank, L.D.
1993-01-01
This paper reviews a technique developed by Nova Corp., to help isolate and measure the acoustic power of individual components in a pipeline compressor and pumping station. The procedure calculates the sound pressure levels of each piece of equipment independently. Based on these measurements, a prediction can be made of the effect of various types of noise treatment techniques on the overall sound levels currently generated or proposed in a future project. This paper describes the equipment to measure the sound levels, techniques for actually measuring the compressor station or equipment area, and techniques used to generate a remediation plan
GRB 080503 LATE AFTERGLOW RE-BRIGHTENING: SIGNATURE OF A MAGNETAR-POWERED MERGER-NOVA
International Nuclear Information System (INIS)
Gao, He; Ding, Xuan; Wu, Xue-Feng; Dai, Zi-Gao; Zhang, Bing
2015-01-01
GRB 080503 is a short gamma-ray burst (GRB) detected by Swift and has been classified as a GRB originating from a compact star merger. The soft extended emission and the simultaneous late re-brightening in both the X-ray and optical afterglow light curves raise interesting questions regarding its physical origin. We show that the broadband data of GRB 080503 can be well explained within the framework of the double neutron star merger model, provided that the merger remnant is a rapidly rotating massive neutron star with an extremely high magnetic field (i.e., a millisecond magnetar). We show that the late optical re-brightening is consistent with the emission from a magnetar-powered “merger-nova.” This adds one more case to the growing sample of merger-novae associated with short GRBs. The soft extended emission and the late X-ray excess emission are well connected through a magnetar dipole spin-down luminosity evolution function, suggesting that direct magnetic dissipation is the mechanism to produce these X-rays. The X-ray emission initially leaks from a hole in the merger ejecta pierced by the short GRB jet. The hole subsequently closes after the magnetar spins down and the magnetic pressure drops below ram pressure. The X-ray photons are then trapped behind the merger-nova ejecta until the ejecta becomes optically thin at a later time. This explains the essentially simultaneous re-brightening in both the optical and X-ray light curves. Within this model, future gravitational-wave sources could be associated with a bright X-ray counterpart along with the merger-nova, even if the short GRB jet beams away from Earth
Directory of Open Access Journals (Sweden)
BITO, Nelson Satio
2006-05-01
Full Text Available RESUMOO Protocolo de Quioto, firmado em dezembro de 1997, é um instrumento importante na diminuição das emissões de gases de efeito estufa e na busca de desenvolvimento sustentável. Os países desenvolvidos que aderiram ao Protocolo assumiram o compromisso de reduzir suas emissões de gases em 5,2% (base 1.990 no período de 2.008 a 2.012. Das três modalidades para a diminuição do custo dos investimentos na redução dos gases, este artigo tem por objeto o estudo do Crédito Carbono previsto no Mecanismo de Desenvolvimento Limpo - MDL, voltado para países em desenvolvimento no trato das questões ambientais através do qual são implementados projetos que trazem resultados positivos. O objetivo deste artigo é estudar o Projeto NovaGerar desenvolvido em Nova Iguaçu – RJ, procurando investigar se o incentivo do Crédito Carbono, previsto no MDL, contribuiu para sua viabilidade econômica e, conseqüentemente, reduziu impactos ambientais por meio de reduções de gases do efeito estufa. A análise dos dados demonstrou que o projeto não se mostrou viável, quando enfocou somente a geração de energia elétrica. Agregando-se o Crédito de Carbono, mostrou-se atrativo com a expressiva taxa interna de retorno de 36,19% ao ano.ABSTRACT The Kyoto Protocol, signed on December 1977, is an important instrument for reducing greenhouse gas emissions and for pursuing sustainable development. The developed countries that adhered to the Protocol committed themselves to reduce their gas emissions by 5.2% (data-base 1990 during the 2008-2012 period. Of the three modalities for diminishing gas reduction investment costs, this article aims at studying the Carbon Credit instrument foreseen in the Clean Development Mechanism – CDM, which has been designed for handling environmental issues by developing countries, whereby projects that bring positive results are implemented. The purpose of this article is to study the NovaGerar Project developed in
UBVRH/sub. cap alpha. /-photometry and polarimetry of the Nova Cygni 1975= the V 1500 Cyg
Energy Technology Data Exchange (ETDEWEB)
Kiselev, N N; Narizhnaya, N V
1977-01-01
The results of photometric and polarimetric observations of the Nova Cygni 1975 performed at the Gissarskaya Astronomical Observatory from 30.8.75 to 1.2.76 are given. Some outburst development peculiarities are discussed. Some parameters of the Nova Cygni are estimated: absolute magnitude at maximum brightness Msub(max)=-9.sup(m)7; distance r=1.2 kpc; the photospheric radius at maximum brightness of 390 Sun radii.
Precision operation of the Nova laser for fusion experiments
International Nuclear Information System (INIS)
Caird, J.A.; Ehrlich, R.B.; Hermes, G.L.; Landen, O.L.; Laumann, C.W.; Lerche, R.A.; Miller, J.L.; Murray, J.E.; Nielsen, N.D.; Powell, H.T.; Rushford, M.C.; Saunders, R.L.; Thompson, C.E.; VanArsdall, P.J.; Vann, C.S.; Weiland, T.L.
1994-01-01
The operation of a Neodymium glass laser of a special design for fusion experiments is improved by a better pulse synchronization, the gain stabilization, and the laser diagnostics. We used sensor upgrading and antifriction coating of focusing lenses. The pointing accuracy of the Nova laser meets now our goal for precision operation. (AIP) copyright 1994 American Institute of Physics
A remarkable recurrent nova in M 31: The optical observations
Czech Academy of Sciences Publication Activity Database
Darnley, M.J.; Williams, S.C.; Bode, M.F.; Henze, M.; Ness, J.-U.; Shafter, A.W.; Hornoch, Kamil; Votruba, Viktor
2014-01-01
Roč. 563, March (2014), L9/1-L9/4 ISSN 0004-6361 R&D Projects: GA MŠk LG12001 Institutional support: RVO:67985815 Keywords : galaxies: individual: M 31 * novae * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
REESTRUTURAÇÃO URBANA E CRIAÇÃO DE NOVAS CENTRALIDADES: considerações sobre os Shopping Centers
Directory of Open Access Journals (Sweden)
Lidiane Aparecida Alves
2011-04-01
Full Text Available O espaço urbano, entendido enquanto a condição, meio e produto das ações realizadas pela sociedade ao longo do tempo, apresenta-se em constante reestruturação, segundo as imposições do modo capitalista de produção, que passa por modificações, a fim de assegurar a reprodução do capital. Como resultado do processo de reestruturação produtiva tem-se reestruturação urbana, consubstanciada nas novas centralidades, a exemplo dos Shopping Centers. Essas novas centralidades criam novas dinâmicas econômicas e espaciais (redefinindo as funções em seu entorno e da área central. Diante da relevância dessa temática, através deste estudo busca tecer considerações sobre os Shopping Centers, vistos enquanto resultado das modificações no processo produtivo, cujos reflexos são diretamente sentidos na dinâmica urbana, no âmbito do processo de reestruturação urbana, a partir da criação de novas centralidades. Espera-se a partir das discussões realizadas, contribuir com os estudos de geografia urbana, especificamente com aqueles referentes ao processo de reestruturação urbana, e surgimento de novas centralidades.
High Energy Emission of Symbiotic Recurrent Novae: RS Oph and V407 Cyg
Directory of Open Access Journals (Sweden)
Hernanz M.
2012-06-01
Full Text Available Recurrent novae occurring in symbiotic binaries are candidate sources of high energy photons, reaching GeV energies. Such emission is a consequence of particle acceleration leading to pion production. the shock between matter ejected by the white dwarf, undergoing a nova explosion, and the wind from the red giant companion are responsible for such a process, which mimics a supernova remnant but with much smaller energetic output and much shorter time scales. Inverse Compton can also be responsible for high energy emission. Recent examples are V407 Cyg, detected by Fermi, and RS Oph, which unfortunately exploded in 2006, before Fermi was launched.
Time-scale for turn-off of a nova after the outburst
International Nuclear Information System (INIS)
Starrfield, S.
1979-01-01
Theoretical and observational evidence is reviewed for the remnant from a nova outburst. Its evolution to burnout is described. Finally, the various physical mechanisms which can lead to an extended period of mass loss are discussed. 19 references
Discussão de um sistema de custeio adaptado as exigências da nova competição global
Tania Henke Kraemer
1995-01-01
Atualmente, uma empresa deve ter sua atenção voltada não somente ao mercado brasileiro, mas também ao mercado internacional. Esta nova forma de postura, denominada “A Nova Competição Global”, vem forçando os empresários à aprimorarem, continuamente, seus processos produtivos. Nesse sentido, as novas formas de organização da produção estão revolucionando o gerenciamento das empresas. Informações geradas por relatórios econômico-financeiros são consideradas como uma das melhores formas de mediç...
On the of classification of BL Her subtype of the Type II Cepheids
Directory of Open Access Journals (Sweden)
Jurkovic Monika I.
2015-01-01
Full Text Available The initial reason for studying Type II Cepheids (CWB was for period changes, binarity or any other signs of change other than the pulsation. The GCVS contained 71 objects of this kind in 2012 when the wok started, and that list is now extended to 100 CWB and 26 CWB: objects. The photometric data for the 71 objects was collected from ASAS, AAVSO, CATALINA, LINEAR, SuperWASP, NSVS surveys. Surprisingly, there is a discrepancy in the classification of the stars in this list. A large percentage of these objects might not be not Type II Cepheids, some of them are classical Cepheids, RR Lyrae, some eclipsing binaries, there is even a dwarf novae.
SALT confirmation of PNV J17244011-2421463 as a classical nova
Aydi, E.; Buckley, D. A. H.; Mohamed, S.; Whitelock, P. A.
2018-02-01
We report on high-resolution spectroscopy of PNV J17244011-2421463 which was reported as a possible nova by T. Kojima, Gunma-ken, Japan (CBAT follow-up: http://www.cbat.eps.harvard.edu/unconf/followups/J17244011-2421463.html).
Composite polymer/glass edge claddings for new Nova laser disks
International Nuclear Information System (INIS)
Powell, H.T.; Campbell, J.H.; Edwards, G.
1987-01-01
Large Nd:glass laser disks like those used in Nova require an edge cladding which absorbs at 1 μm. This cladding prevents Fresnel reflections from the edges from causing parasitic oscillations which would otherwise reduce the gain. The original Nova disks had a Cu/sup 2+/-doped phosphate glass cladding which was cast at high temperature around the circumference of the disk. Although the performance of this cladding is excellent, it was expensive to produce. Consequently, in parallel with their efforts to develop Pt inclusion-free laser glass, the authors developed a composite polymer/glass edge cladding that can be applied at greatly reduced cost. Laser disks constructed with the new cladding design show identical performance to the previous Nova disks and have been tested for hundreds of shots without degradation. The new cladding consists of absorbing glass strips which are bonded to the edges of polygonal-rather that elliptical-shaped disks. The bond is made by an --25-μm thick clear epoxy adhesive whose index of refraction matches both the laser and absorbing glass. By blending aromatic and aliphatic epoxy constituents, they achieved an index-of-refraction match within approximately +-0.003 between the epoxy and glass. The epoxy was also chosen based on its damage resistance to flashlamp light and its adhesive strength to glass. The present cladding is a major improvement over a previous experimental cladding utilizing silicone rubber as a coupling agent. Early prototypes constructed without using the presented techniques exhibited failures from both mechanisms. Delamination failures occurred which clearly showed both surface and bulk-mode parasitic oscillation. Requirements on the polymer, disk size, and Nd doping to prevent these problems are presented
International Nuclear Information System (INIS)
Calliger, R.J.; Suski, G.J.
1981-01-01
Nova is a 200 terawatt, 10-beam High Energy Glass Laser currently under construction at LLNL. This facility, designed to demonstrate the feasibility of laser driven inertial confinement fusion, contains over 5000 elements requiring coordinated control, data acquisition, and analysis functions. The large amounts of data that will be generated must be maintained over the life of the facility. Often the most useful but inaccessible data is that related to time dependent events associated with, for example, operator actions or experiment activity. We have developed an Event Logging System to synchronously record, maintain, and analyze, in part, this data. We see the system as being particularly useful to the physics and engineering staffs of medium and large facilities in that it is entirely separate from experimental apparatus and control devices. The design criteria, implementation, use, and benefits of such a system will be discussed
Directory of Open Access Journals (Sweden)
Diana Gonçalves Vidal
2013-01-01
Full Text Available O artigo, produzido no âmbito das comemorações dos 80 anos de publicação do Manifesto dos Pioneiros da Educação Nova, interroga-se sobre a atualidade dessa carta. Para tanto, explora as condições históricas de emergência do documento, os significados atribuídos à Escola Nova no Brasil na década de 1930 e as contendas ocorridas na arena educacional no período. Além disso, discorre sobre as especificidades do movimento escolanovista brasileiro, procurando demonstrar que a Escola Nova constituiu-se no país como uma fórmula, com significados múltiplos e distintas apropriações produzidas no entrelaçamento de três vertentes: a pedagógica, a ideológica e a política. No que tange ao primeiro aspecto, a indefinição das fronteiras conceituais permitiu que a expressão Escola Nova aglutinasse diferentes educadores, católicos e liberais, em torno de princípios pedagógicos do ensino ativo. No segundo caso, a fórmula ofereceu-se como meio para a transformação da sociedade, servindo às finalidades divergentes dos grupos em litígio. Já na terceira acepção, tornou-se bandeira política, sendo capturada como signo de renovação do sistema educacional pelo Manifesto e por seus signatários. Assim, o documento emergiu como parte do jogo político pela disputa do controle do Estado e de suas dinâmicas, e, portanto, como elemento de coesão de uma frente de educadores que, a despeito de suas diferenças, articulava-se em torno de alguns objetivos comuns, como laicidade, gratuidade e obrigatoriedade da educação. Ademais, ele também foi representante de um grupo de intelectuais que abraçava um mesmo projeto de nação, ainda que com divergências internas.The article, prepared in the context of the celebrations marking the 80 years of the publication of the Manifesto of the Pioneers of Educação Nova, inquiries into the current value of this charter. For that, it explores the historical conditions of the emergence of this
Directory of Open Access Journals (Sweden)
LEITE, Ramon Silva
2009-03-01
Full Text Available RESUMOTradicionalmente, a literatura gerencial aborda os efeitos de relacionamentos competitivos ou colaborativos na estratégia organizacional. Entretanto, recentemente, verifica-se o crescimento de uma terceira abordagem, na qual um mesmo relacionamento pode integrar rivalidade e parceria entre concorrentes. Este estudo tem por finalidade fornecer subsídios para essa discussão. Para isso, foi adotado um delineamento qualitativo de pesquisa, no qual foram entrevistados os empresários do arranjo produtivo calçadista de Nova Serrana. Com isso, foram identificados os aspectos que levam as empresas da cidade a adotarem uma postura colaborativa ou competitiva em seus relacionamentos.ABSTRACTTraditionally, the management literature discusses the effects of competitive or collaborative relationships in organizational strategy. However, recently a third approach has emerged, in which a single relationship is seem as a variable that can integrate collaboration and rivalry between competitors. This study aims to provide subsidies for this discussion. For this, a qualitative design was adopted; in which businessmen of the city of Nova Serrana were interviewed. The results indicate that the decision of collaborate or compete is dependent on a set of factors.RESUMENTradicionalmente, la literatura de gestión la analiza los efectos de la competencia o de relaciones de colaboración en las estrategias de la organización. Sin embargo, recientemente, un tercer enfoque ha surgido, en el que una sola relación se parece como una variable que puede integrar la colaboración y la rivalidad entre competidores. Este estudio tiene como objetivo proporcionar subsidios para este debate. Por ello, se adoptó un diseño cualitativo en el que los hombres de negocios de la ciudad de Nova Serrana fueron entrevistados. Los resultados indican que la decisión de colaborar o competir depende de una serie de factores.
X-ray and UV observations of Nova Mus 2018 with Swift
Nelson, Thomas; Mukai, Koji; Chomiuk, Laura; Li, Kwan-Kok; Kawash, Adam; Sokoloski, J. L.; Rupen, Michael; Linford, Justin; Mioduszewski, Amy
2018-01-01
We observed Nova Mus 2018 (PNV J11261220-6531086) with the Neil Gehrels Swift Observatory on 2018 January 21, 18 days after the initial rapid rise to V=8.8 on 2018 January 3.24 (see link below for more details).
The White Dwarf Mass and the Accretion Rate of Recurrent Novae: An X-ray Perspective
Mukai, Koji; Sokoloski, Jennifer L.; Nelson, Thomas; Luna, Gerardo J. M.
2011-01-01
We present recent results of quiescent X-ray observations of recurrent novae (RNe) and related objects. Several RNe are luminous hard X-ray sources in quiescence, consistent with accretion onto a near Chandrasekhar mass white dwarf. Detection of similar hard X-ray emissions in old novae and other cataclysmic variables may lead to identification of additional RN candidates. On the other hand, other RNe are found to be comparatively hard X-ray faint. We present several scenarios that may explain this dichotomy, which should be explored further.
Outra Verdade Inconveniente: a nova geografia política da energia numa perspectiva subalterna
Porto-Gonçalves, Carlos Walter
2008-01-01
O artigo analisa a nova configuração geopolítica em torno da transição de matriz energética dos fósseis (carvão e petróleo) para a biomassa (os agrocombustíveis etanol e biodiesel). O artigo mostra como o Brasil se coloca como parte do novo bloco de poder técnico-científico-agroindustrial-financeiro-militar-midiático mundial e como os movimentos sociais colocam novas formulações para velhas e atuais questões como a reforma agrária. This article analyzes the new geopolitical configuration a...
The Evolution of NR TrA (Nova TrA 2008) from 2008 through 2017
Walter, Frederick M.; Burwitz, Vadim; Kafka, Stella
2018-06-01
The classical nova NR TrA was discovered as an O-type optically-thick classical nova. There is no evidence that it formed dust. Within four years the envelope became sufficiently thin to reveal an eclipsing accretion disk-dominated system with orbitally-modulated permitted lines of C IV, N V, and O VI. XMM observations reveal a non-eclipsing soft X-ray source and a deeply-eclipsing UV continuum. We will present the first ten years of optical spectral evolution of this system accompanied by ten years of BVRIJHK photometry, with an eye to deciphering the current nature of the system.
Diagnostics of Shiva Nova produced high yield thermonuclear events
International Nuclear Information System (INIS)
Ahlstrom, H.G.; Banner, D.L.; Boyle, M.J.; Campbell, E.M.; Coleman, L.W.; Koppel, L.N.; Kornblum, H.N. Jr.; Rienecker, F.; Severyn, J.R.; Slivinsky, V.W.
1978-01-01
Experiments with the Shiva Nova laser facility which produce yield levels of scientific breakeven and above will result in neutron, x-ray and particle fluxes which will require specific attention to the survivability of diagnostic instrumentation. These yield levels will also allow the utilization of new diagnotics techniques which can provide detailed information on the state of the imploded fuel and pusher shells
First measurement of electron neutrino appearance in NOvA
Czech Academy of Sciences Publication Activity Database
Adamson, P.; Ader, C.; Andrews, M.; Lokajíček, Miloš; Zálešák, Jaroslav
2016-01-01
Roč. 116, č. 15 (2016), 1-7, č. článku 151806. ISSN 0031-9007 R&D Projects: GA MŠk(CZ) LG15047; GA MŠk LM2015068 Institutional support: RVO:68378271 Keywords : mass: hierarchy * background * NOvA * near detector * far detector * experimental results Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 8.462, year: 2016
The dwarf novae WX Hyi and V436 Cen
International Nuclear Information System (INIS)
Bailey, J.
1979-01-01
High speed photometric observations of the dwarf novae WX Hydri and V436 Centauri are presented. WX Hyi was observed during a supermaximum, and showed 'superhumps' repeating with a period of 111 min, similar to those observed in a number of similar systems. Neither WX Hyi nor V436 Cen show any periodic modulation in their quiescent state light curves. (author)
Terra Nova tow-out poised as next East Coast event
International Nuclear Information System (INIS)
Reid, W.
2001-01-01
This spring, Newfoundland will send off a floating production, storage and offloading (FPSO) vessel to the offshore Terra Nova field. The Terra Nova will proceed southeast through Bull Arm, then northeast out of Trinity Bay, then heads southeast to the Jeanne d'Arc Basin on the Grand Banks. The Terra Nova is expected to produce 115,000 barrels of oil per day for six years, when it reaches full capacity. The consortium, headed by Petro-Canada as senior ownership partner and operator, built an environment protection program into every aspect of the project. Some of the features of the environment protection program include glory holes excavated on the ocean floor for the protection of production equipment from icebergs, to a flare stack on the platform, which has four legs to provide stability in rough seas. The FPSO was designed to withstand sea ice, icebergs, and severe winter storms. Flow lines are also protected, and in the event that a line is damaged, sea water will leak rather than oil or gas, since the hydrocarbons can be flushed out of the production lines. Safety was ever present during the design phase, where the engineers studied the designs of other platforms and included the best elements in the design of the Terra Nova. The rig possesses an ice-strengthened double hull, reinforced with 3,000 tonnes of steel. A series of tanks are attached to the inside surface of the outer shell for sea water ballasts, while the inner hull holds the crude oil. In addition, an environmental effects monitoring EEM system is in place to gather information for future reference, to assess and detect changes in the marine climate and the ecosystem. The analysis of the information will assist in the determination of the best course of action in the event that remedial action is required. Baseline information was gathered beginning in 1997. Additional sampling will be performed on an annual basis for the next three years. After this period, sampling will be periodical
FUSE SPECTROSCOPIC ANALYSIS OF THE SLOWEST SYMBIOTIC NOVA AG PEG DURING QUIESCENCE
Sion, Edward Michael; Godon, Patrick; Katynski, Marcus; Mikolajewska, Joanna
2018-01-01
We present a far ultraviolet spectroscopic analysis of the slowest known symbiotic nova AG Peg (MIII giant + hot white dwarf; P_orb = 818.4 days) which underwent a nova explosion in 1850 followed by a very slow decline that did not end until ~ 1996, marking the beginning of queiscence. Eight years of quiescence ended in June 2015, when AG Peg exhibited a Z And-type outburst with an optical amplitude of ~ 3 magnitudes. We have carried out accretion disk and WD photosphere synthetic spectral modeling of a FUSE spectrum (Froning et al. 2014) obtained on June 5.618, 2003 during the quiescence intervai ~ 12 years before the 2015 outburst. The spectrum is heavily affected by ISM absorption as well as strong broad emission lines. We de-reddened the FUSE fluxes with E(B-V) = 0.10 which is the maximum galactic reddening in the direction of AG Peg and took the distance of 800 pc (Kenyon et al. 1993) but used a range of white dwarf masses, surface temperatures and disk inclination angles. Our analysis also incororates archival HST FOS spectra obtained in 1996 at the onset of quiescence, 147 years after the 1850 nova explosion. The results of our analysis are presented and implications are discussed.This work is supported in part by NASA ADP grant NNX17AF36G to Villanova University.
The Massive CO White Dwarf in the Symbiotic Recurrent Nova RS Ophiuchi
Mikołajewska, Joanna; Shara, Michael M.
2017-10-01
If accreting white dwarfs (WDs) in binary systems are to produce type Ia supernovae (SNe Ia), they must grow to nearly the Chandrasekhar mass and ignite carbon burning. Proving conclusively that a WD has grown substantially since its birth is a challenging task. Slow accretion of hydrogen inevitably leads to the erosion, rather than the growth of WDs. Rapid hydrogen accretion does lead to growth of a helium layer, due to both decreased degeneracy and the inhibition of mixing of the accreted hydrogen with the underlying WD. However, until recently, simulations of helium-accreting WDs all claimed to show the explosive ejection of a helium envelope once it exceeded ˜ {10}-1 {M}⊙ . Because CO WDs cannot be born with masses in excess of ˜ 1.1 {M}⊙ , any such object in excess of ˜ 1.2 {M}⊙ must have grown substantially. We demonstrate that the WD in the symbiotic nova RS Oph is in the mass range 1.2-1.4 M ⊙. We compare UV spectra of RS Oph with those of novae with ONe WDs and with novae erupting on CO WDs. The RS Oph WD is clearly made of CO, demonstrating that it has grown substantially since birth. It is a prime candidate to eventually produce an SN Ia.
A flickering study of nova-like systems KR Aur and UU Aqr
Dobrotka, A.; Mineshige, S.; Casares, J.
2012-03-01
We present a study of the flickering activity in two nova-like systems, KR Aur and UU Aqr. We applied a statistical model of flickering simulations in accretion discs based on turbulent angular momentum transport between two adjacent rings with an exponential distribution of the turbulence dimension scale. The model is based on a steady-state disc model, which is satisfied in the case of hot ionized discs of nova-like cataclysmic variables. Our model successfully fits the observed power-density spectrum of KR Aur with the disc parameter α= 0.10-0.40 and an inner-disc truncation radius in the range Rin= 0.88-1.67 × 109 cm. The exact values depend on the mass-transfer rate in the sense that α decreases and Rin increases with mass-transfer rate. In any case, the inner-disc radius found for KR Aur is considerably smaller than those for quiescent dwarf novae, as predicted by the disc instability model. On the other hand, our simulations fail to reproduce the power-density spectrum of UU Aqr. A tantalizing explanation involves the possible presence of spiral waves, which are expected in UU Aqr because of its low mass ratio but not in KR Aur. In general our model predicts the observed concentration of flickering in the central disc. We explain this by the radial dependence of the angular-momentum gradient.
Colpitts, Emily; Gahagan, Jacqueline
2016-09-22
Currently, there is a dearth of baseline data on the health of lesbian, gay, bisexual, transgender, and queer (LGBTQ) populations in the province of Nova Scotia, Canada. Historically, LGBTQ health research has tended to focus on individual-level health risks associated with poor health outcomes among these populations, which has served to obscure the ways in which they maintain their own health and wellness across the life course. As such, there is an urgent need to shift the focus of LGBTQ health research towards strengths-based perspectives that explore the complex and resilient ways in which LGBTQ populations promote their health. This paper discusses the findings of our recent scoping review as well as the qualitative data to emerge from community consultations aimed at developing strengths-based approaches to understanding and advancing LGBTQ pathways to health across Nova Scotia. Our scoping review findings demonstrated the lack of strengths-based research on LGBTQ health in Nova Scotia. Specifically, the studies examined in our scoping review identified a number of health-promoting factors and a wide variety of measurement tools, some of which may prove useful for future strengths-based health research with LGBTQ populations. In addition, our community consultations revealed that many participants had negative experiences with health care systems and services in Nova Scotia. However, participants also shared a number of factors that contribute to LGBTQ health and suggestions for how LGBTQ pathways to health in Nova Scotia can be improved. There is an urgent need to conduct research on the health needs, lived experiences, and outcomes of LGBTQ populations in Nova Scotia to address gaps in our knowledge of their unique health needs. In moving forward, it is important that future health research take an intersectional, strengths-based perspective in an effort to highlight the factors that promote LGBTQ health and wellness across the life course, while taking
Legislating Interprofessional Regulatory Collaboration in Nova Scotia
Directory of Open Access Journals (Sweden)
William Lahey
2013-10-01
Full Text Available To shift health professions regulation from traditional to ‘collaborative’ self-regulation, Nova Scotia has adopted legislation which will: make all self-regulating health professions members of the Regulated Health Professions Network; mandate the Network to facilitate voluntary collaboration among its members; and enable regulators to work together on investigations of patient complaints, to adjust scopes of practice on an ongoing basis and to adjudicate appeals of unsuccessful applicants for registration. The goals are to give health professions regulation the capacity to enable and support the functioning of interprofessional teams. The legislation was adopted primarily for two reasons: collaborative development and unanimous support by all of the province’s self-regulating professions; and alignment with the government’s health care reform agenda and its emphasis on collaborative team-based care. Contrary to the approach of several other provinces, the legislation will enable but not require regulators to collaborate on the premise that consensual collaboration is more likely to happen, to be meaningful and to yield tangible benefits. Support for this approach can be taken from the impressive collaborative work on which the legislation is based. Evaluation will be critical, and the five-year review required by the legislation will give Nova Scotia the opportunity to test not only the legislation but the ideas on which it is based. The extent of the legislation’s reliance on voluntary process will prove to be either its greatest strength or its greatest weakness.
Region of Nova Cygni 1975 on the Palomar Sky Survey
International Nuclear Information System (INIS)
Beardsley, W.R.; King, M.W.; Russell, J.L.; Stein, J.W.
1975-01-01
Careful superposition of a blue Palomar Sky Survey print onto a sectored photograph of Nova Cygni 1975 obtained with the Thaw 30-inch (76-cm) refractor at the Allegheny Observatory decisively confirms the fact that no star brighter than magnitude 21 appears on the Sky Survey print at that position
Surface Current Measurements In Terra Nova Bay By Hf Radar
Flocco, D.; Falco, P.; Wadhams, P.; Spezie, G.
We present the preliminary results of a field experiment carried out within frame- work of the CLIMA project of the Italian National Programme for Antarctic Research (PNRA) and in cooperation with the Scott Polar Research Institute of Cambridge. Dur- ing the second period (02/12/1999-23/01/2000) of the XV Italian expedition a coastal radar was used to characterize the current field in the area of Terra Nova Bay (TNB). One of the aims of the CLIMA (Climatic Long-term Interactions for the Mass balance in Antarctica) project is to determine the role of the polynya in the sea ice mass bal- ance, water structure and local climate. The OSCR-II experiment was planned in order to provide surface current measurements in the area of TNB polynya, one of the most important coastal polynya of the Ross Sea. OSCR (Ocean Surface Current Radar) is a shore based, remote sensing system designed to measure sea surface currents in coastal waters. Two radar sites (a master and a slave) provide with radial current mea- surements; data combined from both sites yield the total current vector. Unfortunately the master and slave stations did not work together throughout the whole period of the experiment. A description of the experiment and a discussion of the results, will be proposed.
Inner Disk Structure of Dwarf Novae in the Light of X-Ray Observations
Directory of Open Access Journals (Sweden)
S. Balman
2015-02-01
Full Text Available Diversity of the X-ray observations of dwarf nova are still not fully understood. I review the X-ray spectral characteristics of dwarf novae during the quiescence in general explained by cooling flow models and the outburst spectra that show hard X-ray emission dominantly with few sources that reveal soft X-ray/EUV blackbody emission. The nature of aperiodic time variability of brightness of dwarf novae shows band limited noise, which can be adequately described in the framework of the model of propagating fluctuations. The frequency of the break (1-6 mHz indicates inner disk truncation of the optically thick disk with a range of radii (3.0-10.0×109 cm. The RXTE and optical (RTT150 data of SS Cyg in outburst and quiescence reveal that the inner disk radius moves towards the white dwarf and receeds as the outburst declines to quiescence. A preliminary analysis of SU UMa indicates a similar behaviour. In addition, I find that the outburst spectra of WZ Sge shows two component spectrum of only hard X-ray emission, one of which may be fitted with a power law suggesting thermal Comptonization occuring in the system. Cross-correlations between the simultaneous UV and X-ray light curves (XMM −Newton of five DNe in quiescence show time lags in the X-rays of 96-181 sec consistent with travel time of matter from a truncated inner disk to the white dwarf surface. All this suggests that dwarf novae and other plausible nonmagnetic systems have truncated accretion disks indicating that the disks may be partially evaporated and the accretion may occur through hot (coronal flows in the disk.
Sistema agroflorestal em Nova Olinda, Ceará: Uma experiência de sucesso
Directory of Open Access Journals (Sweden)
Terezinha Teixeira da Silva
2014-09-01
Full Text Available Os Sistemas Agroflorestais foram inicialmente utilizados pelos indígenas. Atualmente são desenvolvidos principalmente nas regiões tropicais e subtropicais do planeta. No Nordeste brasileiro começaram com experiências isoladas no sertão. Apresentando resultados positivos, as experiências agroflorestais expandiram-se, ganharam importância, contribuindo para o desenvolvimento socioeconômico de algumas regiões nordestinas, a exemplo da Chapada do Araripe, no Ceará. A primeira experiência de sucesso desenvolvida nessa região foi realizada no município de Nova Olinda. Este trabalho teve como objetivo descrever a importância da implantação de um sistema agroflorestal, através de relato sobre a experiência no Sítio Taboleiro, no município de Nova Olinda, no Cariri cearense, mostrando como o SAF foi introduzido e como o Sr. Zé Arthur vê o desenvolvimento desse sistema na referida região. Utilizou-se entrevista semiestruturada com o proprietário e aplicação de questionário. A entrevista foi gravada com mp3, depois feita a transcrição e análise. Os resultados positivos apresentados pelo SAF do Sr. Zé Arthur revelam que essa prática agroecológica apresentou melhores resultados que a agricultura convencional desenvolvida em outras propriedades no município de Nova Olinda-CE. O agricultor enfatiza que os bons resultados do SAF são frutos de um investimento em mão de obra superior à agricultura convencional. Exemplo de produção sustentável, o SAF do Senhor Zé Arthur vem sendo uma das atrações do roteiro turístico do município de Nova Olinda. Palavras-chave: Sistema Agroflorestal. Experiência de sucesso. Produção sustentável. Resultados positivos.
The first results from the NOVA experiment
CERN. Geneva
2015-01-01
The NOvA experiment measures neutrino oscillation phenomena over a baseline of 810 km using a narrow-band muon neutrino beam that has a peak energy near 2 GeV. With this configuration the experiment has sensitivity to the oscillation parameters that are the least known. Installation of the detector began almost 2 years ago and the collaboration has been recording data since then. The collaboration released its first measurements of neutrino oscillation phenomena this summer. The results of those measurements and the future prospects of the experiment will be discussed.
Engineering design of the Nova Laser Facility for inertial-confinement fusion
International Nuclear Information System (INIS)
Simmons, W.W.; Godwin, R.O.; Hurley, C.A.
1982-01-01
The design of the Nova Laser Facility for inertial confinement fusion experiments at Lawrence Livermore National Laboratory is presented from an engineering perspective. Emphasis is placed upon design-to-performance requirements as they impact the various subsystems that comprise this complex experimental facility
MOSAIC, 1975
1975-01-01
Describes how NOVA filmmakers developed a storyline about San Francisco Bay and captured it on film. Presents the criteria for topic selection by NOVA and the reception the program has had by viewing audiences. (GS)
A spectroscopic study of the deeply eclipsing dwarf nova IP Peg
International Nuclear Information System (INIS)
Marsh, T.R.
1988-01-01
Spectrophotometry of the dwarf novae IP Peg during quiescence is presented. The spectra have broad, double peaked emission lines on a blue continuum, characteristic of high-inclination dwarf novae. The emission lines are 96 per cent eclipsed and the orbital hump, which is strong in the continuum, is much weaker in the lines. We introduce a method for the analysis of radial velocities of emission lines which corrects for bias caused by disc asymmetries, and we determine the geometrical and physical parameters of IP Peg. The masses of the white dwarf and red star are Msub(W) = 1.09 ± 0.10 solar masses and Msub(R) = 0.64 ± 0.09 solar masses, and the orbital inclination is i = 79.3 ± 0.9 0 . The secondary star which has a radius Rsub(R) 0.49 ± 0.03 solar radii, lies near the main sequence mass-radius relation. (author)
Summary of control and data acquisition systems for NOVA experiments (invited)
International Nuclear Information System (INIS)
McCauley, E.W.; Campbell, E.M.; Auerbach, J.M.; Montgomery, D.S.; Martin, V.A.; Randolph, J.E.; Shaw, J.G.; Stewart, B.L.; Stone, G.F.
1986-01-01
The NOVA laser has completed its first year of operation. During this period, emphasis has been placed on activation of the facility and of the numerous target and beam diagnostics. Two separate target chambers are in use. NOVA operation is separated into two broad functions: laser operations and experiments. The operations group provides the laser system control, operation, and data acquisition and the experiments group provides experiment definition, diagnostic instrumentation, and overall data processing. On the operations side, VAX 11/780 computers are used to set up diagnostic operating parameters and collect data recorded by the CAMAC and CCD modules. These data are delivered in files by electronic link to the Laser Experiments and Analysis Facility (LEAF) VAX 11/785 of the experiments group for processing. Film data are digitized at LEAF and the film data files are also processed on the LEAF VAX. The LEAF provides collection, processing, analysis, and archiving of the experimental data. The many applications software packages written for LEAF provide the experimental physicists and NOVA operations staff with programs and data bases for interpretation of experimental results. This software makes fundamental use of the ORACLE relational data base management system to both access the required data and archive the obtained results. Post-shot data processing produces sets of scalar values, x, y profiles and x, y, z contour data. The scalar data are stored in the ORACLE DB; the more extensive results are stored in binary files on disk. All data forms are accessed by a comprehensive software system, the electronic SHOTBOOK, developed around the ORACLE DBMS
Optical and ultraviolet observations of Nova Vul 1987
Energy Technology Data Exchange (ETDEWEB)
Starrfield, S.; Stryker, L.L.; Sonneborn, G.; Sparks, W.M.; Wagner, R.M.; Ferland, G.; Gallagher, J.S.; Wade, R.; Williams, R.E.; Gehrz, R.D.
1988-01-01
We present a brief summary of the outburst for a nova that was discovered in November 1987 and has been followed since that time. Although we were able to observe it with the IUE at maximum, its ultraviolet energy faded rapidly and after the first two weeks we were no longer able to observe it at IUE wavelengths. It was observed to form a thick dust shell and currently is in the nebular stage. 6 figs.
First measurement of muon-neutrino disappearance in NOvA
Czech Academy of Sciences Publication Activity Database
Adamson, P.; Ader, C.; Andrews, M.; Lokajíček, Miloš; Zálešák, Jaroslav
2016-01-01
Roč. 93, č. 5 (2016), 1-8, č. článku 051104. ISSN 2470-0010 R&D Projects: GA MŠk(CZ) LG15047; GA MŠk LM2015068 Institutional support: RVO:68378271 Keywords : neutrino: oscillation * neutrino/mu: beam * neutrino * mixing angle * neutrino: mass difference * neutrino * mass: hierarchy * NOvA Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.568, year: 2016
Directory of Open Access Journals (Sweden)
José P.L. Guadanucci
2007-12-01
Full Text Available The genus Guyruita gen. nov. and two new species from Brazil are described. Holothele waikoshiemi (Bertani & Araújo, 2005 from Venezuela is transferred here to the new genus. Guyruita gen. nov. differs from the remaining Ischnocolinae by the following features: labium densely occupied by a lot of cuspules (more than 100, intercheliceral intumescence absent, posterior sternal sigilla remote from margin, tarsal claws without teeth, tarsal scopula I-II undivided (tarsus II with a line of sparse setae, which does not divide the scopula, III-IV divided.É descrito o gênero Guyruita gen. nov. e duas espécies novas do Brasil. Holothele waikoshiemi (Bertani & Araújo, 2005 da Venezuela é transferido para o novo gênero. Guyruita gen. nov. difere dos outros Ischnocolinae pelas seguintes caracterísicas: lábio densamente ocupado por muitas cúspides (mais de 100, tumescência interqueliceral ausente, sigilla esternal posterior distante da margem, unhas tarsais sem dentes, escópula tarsal I e II inteiras (tarso II com uma fileira de cerdas esparsas, as quais não dividem a escópula, III e IV divididas.
Nova laser alignment control system
International Nuclear Information System (INIS)
Van Arsdall, P.J.; Holloway, F.W.; McGuigan, D.L.; Shelton, R.T.
1984-01-01
Alignment of the Nova laser requires control of hundreds of optical components in the ten beam paths. Extensive application of computer technology makes daily alignment practical. The control system is designed in a manner which provides both centralized and local manual operator controls integrated with automatic closed loop alignment. Menudriven operator consoles using high resolution color graphics displays overlaid with transport touch panels allow laser personnel to interact efficiently with the computer system. Automatic alignment is accomplished by using image analysis techniques to determine beam references points from video images acquired along the laser chain. A major goal of the design is to contribute substantially to rapid experimental turnaround and consistent alignment results. This paper describes the computer-based control structure and the software methods developed for aligning this large laser system
Energy Technology Data Exchange (ETDEWEB)
Boeltzig, A. [Gran Sasso Science Institute, L' Aquila (Italy); Bruno, C.G.; Davinson, T. [University of Edinburgh, SUPA, School of Physics and Astronomy, Edinburgh (United Kingdom); Cavanna, F.; Ferraro, F. [Dipartimento di Fisica, Universita di Genova (Italy); INFN, Genova (Italy); Cristallo, S. [Osservatorio Astronomico di Collurania, INAF, Teramo (Italy); INFN, Napoli (Italy); Depalo, R. [Dipartimento di Fisica e Astronomia, Universita di Padova, Padova (Italy); INFN, Padova (Italy); DeBoer, R.J.; Wiescher, M. [University of Notre Dame, Institute for Structure and Nuclear Astrophysics, Joint Institute for Nuclear Astrophysics, Notre Dame, Indiana (United States); Di Leva, A.; Imbriani, G. [Dipartimento di Fisica, Universita di Napoli Federico II, Napoli (Italy); INFN, Napoli (Italy); Marigo, P. [Dipartimento di Fisica e Astronomia, Universita di Padova, Padova (Italy); Terrasi, F. [Dipartimento di Matematica e Fisica Seconda Universita di Napoli, Caserta (Italy); INFN, Napoli (Italy)
2016-04-15
The nucleosynthesis of light elements, from helium up to silicon, mainly occurs in Red Giant and Asymptotic Giant Branch stars and Novae. The relative abundances of the synthesized nuclides critically depend on the rates of the nuclear processes involved, often through non-trivial reaction chains, combined with complex mixing mechanisms. In this paper, we summarize the contributions made by LUNA experiments in furthering our understanding of nuclear reaction rates necessary for modeling nucleosynthesis in AGB stars and Novae explosions. (orig.)
Observing the Next Galactic Supernova with the NOvA Detectors
Energy Technology Data Exchange (ETDEWEB)
Vasel, Justin A. [Indiana U.; Sheshukov, Andrey [Dubna, JINR; Habig, Alec [Minnesota U., Duluth
2017-10-02
The next galactic core-collapse supernova will deliver a wealth of neutrinos which for the first time we are well-situated to measure. These explosions produce neutrinos with energies between 10 and 100 MeV over a period of tens of seconds. Galactic supernovae are relatively rare events, occurring with a frequency of just a few per century. It is therefore essential that all neutrino detectors capable of detecting these neutrinos are ready to trigger on this signal when it occurs. This poster describes a data-driven trigger which is designed to detect the neutrino signal from a galactic core-collapse supernova with the NOvA detectors. The trigger analyzes 5ms blocks of detector activity and applies background rejection algorithms to detect the signal time structure over the background. This background reduction is an essential part of the process, as the NOvA detectors are designed to detect neutrinos from Fermilab's NuMI beam which have an average energy of 2GeV--well above the average energy of supernova neutrinos.
Accretion onto hot white dwarfs in relation to symbiotic novae
International Nuclear Information System (INIS)
Livio, M.; Prialnik, D.; Regev, O.
1989-01-01
Numerical calculations are used to study the hydrodynamic evolution of a hot white dwarf with 1 solar mass accreting hydrogen-rich matter at rates between 10 to the -8th and 10 to the -6th solar masses/yr. It is found that for accretion at a rate of about 10 to the -8th solar masses/yr, nova-type outbursts of long duration occur at intervals of about 1500 yr. About half of the accreted envelope is ejected during these outbursts. At a rate of about 10 to the -7th solar masses/yr, the star alternates between comparable periods at a high plateau luminosity and giant dimensions and periods at a low luminosity and white dwarf dimension. At 10 to the -6th solar masses/yr, equilibrium is achieved with a typical red giant luminosity supported by steady hydrogen burning. It is concluded that symbiotic novae are more likely to occur in detached systems involving wind accretors. Thus, the contribution of symbiotic stars to the frequency of type I supernovae is severely constrained. 39 refs
Fabrication and testing of gas filled targets for large scale plasma experiments on Nova
International Nuclear Information System (INIS)
Stone, G.F.; Spragge, M.; Wallace, R.J.; Rivers, C.J.
1995-01-01
An experimental campaign on the Nova laser was started in July 1993 to study one st of target conditions for the point design of the National Ignition Facility (NIF). The targets were specified to investigate the current NIF target conditions--a plasma of ∼3 keV electron temperature and an electron density of ∼1.0 E + 21 cm -3 . A gas cell target design was chosen to confine as gas of ∼0.01 cm 3 in volume at ∼ 1 atmosphere. This paper will describe the major steps and processes necessary in the fabrication, testing and delivery of these targets for shots on the Nova Laser at LLNL
Lavender, Samantha; Haria, Kajal; Cooksley, Geraint; Farman, Alex; Beaton, Thomas
2016-08-01
The aim was to understand a future market for NovaSAR-S, with a particular focus on flood mapping, through developing a simple Synthetic Aperture Radar (SAR) simulator that can be used in advance of NovaSAR-S data becoming available.The return signal was determined from a combination of a terrain or elevation model, Envisat S-Band Radar Altimeter (RA)-2, Landsat and CORINE land cover information; allowing for a simulation of a SAR image that's influenced by both the geometry and surface type. The test sites correspond to data from the 2014 AirSAR campaign, and validation is performed by using AirSAR together with Envisat Advanced (ASAR) and Advanced Land Observing Satellite "Daichi" (ALOS) Phased Array type L-Band Synthetic Aperture Radar (PALSAR) data.It's envisaged that the resulting simulated data, and the simulator, will not only aid early understanding of NovaSAR-S, but will also aid the development of flood mapping applications.
Energy Technology Data Exchange (ETDEWEB)
Norrie, E.
1996-10-01
Speaking notes used by the Nova Scotia Minister of Natural Resources at the 1996 CORE Conference were provided. The presentation focused on the new Sable Offshore Energy Project, an important new offshore gas field being developed by Mobil Oil. The project represents a total investment of $3 billion, the biggest capital project ever undertaken in Nova Scotia, and is completely funded by the private sector. Nearly 4,000 jobs will be created during the offshore and onshore construction phase, as well as future tax revenues for the province, new business opportunities, infrastructure for future projects, and an estimated 11,000 `spin-off` jobs. To expedite the development process, the Government of Nova Scotia has recently established the Nova Scotia Offshore Energy Office to work exclusively on the Sable gas and pipeline project. Future plans include a gas processing plant for Guysborough County. The gas will be transported by pipeline across New Brunswick to the New England market. A proposal by Gaz Metropolitain is also expected which would have some of the gas transported to Quebec.
Novas Cartas Portuguesas: The Making of a Reputation
Directory of Open Access Journals (Sweden)
Ana Margarida Dias Martins
2012-05-01
Full Text Available Novas Cartas Portuguesas (New Portuguese Letters, co-authored by Maria Isabel Barreno, Maria Teresa Horta, and Maria Velho da Costa, was banned in 1972 in Portugal for exploring sensitive issues such as women's oppression under the Catholic patriarchy. Given that police action against the authors soon became the focus of an international feminist protest in 1972-73, existing discussions of the book's reception often focus almost exclusively on what may be called its political life. I propose to approach the book from a new angle, with the purpose of uncovering its theoretical dimension as a literary-critical text that may have played an important role in helping to shape feminist intellectual directions of the 1970s. Specifically, I analyze how a general insistence on the political life of Novas Cartas contributed to marginalizing the work on a theoretical level, transforming it into a "strange" (Ahmed textual body out of place. In a manner similar to what would later happen to the Brazilian writer Clarice Lispector as a result of Hélène Cixous's feminist sponsorship of her work, this marginalization helped define the boundaries of "international feminism" as opposed to "Portuguese anti-fascism," according to a conception of the Lusophone cultural sphere as an anachronistic feminine space for political action, entirely disconnected from the centers where feminist theory is made.
International Nuclear Information System (INIS)
Norrie, E.
1996-10-01
Speaking notes used by the Nova Scotia Minister of Natural Resources at the 1996 CORE Conference were provided. The presentation focused on the new Sable Offshore Energy Project, an important new offshore gas field being developed by Mobil Oil. The project represents a total investment of $3 billion, the biggest capital project ever undertaken in Nova Scotia, and is completely funded by the private sector. Nearly 4,000 jobs will be created during the offshore and onshore construction phase, as well as future tax revenues for the province, new business opportunities, infrastructure for future projects, and an estimated 11,000 'spin-off' jobs. To expedite the development process, the Government of Nova Scotia has recently established the Nova Scotia Offshore Energy Office to work exclusively on the Sable gas and pipeline project. Future plans include a gas processing plant for Guysborough County. The gas will be transported by pipeline across New Brunswick to the New England market. A proposal by Gaz Metropolitain is also expected which would have some of the gas transported to Quebec
Ligações narrativas: o uso go link no cinema e nas novas mídias digitais
Directory of Open Access Journals (Sweden)
Egle Müller Spinelli
2014-01-01
Full Text Available Este artigo pretende realizar uma reflexão sobre algumas semelhanças entre a linguagem cinematográfica e as chamadas novas mídias digitais, no que diz respeito à existência de filmes que desenvolvem recursos narrativos e estéticos que funcionavam como conectores (links de outros contextos, um processo que amplia o significado da obra e é inerente às novas mídias.
On the 2011 Outburst of the Recurrent Nova T Pyxidis
Directory of Open Access Journals (Sweden)
L. Izzo
2015-02-01
Full Text Available We discuss the nebular phase emission during the 2011 outburst of the recurrent nova T Pyxidis and present preliminaryresults on the analysis of the line profiles. We also present some discussions about the binary system configurations and the X-ray emission, showing that the white dwarf mass should be larger than 0.8 MΘ.
Directory of Open Access Journals (Sweden)
Emily Colpitts
2016-09-01
Full Text Available Abstract Background Currently, there is a dearth of baseline data on the health of lesbian, gay, bisexual, transgender, and queer (LGBTQ populations in the province of Nova Scotia, Canada. Historically, LGBTQ health research has tended to focus on individual-level health risks associated with poor health outcomes among these populations, which has served to obscure the ways in which they maintain their own health and wellness across the life course. As such, there is an urgent need to shift the focus of LGBTQ health research towards strengths-based perspectives that explore the complex and resilient ways in which LGBTQ populations promote their health. Methods This paper discusses the findings of our recent scoping review as well as the qualitative data to emerge from community consultations aimed at developing strengths-based approaches to understanding and advancing LGBTQ pathways to health across Nova Scotia. Results Our scoping review findings demonstrated the lack of strengths-based research on LGBTQ health in Nova Scotia. Specifically, the studies examined in our scoping review identified a number of health-promoting factors and a wide variety of measurement tools, some of which may prove useful for future strengths-based health research with LGBTQ populations. In addition, our community consultations revealed that many participants had negative experiences with health care systems and services in Nova Scotia. However, participants also shared a number of factors that contribute to LGBTQ health and suggestions for how LGBTQ pathways to health in Nova Scotia can be improved. Conclusions There is an urgent need to conduct research on the health needs, lived experiences, and outcomes of LGBTQ populations in Nova Scotia to address gaps in our knowledge of their unique health needs. In moving forward, it is important that future health research take an intersectional, strengths-based perspective in an effort to highlight the factors that
LINE FORMATION IN SPECTRA OF X-RAY NOVAE
Suleimanov, V. F.; Shimansky, V. V.
2017-01-01
Results of X-ray Novae (XN) optical spectra computation are presented. The continuum and Balmer line are calculated. The model of XN as a self-irradiated accretion disk is used. Local (for given radius) disk atmospheres as model stellar atmospheres, heated due to external X-ray radiation are treated. Changes of spectra shape and equivalent widths of the Balmer lines depending from the luminosity and some others accretion disk parameters are investigated. The comparison of GRO JO422+32 observe...
O PAPEL DA ÁFRICA NA NOVA ROTA DA SEDA MARÍTIMA
Directory of Open Access Journals (Sweden)
Diego Pautasso
2017-01-01
Full Text Available O objetivo do presente artigo é analisar o lugar da África na construção da Nova Rota da Seda Marítima. Este é justamente um dos vetores do ambicioso projeto chinês de integração da Ásia, Europa e África, lançada em 2013 sob título de Iniciativa OBOR (One Belt, One Road. Na medida que os desafios da reconstrução nacional são superados, a China torna-se mais assertiva e dá forma à sua estratégia de inserção mundial. Nesse sentido, a Nova Rota da Seda agrega os objetivos centrais da diplomacia da China para o século XXI, reservando à África a condição de trampolim para que o projeto se torne global.
Proceedings of Nova Scotia's 2006 energy research and development forum
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
The Nova Scotia 2006 energy research and development forum provided a venue for experts from industry, research institutions and government to discuss how research and development will shape the future of energy in the province. The forum was divided into 3 sessions: (1) building knowledge about the marine environment, (2) building knowledge about geoscience, and (3) building knowledge about sustainable energy. A wide ranges of issues related to the Nova Scotia region included whale identification; fisheries mapping; the commercialization of hydrocarbon discoveries; carbon capture and storage and petroleum system analysis and prospect evaluation. Keynote addresses were presented on produced water in Norway; deepwater exploration in Morocco; renewable energy and Canada's role as an energy superpower. The conference featured more than 57 presentations, of which 4 have been catalogued separately for inclusion in this database. refs., tabs., figs.
Nova abordagem no tratamento da esquizofrenia
Directory of Open Access Journals (Sweden)
Walter Speltri
1966-12-01
Full Text Available Foram tratados 11 casos de esquizofrenia com a guanetidina, substância considerada, do ponto de vista farmacodinâmico, como simpaticoplégica. Na opinião do autor, os surpreendentes e significativos resultados obtidos autorizam uma nova abordagem nas pesquisas à procura da etiopatogenia da esquizofrenia e, a partir dos elementos colhidos, considera plausível uma "teoria psicossomática da esquizofrenia". Recusa-se, entretanto, a cair no atraente, mas inútil, terreno especulativo. Prefere aguardar que os farmacologistas e fisiologistas forneçam dados pais precisos sobre o mecanismo de ação da guanetidina e que novos estudos confirmem seus resultados para, depois, dar publicidade à sua teoria.
Constraints on Oscillation Parameters from νe Appearance and νμ Disappearance in NOvA
Adamson, P.; Aliaga, L.; Ambrose, D.; Anfimov, N.; Antoshkin, A.; Arrieta-Diaz, E.; Augsten, K.; Aurisano, A.; Backhouse, C.; Baird, M.; Bambah, B. A.; Bays, K.; Behera, B.; Bending, S.; Bernstein, R.; Bhatnagar, V.; Bhuyan, B.; Bian, J.; Blackburn, T.; Bolshakova, A.; Bromberg, C.; Brown, J.; Brunetti, G.; Buchanan, N.; Butkevich, A.; Bychkov, V.; Campbell, M.; Catano-Mur, E.; Childress, S.; Choudhary, B. C.; Chowdhury, B.; Coan, T. E.; Coelho, J. A. B.; Colo, M.; Cooper, J.; Corwin, L.; Cremonesi, L.; Cronin-Hennessy, D.; Davies, G. S.; Davies, J. P.; Derwent, P. F.; Dharmapalan, R.; Ding, P.; Djurcic, Z.; Dukes, E. C.; Duyang, H.; Edayath, S.; Ehrlich, R.; Feldman, G. J.; Frank, M. J.; Gabrielyan, M.; Gallagher, H. R.; Germani, S.; Ghosh, T.; Giri, A.; Gomes, R. A.; Goodman, M. C.; Grichine, V.; Group, R.; Grover, D.; Guo, B.; Habig, A.; Hartnell, J.; Hatcher, R.; Hatzikoutelis, A.; Heller, K.; Himmel, A.; Holin, A.; Hylen, J.; Jediny, F.; Judah, M.; Kafka, G. K.; Kalra, D.; Kasahara, S. M. S.; Kasetti, S.; Keloth, R.; Kolupaeva, L.; Kotelnikov, S.; Kourbanis, I.; Kreymer, A.; Kumar, A.; Kurbanov, S.; Lang, K.; Lee, W. M.; Lin, S.; Liu, J.; Lokajicek, M.; Lozier, J.; Luchuk, S.; Maan, K.; Magill, S.; Mann, W. A.; Marshak, M. L.; Matera, K.; Matveev, V.; Méndez, D. P.; Messier, M. D.; Meyer, H.; Miao, T.; Miller, W. H.; Mishra, S. R.; Mohanta, R.; Moren, A.; Mualem, L.; Muether, M.; Mufson, S.; Murphy, R.; Musser, J.; Nelson, J. K.; Nichol, R.; Niner, E.; Norman, A.; Nosek, T.; Oksuzian, Y.; Olshevskiy, A.; Olson, T.; Paley, J.; Pandey, P.; Patterson, R. B.; Pawloski, G.; Pershey, D.; Petrova, O.; Petti, R.; Phan-Budd, S.; Plunkett, R. K.; Poling, R.; Potukuchi, B.; Principato, C.; Psihas, F.; Radovic, A.; Rameika, R. A.; Rebel, B.; Reed, B.; Rocco, D.; Rojas, P.; Ryabov, V.; Sachdev, K.; Sail, P.; Samoylov, O.; Sanchez, M. C.; Schroeter, R.; Sepulveda-Quiroz, J.; Shanahan, P.; Sheshukov, A.; Singh, J.; Singh, J.; Singh, P.; Singh, V.; Smolik, J.; Solomey, N.; Song, E.; Sousa, A.; Soustruznik, K.; Strait, M.; Suter, L.; Talaga, R. L.; Tamsett, M. C.; Tas, P.; Thayyullathil, R. B.; Thomas, J.; Tian, X.; Tognini, S. C.; Tripathi, J.; Tsaris, A.; Urheim, J.; Vahle, P.; Vasel, J.; Vinton, L.; Vold, A.; Vrba, T.; Wang, B.; Wetstein, M.; Whittington, D.; Wojcicki, S. G.; Wolcott, J.; Yadav, N.; Yang, S.; Zalesak, J.; Zamorano, B.; Zwaska, R.; NOvA Collaboration
2017-06-01
Results are reported from an improved measurement of νμ→νe transitions by the NOvA experiment. Using an exposure equivalent to 6.05 ×1 020 protons on target, 33 νe candidates are observed with a background of 8.2 ±0.8 (syst.). Combined with the latest NOvA νμ disappearance data and external constraints from reactor experiments on sin22 θ13, the hypothesis of inverted mass hierarchy with θ23 in the lower octant is disfavored at greater than 93% C.L. for all values of δC P.
Directory of Open Access Journals (Sweden)
Víctor Codina
2013-01-01
Full Text Available Não se pode compreender a eclesiologia do Vaticano II sem conhecer a vida, o estilo pastoral e o carisma de João XXIII, que convocou o Concílio e abriu o caminho em direção a uma nova configuração eclesial que acabava com séculos de uma Igreja de Cristandade. O Vaticano II implica uma transição de uma Igreja clerical a uma Igreja Povo de Deus, povo de batizados. A passagem de uma Igreja juridicista e legalista a uma Igreja Mistério de comunhão em Cristo. Mudar de uma Igreja triunfalista e ligada ao poder mundano a uma Igreja vivificada pela força renovadora do Espírito. A Igreja está a caminho rumo ao Reino de Deus juntamente com todos os cristãos e com toda a humanidade. A recepção do Vaticano II supõe uma conversão pastoral: voltar ao Evangelho e abrir-se aos novos sinais dos tempos seguindo o Espírito que inspirou João XXIII. ABSTRACT: You cannot understand the Ecclesiology of Vatican II without knowing the life, the pastoral style and the charisma of John XXIII, who convened the Council and opened the way toward a new ecclesial setting that ended centuries of a church of Christendom. The Vatican II involves a transition from a clerical Church to a “People (baptized people of God” Church. The Vatican II implies the passage from a juridical and legalistic Church to a Church as the Mystery of the communion in Christ. The Vatican II implies the change from a triumphalistic Church and connected to worldly power to a Church vivified by the renewing force of the Spirit. The Church is on its way toward the Kingdom of God together with all Christians and all mankind. The reception of the Vatican II supposes a pastoral conversion: a return to the Gospel and openness to new signs of the times following the Spirit that inspired John XXIII.
Energy Technology Data Exchange (ETDEWEB)
Barrosa Correa, S. M. B.; Ruiz, E.; Romero, F.
2004-07-01
This work is based on data of the wastewater plant of Nova Pampulha with an UASB reactor. The objective of this research was focussed in the comparison of this plant with another ten brazilian stations provided with different depuration techniques. Firstly the graphical comparison of average operational data suggest analogies between influents (less suspended solids in the Nova Pampulha), effluent (more suspended solids and bacteria in the same station) and alimentation's (smaller for suspended solids and bacteria in Nova Pampulha, where there is also an increase in alkalinity). Cluster analysis, made with percentages of elimination of constituents in the eleven stations and shown as dendrograms, was chosen as the second comparative method. A third comparison was affected by multiple linear regression for obtaiming mathematical models from the eliminations of constituents, with statistical significance at level of the 95% confidence, using as possible independent variables the flows and the concentrations of influents. The explanations of the variances of data by the calculated equations is in the range 46 to 91%. As a general conclusion, it can be said that a well operated UASB reactor may be a satisfactory technique for wastewater treatment and well adapted to climatological Brazilian conditions. (Author) 14 refs.
Dwarf novae in outburst: modelling the observations
International Nuclear Information System (INIS)
Pringle, J.E.; Verbunt, F.
1986-01-01
Time-dependent accretion-disc models are constructed and used to calculate theoretical spectra in order to try to fit the ultraviolet and optical observations of outbursts of the two dwarf novae VW Hydri and CN Orionis. It is found that the behaviour on the rise to outburst is the strongest discriminator between theoretical models. The mass-transfer burst model is able to fit the spectral behaviour for both objects. The disc-instability model is unable to fit the rise to outburst in VW Hydri, and gives a poor fit to the observations of CN Orionis. (author)
The Investigation of Nova-like Variable MV Lyr during the 1999 ...
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
The Investigation of Nova-like Variable MV Lyr during the 1999–2001. Years. N. A. Katysheva & S. Yu. Shugarov. 1. , E. P. Pavlenko. 2. & P. V. Abolmasov. 3. 1Sternberg Astronomical Institute, Moscow, Russia. 2Crimean Astrophysical Observatory, p. Nauchny, Crimea. 3Physical Department, Moscow State University, ...
International Nuclear Information System (INIS)
Troyer, G.L.
1975-08-01
A method for data communication between PDP-8/L and NOVA 1220 computer-based multichannel analyzer systems is described. The method is implemented by modification of each system's operating program with appropriate I/O subroutines and by installation of a minor amount of hardware logic to a NOVA general purpose interface board. The method provides for high speed transfer of gamma energy analysis data between a Nuclear Data Corporation 50/50 system and a Tracor-Northern Corporation 660 system
ECLIPSES DURING THE 2010 ERUPTION OF THE RECURRENT NOVA U SCORPII
International Nuclear Information System (INIS)
Schaefer, Bradley E.; Pagnotta, Ashley; LaCluyze, Aaron P.; Reichart, Daniel E.; Ivarsen, Kevin M.; Haislip, Joshua B.; Nysewander, Melissa C.; Moore, Justin P.; Oksanen, Arto; Worters, Hannah L.; Sefako, Ramotholo R.; Mentz, Jaco; Dvorak, Shawn; Gomez, Tomas; Harris, Barbara G.; Henden, Arne A.; Tan, Thiam Guan; Templeton, Matthew; Allen, W. H.; Monard, Berto
2011-01-01
The eruption of the recurrent nova U Scorpii on 2010 January 28 is now the all-time best observed nova event. We report 36,776 magnitudes throughout its 67 day eruption, for an average of one measure every 2.6 minutes. This unique and unprecedented coverage is the first time that a nova has had any substantial amount of fast photometry. With this, two new phenomena have been discovered: the fast flares in the early light curve seen from days 9-15 (which have no proposed explanation) and the optical dips seen out of eclipse from days 41-61 (likely caused by raised rims of the accretion disk occulting the bright inner regions of the disk as seen over specific orbital phases). The expanding shell and wind cleared enough from days 12-15 so that the inner binary system became visible, resulting in the sudden onset of eclipses and the turn-on of the supersoft X-ray source. On day 15, a strong asymmetry in the out-of-eclipse light points to the existence of the accretion stream. The normal optical flickering restarts on day 24.5. For days 15-26, eclipse mapping shows that the optical source is spherically symmetric with a radius of 4.1 R ☉ . For days 26-41, the optical light is coming from a rim-bright disk of radius 3.4 R ☉ . For days 41-67, the optical source is a center-bright disk of radius 2.2 R ☉ . Throughout the eruption, the colors remain essentially constant. We present 12 eclipse times during eruption plus five just after the eruption.
ECLIPSES DURING THE 2010 ERUPTION OF THE RECURRENT NOVA U SCORPII
Energy Technology Data Exchange (ETDEWEB)
Schaefer, Bradley E.; Pagnotta, Ashley [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); LaCluyze, Aaron P.; Reichart, Daniel E.; Ivarsen, Kevin M.; Haislip, Joshua B.; Nysewander, Melissa C.; Moore, Justin P. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC (United States); Oksanen, Arto [Caisey Harlingten Observatory, Caracoles 166, San Pedro de Atacama (Chile); Worters, Hannah L.; Sefako, Ramotholo R. [South African Astronomical Observatory, P.O. Box 9, Observatory 7935, Cape Town (South Africa); Mentz, Jaco [Unit for Space Physics, North-West University, Private Bag X6001, Potchefstroom 2520 (South Africa); Dvorak, Shawn; Gomez, Tomas; Harris, Barbara G.; Henden, Arne A.; Tan, Thiam Guan; Templeton, Matthew [American Association of Variable Star Observers, 49 Bay State Road, Cambridge, MA 02138 (United States); Allen, W. H. [Center for Backyard Astrophysics, Vintage Lane Observatory, RD 3, Blenheim (New Zealand); Monard, Berto [Center for Backyard Astrophysics, 538 W. 120th St., New York, NY 10027 (United States); and others
2011-12-01
The eruption of the recurrent nova U Scorpii on 2010 January 28 is now the all-time best observed nova event. We report 36,776 magnitudes throughout its 67 day eruption, for an average of one measure every 2.6 minutes. This unique and unprecedented coverage is the first time that a nova has had any substantial amount of fast photometry. With this, two new phenomena have been discovered: the fast flares in the early light curve seen from days 9-15 (which have no proposed explanation) and the optical dips seen out of eclipse from days 41-61 (likely caused by raised rims of the accretion disk occulting the bright inner regions of the disk as seen over specific orbital phases). The expanding shell and wind cleared enough from days 12-15 so that the inner binary system became visible, resulting in the sudden onset of eclipses and the turn-on of the supersoft X-ray source. On day 15, a strong asymmetry in the out-of-eclipse light points to the existence of the accretion stream. The normal optical flickering restarts on day 24.5. For days 15-26, eclipse mapping shows that the optical source is spherically symmetric with a radius of 4.1 R{sub Sun }. For days 26-41, the optical light is coming from a rim-bright disk of radius 3.4 R{sub Sun }. For days 41-67, the optical source is a center-bright disk of radius 2.2 R{sub Sun }. Throughout the eruption, the colors remain essentially constant. We present 12 eclipse times during eruption plus five just after the eruption.
Directory of Open Access Journals (Sweden)
Wilson Martins Lopes Junior
2009-12-01
Full Text Available Alterações na organização espacial das cidades expressam o surgimento de novas áreas com atividades comerciais, de serviços e também um fluxo que expressa á centralidade. Neste processo, ocorre a descontinuidade do território da cidade e a criação de novos espaços que representam a relação centro – periferia. A relação centro-periferia torna-se tema relevante no estudo de novas centralidades uma vez que a morfologia urbana é alterada diante da definição de novas centralidades e a formação de outras periferias. Deste modo a cidade através de seu tecido urbano apresenta uma dinâmica contraditória de concentração e descentralização dos espaços urbanos redefinindo a relação centro-periferia, que evidencia as novas centralidades. Portanto, a concentração e descentralização que ocorre no urbano refletem em nova dinâmica no espaço intra-urbano, apresentando novas centralidades atreladas às novas localizações de grupos – empresas de comércio e de serviços, favorecendo a fragmentação espacial. Finalmente tem-se a produção de espaços interiores na cidade com suas funções específicas como: produção, consumo, moradia, e outras que influem no valor destas áreas, de acordo com sua característica ou tipo de atividade. Assim, criam-se vários centros com funções distintas evidenciados primeiramente em metrópoles e grandes cidades e num segundo momento em cidades médias contrapondo-se a antiga cidade (pequena, com centro único.
Marrón-Ponce, Joaquín A; Sánchez-Pimienta, Tania G; Louzada, Maria Laura da Costa; Batis, Carolina
2018-01-01
To identify the energy contributions of NOVA food groups in the Mexican diet and the associations between individual sociodemographic characteristics and the energy contribution of ultra-processed foods (UPF). We classified foods and beverages reported in a 24 h recall according to the NOVA food framework into: (i) unprocessed or minimally processed foods; (ii) processed culinary ingredients; (iii) processed foods; and (iv) UPF. We estimated the energy contribution of each food group and ran a multiple linear regression to identify the associations between sociodemographic characteristics and UPF energy contribution. Mexican National Health and Nutrition Survey 2012. Individuals ≥1 years old (n 10 087). Unprocessed or minimally processed foods had the highest dietary energy contribution (54·0 % of energy), followed by UPF (29·8 %), processed culinary ingredients (10·2 %) and processed foods (6·0 %). The energy contribution of UPF was higher in: pre-school-aged children v. other age groups (3·8 to 12·5 percentage points difference (pp)); urban areas v. rural (5·6 pp); the Central and North regions v. the South (2·7 and 8·4 pp, respectively); medium and high socio-economic status v. low (4·5 pp, in both); and with higher head of household educational level v. without education (3·4 to 7·8 pp). In 2012, about 30 % of energy in the Mexican diet came from UPF. Our results showed that younger ages, urbanization, living in the North region, high socio-economic status and high head of household educational level are sociodemographic factors related to higher consumption of UPF in Mexico.
First inventory of the echinoderms from Juan de Nova (Iles Eparses ...
African Journals Online (AJOL)
Juan de Nova is one of the Iles Eparses, French islands scattered in the Mozambique Channel (Western India Ocean). They have been kept isolated of the anthropogenic influences which makes them rare areas to study biodiversity and provides elements of comparison with areas that are strongly impacted by urbanization ...
Serendipitous discovery of a dwarf Nova in the Kepler field near the G dwarf KIC 5438845
International Nuclear Information System (INIS)
Brown, Alexander; Ayres, Thomas R.; Neff, James E.; Wells, Mark A.; Kowalski, Adam; Hawley, Suzanne; Berdyugina, Svetlana; Harper, Graham M.; Korhonen, Heidi; Piskunov, Nikolai; Saar, Steven; Walkowicz, Lucianne
2015-01-01
The Kepler satellite provides a unique window into stellar temporal variability by observing a wide variety of stars with multi-year, near-continuous, high precision, optical photometric time series. While most Kepler targets are faint stars with poorly known physical properties, many unexpected discoveries should result from a long photometric survey of such a large area of sky. During our Kepler Guest Observer programs that monitored late-type stars for starspot and flaring variability, we discovered a previously unknown dwarf nova that lies within a few arcseconds of the mid-G dwarf star KIC 5438845. This dwarf nova underwent nine outbursts over a 4 year time span. The two largest outbursts lasted ∼17–18 days and show strong modulations with a 110.8 minute period and a declining amplitude during the outburst decay phase. These properties are characteristic of an SU UMa-type cataclysmic variable. By analogy with other dwarf nova light curves, we associate the 110.8 minute (1.847 hr) period with the superhump period, close to but slightly longer than the orbital period of the binary. No precursor outbursts are seen before the super-outbursts and the overall super-outburst morphology corresponds to Osaki and Meyer “Case B” outbursts, which are initiated when the outer edge of the disk reaches the tidal truncation radius. “Case B” outbursts are rare within the Kepler light curves of dwarf novae. The dwarf nova is undergoing relatively slow mass transfer, as evidenced by the long intervals between outbursts, but the mass transfer rate appears to be steady, because the smaller “normal” outbursts show a strong correlation between the integrated outburst energy and the elapsed time since the previous outburst. At super-outburst maximum the system was at V ∼ 18, but in quiescence it is fainter than V ∼ 22, which will make any detailed quiescent follow-up of this system difficult.
Pós-modernidade e novas tecnologias no discurso do professor de língua
Directory of Open Access Journals (Sweden)
Maria José R. Faria Coracini
2006-01-01
Full Text Available
Este texto pretende apresentar algumas reflexões em torno da identidade do professor, atravessada pelo discurso da pós modernidade na vertente que se apóia nas novas tecnologias como resultado do chamado progresso científico. Para este estudo, baseamo-nos nas teorias do discurso, na psicanálise e na filosofia derrideana, cuja tarefa é desconstruir o edifício logocêntrico da cultura ocidental. Depois de analisar 50 redações de professores, foi possível observar que coabitam crenças que remetem ao professor missionário e idealista e a mitificação das novas tecnologias como a solução para os problemas de método e de motivação. Chocam-se, assim, resistências ao passado e resistências às novas tecnologias, que perturbam a garantia do saber e, portanto, do poder do professor, enfatizando o saber do aluno. O desejo da tranqüilidade e do conforto da verdade e da totalidade, garantido pela Torre de Marfim, se fragiliza na insegurança e nas incertezas da Torre de Babel (reconstruída pela (pós-modernidade, em que vigoram a complexidade, a heterogeneidade e a impossibilidade de completude.
NOvA Event Building, Buffering and Data-Driven Triggering From Within the DAQ System
Energy Technology Data Exchange (ETDEWEB)
Fischler, M. [Fermilab; Green, C. [Fermilab; Kowalkowski, J. [Fermilab; Norman, A. [Fermilab; Paterno, M. [Fermilab; Rechenmacher, R. [Fermilab
2012-06-22
To make its core measurements, the NOvA experiment needs to make real-time data-driven decisions involving beam-spill time correlation and other triggering issues. NOvA-DDT is a prototype Data-Driven Triggering system, built using the Fermilab artdaq generic DAQ/Event-building tools set. This provides the advantages of sharing online software infrastructure with other Intensity Frontier experiments, and of being able to use any offline analysis module--unchanged--as a component of the online triggering decisions. The NOvA-artdaq architecture chosen has significant advantages, including graceful degradation if the triggering decision software fails or cannot be done quickly enough for some fraction of the time-slice ``events.'' We have tested and measured the performance and overhead of NOvA-DDT using an actual Hough transform based trigger decision module taken from the NOvA offline software. The results of these tests--98 ms mean time per event on only 1/16 of th e available processing power of a node, and overheads of about 2 ms per event--provide a proof of concept: NOvA-DDT is a viable strategy for data acquisition, event building, and trigger processing at the NOvA far detector.
Bioidentical hormone therapy: Nova Scotia pharmacists’ knowledge and beliefs
Whelan, Anne Marie; Thebeau, Jean-Pierre; Jurgens, Tannis M.; Hurst, Eileen
2012-01-01
Objectives: To investigate Nova Scotia (NS) pharmacists´ knowledge and beliefs regarding the use of bioidentical hormones (BHs) for the management of menopause related symptoms. Methods: Using Dillman´s tailored design methodology, an invitation to complete the web-based questionnaire was emailed to pharmacists in NS as part of the Dalhousie College of Pharmacy Continuing Pharmacy Education Department´s (CPE) weekly email update. Data was analyzed using descriptive statistics. Results: Of app...
Determining the neutrino mass hierarchy with INO, T2K, NOvA and reactor experiments
International Nuclear Information System (INIS)
Ghosh, Anushree; Choubey, Sandhya; Thakore, Tarak
2013-01-01
The relatively large measured value of θ 13 has opened up the possibility of determining the neutrino mass hierarchy through earth matter effects. Amongst the current accelerator experiments only NOvA has a long enough baseline to observe earth matter effects. However, even NOvA is plagued with uncertainty on the knowledge of the true value of Δ CP which drastically reduces its sensitivity to the neutrino mass hierarchy. Earth matter effects in atmospheric neutrinos on the other hand is almost independent of δ CP . The 50 kton magnetized Iron CALorimeter at the India-based Neutrino Observatory (ICAL at the rate lNO) will be observing atmospheric neutrinos. The charge identification capability of this detector gives it an edge over others for mass hierarchy determination through observation of earth matter effects. We study in detail the neutrino mass hierarchy sensitivity of the data from this experiment simulated using the Nuance based generator developed for ICAL at the rate lNO and folded with the detector resolution and efficiencies obtained by the INO collaboration from a full detector Geant based simulation. The data from ICAL at the rate lNO is then combined with simulated of T2K, NOvA Double Chooz, RENO and Daya Bay experiments and a combined sensitivity study to the mass hierarchy performed. With 10 years of ICAL at the rate lNO data combined with T2K, NOvA and reactor data, one could get 2.8σ - 5σ discovery for the neutrino mass hierarchy depending on the true value of (θ23, θ13 and δ CP . (author)
Determining the Neutrino Mass Hierarchy and CP Violation in NOvA with a Second Off-Axis Detector
Mena, O; Pascoli, S; Mena, Olga; Palomares-Ruiz, Sergio; Pascoli, Silvia
2006-01-01
We consider a Super-NOvA-like experimental configuration based on the use of two detectors in a long-baseline experiment as NOvA. We take the far detector as in the present NOvA proposal and add a second detector at a shorter baseline. The location of the second off-axis detector is chosen such that the ratio L/E is the same for both detectors, being L the baseline and E the neutrino energy. We consider liquid argon and water-Cherenkov techniques for the second off-axis detector and study, for different experimental setups, the detector mass required for the determination of the neutrino mass hierarchy, for different values of theta13. We also study the capabilities of such an experimental setup for determining CP violation in the neutrino sector. Our results show that by adding a second off-axis detector a remarkable enhancement on the capabilities of the current NOvA experiment could be achieved.
Urban Design - Architectural Workshop Nova Gorica
Directory of Open Access Journals (Sweden)
Anja Planišček
2012-01-01
Full Text Available The workshop ran through the 2008-09 academic year. The main themes were a thorough design of Magistrala, the main city street, and research of the spatial and programmatic development alongside it. The research was based on the original urban plan of Nova Gorica designed by architect Edvard Ravnikar in 1949.The workshop was divided into two phases. In the first phase, students researched the possibilities of an overall design for Magistrala (traffic arrangement, relations between built and vacant space, green spaces, public and private domain etc.. In the second phase, they proposed urban architectural interventions in the open spaces along Magistrala (university campus in the northern part of the city, student housing, residential areas, main square, law court, hotel etc..
Kaatsu training : novas perspectivas para o treinamento resistido
Deus, Lysleine Alves de
2012-01-01
Para que um treinamento resistido possa contribuir de forma eficaz para o aumento de força e hipertrofia, muitos são os fatores que interferem na sua elaboração. Estudos ao longo dos anos vinham relatando que o treinamento resistido executado com cargas altas era o método mais eficaz para o aumento de força e hipertrofia. Em contradição a essas teorias pesquisadores japoneses desenvolveram uma nova técnica em que o treinamento resistido (TR) é executado com baixa intensidade e pouco peso asso...
Pulse-power circuit diagnostics for the Nova laser
International Nuclear Information System (INIS)
Christie, D.J.; Dallum, G.E.; Gritton, D.G.; Merritt, B.T.; Whitham, K.; Berkbigler, L.W.
1982-01-01
The Nova laser will have a large pulse power system for driving laser amplifiers, incorporating approximately 1600 flashlamp circuits. An automated system has been designed for diagnosing the condition of these flashlamp circuits. It records digitized circuit current waveforms and detects current excursions above a given threshold. In addition, it is able to fire flashlamps at a low energy to ascertain the health of the system. Data from this system can be ploted for inspection by the operator, analyzed by the computer system and archived for future reference
Discovery of Five Probable Novae in M81
Hornoch, K.; Errmann, R.; Sowicka, P.; Humphries, N.; Vaduvescu, O.
2015-10-01
We report the discovery of five probable novae in M81 on a co-added 2000-s narrow-band H-alpha CCD image taken with the 2.5-m Isaac Newton Telescope (INT) + WFC at La Palma under ~1.5" seeing on 2015 Oct. 14.198 UT. The new objects are well visible on the co-added image (see the finding charts linked below), but are not present on numerous narrow-band H-alpha archival images from the INT down to limiting magnitude as faint as H-alpha = 22.3.
10% discount at Novae restaurants for students
2016-01-01
A 10% discount will be granted for students dining in restaurants 1 and 2 (on the Meyrin site) during the summer from 15 June 2016 to 15 September 2016. A special badge will be issued by the respective secretariats if the student fulfils the following criteria: Is under 25 years old; Is in possession of a student card issued by a University or college; Has a CERN contract > 1 month (Users, Summer Students, Trainees, etc). This badge and the CERN access card will have to be shown at the Novae restaurants in order to benefit from this discount.
Orbital periods of recurrent novae
International Nuclear Information System (INIS)
Schaefer, B.E.
1990-01-01
The class of recurrent novae (RN) with thermonuclear runaways contains only three systems (T Pyx, U Sco, and V394 CrA), for which no orbital periods are known. This paper presents a series of photometric observations where the orbital periods for all three systems are discovered. T Pyx is found to have sinusoidal modulation with an amplitude of 0.08 mag and a period of 2.3783 h (with a possible alias of 2.6403 h). U Sco is found to be an eclipsing system with an eclipse amplitude of roughly 1.5 mag and an orbital period of 1.2344 days. V394 CrA is found to have sinusoidal modulation with an amplitude of 0.5 mag and a period of 0.7577 days. Thus two out of three RN with thermonuclear runaways (or five out of six for all RN) have evolved companions. 16 refs
Directory of Open Access Journals (Sweden)
Prince Aian G. Villanueva
2015-08-01
Full Text Available Patronage politics has become a defining charac-teristic of the Philippine political landscape. Clientelism, a form of patronage, is often studied as disadvantageous in governance and democratic consolidation. While the patron-client framework remains the most influential among schools of thought that explain Philippine politics, transforma-tions in a clientelist exchange are evident given changes in political, cultural and economic settings. Using this frame of new clientelism, we look at and revisit the structure of patronage in the provision of housing welfare in the Philippines, focusing now on the roles of three important actors— the nongov-ernmental organization, the state through the local government and the recipients or beneficiaries— in an urban setting, thus deviating from the traditional conception of patronage and clientelist politics. This relationship of clientelist exchange is presented in our Accomplice-Principal-Accessory (APA model ofclientelism, with the local government unit of Parañaque City as accomplice, the Gawad Kalinga (GK as the principal agent, and the recipients or beneficiaries as accessories in the provision of hous-ing welfare.
Discovery, photometry, and astrometry of 49 classical nova candidates in M81 galaxy
Czech Academy of Sciences Publication Activity Database
Hornoch, Kamil; Scheirich, Peter; Garnavich, P.M.; Hameed, S.; Thilker, D. A.
2008-01-01
Roč. 492, č. 1 (2008), s. 301-317 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : M81 galaxy * novae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.153, year: 2008
International Nuclear Information System (INIS)
Patterson, Ryan; Backhouse, Christopher; Bays, Kirk; Lozier, Joseph; Pershey, Daniel
2016-01-01
The NOvA long-baseline neutrino experiment uses a fine-grained, low-Z, fully active detector that offers unprecedented electron neutrino identification capabilities for a detector of its scale. In this award's proposal, the PI outlined the development and implementation of novel techniques for channel readout, detector calibration, and event reconstruction that make full use of the strengths of the NOvA detector technology. In particular, this included designing custom event reconstruction algorithms that utilize the rich information available in the substructure of hadronic and electromagnetic showers. Exploiting this information provides not only substantial improvement in background rejection for the electron neutrino search but also better shower energy resolution (improving the precision on measured oscillation parameters) and a high-energy electromagnetic calibration source (through neutral pion events). The PI further proposed developing and deploying a new electronics readout scheme compatible with the existing hardware that can reduce near detector event pile-up and can offer powerful timing information to the reconstruction, allowing for cosmic ray muon tagging via track direction determination, among other things. In conjunction with the above, the PI proposed leading the calibration of the NOvA detectors, including characterizing individual electronics channels, correcting for spatial variations across the detector, and establishing absolute event energy scales. All three of these lines of effort have been successfully completed, feeding directly into the NOvA's recent exciting neutrino oscillation results. The techniques developed under this award are detailed in this final technical report.
An estimate of the system parameters in the dwarf nova IP Peg
International Nuclear Information System (INIS)
Wood, Janet; Crawford, C.S.
1986-01-01
High-speed photometry of the eclipsing dwarf nova IP Peg is used to estimate the geometry of the binary system and the masses of its components. A white dwarf eclipse width between 0.0863 and 0.0918, is found and hence constraints on the mass ratio, q, of 0.35#lt#q#lt#0.49 and on the inclination, i, of 80 0 .9#lt#i#lt#90 0 . The white dwarf is surrounded by an extended boundary layer and has a mass of at least Msub(WD) approx.0.3 solar mass, probably much greater, depending on the thickness of the boundary layer and the orbital inclination. Its mass could be as high as 0.9 solar mass for an inclination of 80 0 .9. The mass of the secondary star is greater than 0.09 solar mass probably a lot higher. IP Peg could be earlier in the evolutionary sequence of dwarf novae than the ultra-short-period system (P#lt#2hr). (author)
Directory of Open Access Journals (Sweden)
Erin Morton
2014-10-01
Full Text Available This article will examine the development of a state-sponsored therapeutic craft regime in Nova Scotia in the early to mid-twentieth century. Built on the notion that postwar residents needed "work therapy - not a vacation, but a hardening process" (Black n.d. a: 3 - therapeutic craft emerged in Nova Scotia through a complex combination of the individualization of work habits, the desire to construct an antimodern regional identity around handwork, and the notion that both infirm patients and the province as a whole could be healed from economic stagnation through craft. Key to the success of Nova Scotia's therapeutic craft regime was occupational therapist Mary E. Black's career as director of the provincial government's Handicrafts and Home Industries Division from 1943 to 1955. Black's healthcare training led her to seek out therapeutic possibilities in everyday work activities, not to mention a therapeutic solution to what she called "the atti-tude of most Nova Scotians"[:] defeatism" (Black 1949: 46. Her ability to turn seemingly disparate things - such as Scandinavian design, the ordered work of occupational rehabilitation, and a phenomenological focus on what she called “in-dividualistic existence” (Black n.d. b: 2 - into a unified therapeutic solution demonstrates that the contemporary rise of therapeutic culture under the increased individualism of the neoliberal era has an established historical root in the postwar period that remains important to understand.
Stellar activity with LAMOST - II. Chromospheric activity in open clusters
Fang, Xiang-Song; Zhao, Gang; Zhao, Jing-Kun; Bharat Kumar, Yerra
2018-05-01
We use the LAMOST spectra of member stars in Pleiades, M34, Praesepe, and Hyades to study how chromospheric activity varies as a function of mass and rotation at different age. We measured excess equivalent widths of H α, H β, and Ca II K based on estimated chromospheric contributions from old and inactive field dwarfs, and excess luminosities are obtained by normalizing bolometric luminosity, for more than 700 late-type stars in these open clusters. Results indicate two activity sequences in cool spot coverage and H α excess emission among GK dwarfs in Pleiades and M dwarfs in Praesepe and Hyades, paralleling with well-known rotation sequences. A weak dependence of chromospheric emission on rotation exists among ultrafast rotators in saturated regime with Rossby number Ro ≲ 0.1. In the unsaturated regime, chromospheric and coronal emission show similar dependence on Ro, but with a shift towards larger Ro, indicating chromospheric emission gets easily saturated than coronal emission, and/or convective turnover time-scales based on X-ray data do not work well with chromospheric emission. More interestingly, our analysis shows fully convective slow rotators obey the rotation-chromospheric activity relation similar to hotter stars, confirming the previous finding. We found correlations among H α, H β, and Ca II K emissions, in which H α losses are more important than Ca II K for cooler and more active stars. In addition, a weak correlation is seen between chromospheric emission and photospheric activity that shows dependence on stellar spectral type and activity level, which provides some clues on how spot configuration varies as a function of mass and activity level.
Energy Technology Data Exchange (ETDEWEB)
Buszynski, M.E.; Peacock, T. [Sempra Atlantic Gas Inc., Halifax, NS (Canada)
2000-07-01
The discovery of large natural gas reserves off the Scotian Shelf has resulted in the development and construction of offshore production platforms as well as underwater and onshore pipelines to transport natural gas to markets on the eastern seaboard. A billion-dollar expenditure is proposed to establish a local distribution company to construct and maintain approximately 8000 km of distribution and lateral pipelines in the province of Nova Scotia. The many aspects of the proposed program were described with particular focus on the regulatory hearings. The paper also discussed the different landscapes that will be crossed and the specialized construction techniques that will be used to meet environmental and economic challenges. The mechanisms in place to ensure maximum benefit for Nova Scotians were also discussed. The proposed project was also compared to other local megaprojects in the province such as the Sable Offshore Energy Project and the Interprovincial Pipeline through Nova Scotia and New Brunswick. Some of the successful strategies for implementing benefits plans related to large energy projects were also described. Sempra has been awarded the franchise to distribute natural gas in Nova Scotia. The company has developed a benefits plan that offers significant local involvement in terms of labour and materials. 4 figs.
Energy Technology Data Exchange (ETDEWEB)
Sulatisky, M. [Saskatchewan Research Council, Saskatoon, SK (Canada); Ghelesel, A. [BC Gas International, Vancouver, BC (Canada)
1999-07-01
The elements of natural gas vehicle conversion technology are described as background to a discussion of the development of bi-fuel injection system for the Rumanian-manufactured DACIA-NOVA automobile. The bi-fuel injection system mirrors the fueling system installed by the original equipment manufacturer; it can also be easily installed on Ford, General Motors and DaimlerChrysler vehicles as well as on most imports.To meet emission standards after 2000, it is envisaged to install on the DACIA NOVA a neural control system (NCS) and a completely adaptive linear control system (ACLS). Details of natural gas vehicles development and the development of NCS and ACLS are discussed, including short-term and long-term objectives.
The HEPCloud Facility: elastic computing for High Energy Physics - The NOvA Use Case
Fuess, S.; Garzoglio, G.; Holzman, B.; Kennedy, R.; Norman, A.; Timm, S.; Tiradani, A.
2017-10-01
The need for computing in the HEP community follows cycles of peaks and valleys mainly driven by conference dates, accelerator shutdown, holiday schedules, and other factors. Because of this, the classical method of provisioning these resources at providing facilities has drawbacks such as potential overprovisioning. As the appetite for computing increases, however, so does the need to maximize cost efficiency by developing a model for dynamically provisioning resources only when needed. To address this issue, the HEPCloud project was launched by the Fermilab Scientific Computing Division in June 2015. Its goal is to develop a facility that provides a common interface to a variety of resources, including local clusters, grids, high performance computers, and community and commercial Clouds. Initially targeted experiments include CMS and NOvA, as well as other Fermilab stakeholders. In its first phase, the project has demonstrated the use of the “elastic” provisioning model offered by commercial clouds, such as Amazon Web Services. In this model, resources are rented and provisioned automatically over the Internet upon request. In January 2016, the project demonstrated the ability to increase the total amount of global CMS resources by 58,000 cores from 150,000 cores - a 38 percent increase - in preparation for the Recontres de Moriond. In March 2016, the NOvA experiment has also demonstrated resource burst capabilities with an additional 7,300 cores, achieving a scale almost four times as large as the local allocated resources and utilizing the local AWS s3 storage to optimize data handling operations and costs. NOvA was using the same familiar services used for local computations, such as data handling and job submission, in preparation for the Neutrino 2016 conference. In both cases, the cost was contained by the use of the Amazon Spot Instance Market and the Decision Engine, a HEPCloud component that aims at minimizing cost and job interruption. This paper
A White Dwarf at the Limit: V838 Herculis 25 Years After Its Nova Outburst
Garnavich, Peter; Kennedy, Mark; Littlefield, Colin; Szkody, Paula; Mukadam, Anjum
2018-01-01
We present time-resolved photometry and spectroscopy of V838 Her (aka Nova Herculis 1991) a quarter of a century after its unique nova outburst. No new optical observations of the star have been published since the early 1990s. Here, we confirm the presence of deep primary eclipses with a period of 7.14 hours and we detect clear secondary minima. Night-to-night changes of 30% in the system brightness suggests the mass transfer rate is not stable. Spectroscopy reveals absorption features from the secondary star consistent with a K4±1.5 spectral type. From the velocity amplitudes we directly measure the mass ratio of the binary to be q=0.73±0.04. Assuming the secondary is filling its Roche lobe, we estimate the white dwarf mass to be 1.38±0.13 M⊙, consistent with the indirect mass indicators such as the early light curve decay rate and metal abundance in the nebular phase. The mass of the secondary star is also quite high at 1.01±0.06 M⊙. We estimate that the luminosity of the nova peaked at MV = –9.1±0.4 mag, and that its current luminosity is MV = 6.5±0.4 mag.
Photometric and spectroscopic observations of the Nova Cygni 1975= the V1500 Cygni
International Nuclear Information System (INIS)
Rosino, L.; Tempesti, P.
1977-01-01
The results of a photometric and spectroscopic study of Nova V1500 Cyg carried out jointly at the Observatories of Teramo (photoelectric photometry) and Asiago (spectroscopy) have presented. The brightness curve was distinguished by a sharp maximum and a steep fall. The Nova was remarkable for its very large amplitude (>18sup(m).5), the extremely rapid decline (t 2 =2sup(d)x5; t 3 =3sup(d)x9) and the high luminosity at maximum -10.25. The existence of a rapid brightness fluctuation with period 0sup(d).14096 was discovered. The pulsation showed variable amplitude, but the period was constant in the whole interval covered by long night runs of observation. The spectrum near maximum and during the first decline was characterized by the presence of wide emission bands, shortward accompanied by broad diffuse absorption features with mean radial velocities increasing from - 1700 on August 30-31 to -4200 km/s on Sep 23 when the absorptions disappeared. The emission bands were very broad and many of them overlapped. The expansion velocity derived by the half-width of the bright bands increased from 860 km/s to 1500 km/s on Sep 3, then remaining sensibly constant. The profiles of these bands were complex, of changing form, with several maxima and a saddle - shaped structure. The spectral evolution was rapid, the excitation went steadily increasing and the Nova entered in the nebular stage between 9-12 September. This phase was characterized by the strengthening of the forbidden lines of [Ne 3] lambda lambda 3869-3968, [O 3] lambda lambda 4363, 4958-5007, [N 2] 5754 and the permitted lines of N 3 4640, He 1 and He 2 lambda 4686, which soon became prominent. Later, at the end of September and the beginning of October, also emission lines of [Ne 5], [Ca 5], [Fe 6] and [Fe 7] appeared and rapidly strengthened. At the end of the year the forbidden line of [Fe 7] at lambda 6087 was still rising, being already as strong as He 1 lambda 5875. Some general considerations on the
Nova control system: goals, architecture, and system design
International Nuclear Information System (INIS)
Suski, G.J.; Duffy, J.M.; Gritton, D.G.; Holloway, F.W.; Krammen, J.R.; Ozarski, R.G.; Severyn, J.R.; Van Arsdall, P.J.
1982-01-01
The control system for the Nova laser must operate reliably in a harsh pulse power environment and satisfy requirements of technical functionality, flexibility, maintainability and operability. It is composed of four fundamental subsystems: Power Conditioning, Alignment, Laser Diagnostics, and Target Diagnostics, together with a fifth, unifying subsystem called Central Controls. The system architecture utilizes a collection of distributed microcomputers, minicomputers, and components interconnected through high speed fiber optic communications systems. The design objectives, development strategy and architecture of the overall control system and each of its four fundamental subsystems are discussed. Specific hardware and software developments in several areas are also covered
Marine renewable energy legislation for Nova Scotia : policy background paper
International Nuclear Information System (INIS)
2010-07-01
Marine renewable energy sources can provide Nova Scotia with a large supply of sustainable, non-carbon emitting electricity. One of the largest tidal ranges within the world is contained within the Bay of Fundy, which holds power potential in the form of wind, wave and tidal energy. A strategic environmental assessment (SEA) on the Bay of Fundy's potential marine renewable energy was published in 2008. An assessment of the social, economic, and environmental effects and factors linked with possible development of renewable energy sources in the Bay Fundy was published. Twenty-nine recommendations were offered, including the creation of marine renewable energy legislation incorporating sustainability principles. This discussion paper described the policy drivers and opportunities in Nova Scotia for marine renewable energy sources as well as the challenges and relevant subject areas that should be considered when creating marine renewable energy legislation and policy. Specific challenges that were discussed included a policy approach to development; multiple jurisdictions; Aboriginal issues; economic factors; environmental impacts; occupational and operation safety; allocation of rights; and regulatory issues. It was concluded that if the marine renewable energy resource was going to be created with the possibility of providing commercial electricity generation, a coordinated legislative framework should be established. refs., tabs.
Clinical characteristics, treatment and outcome of children with Lyme arthritis in Nova Scotia.
Glaude, Pier Diane; Huber, Adam M; Mailman, Timothy; Ramsey, Suzanne; Lang, Bianca; Stringer, Elizabeth
2015-10-01
Lyme disease is an emerging problem in Nova Scotia. Lyme arthritis is a late manifestation of Lyme disease. To describe the demographic characteristics, referral patterns and clinical course of children diagnosed with Lyme arthritis in a tertiary care pediatric rheumatology clinic in Nova Scotia. In the present retrospective chart review, subjects diagnosed with Lyme arthritis between 2006 and 2013 were identified through the clinic database. Demographic variables, referral patterns, clinical presentation and information regarding treatment course and outcome were collected. Seventeen patients were identified; 76% presented in 2012 and 2013. In 37.5% of cases, the referring physician suspected Lyme disease. Most patients presented with one or more painful and/or swollen joints; 94% had knee involvement. Only three of 17 patients had a history of erythema migrans and four of 17 recalled a tick bite. Five patients had a history of neurological manifestations consistent with Lyme disease, although, none had a diagnosis made at the time. Arthritis usually resolved after treatment with standard antibiotics; however, at last follow-up, two patients had antibiotic refractory Lyme arthritis, with one having joint damage despite aggressive arthritis treatment. A significant increase in cases of Lyme arthritis has recently been recognized in a pediatric rheumatology clinic in Nova Scotia. A history of a tick bite or erythema migrans were not sensitive markers of Lyme arthritis, and this diagnosis was often not considered by the referring physician. Educational initiatives should be undertaken to increase local awareness of this treatable cause of arthritis in children.
Limnological reconnaissance of a Nova Scotian brown-water lake
Energy Technology Data Exchange (ETDEWEB)
Smith, M W
1961-01-01
Summer hydrography and biota of a Nova Scotian brown-water lake are described. A bloom of a dinoflagellate was noted. Zooplankton was plentiful. With a range in pH of 4.3 to 4.8, mollusks were absent. Chaoborus dominated in the poor bottom fauna. Standing crop of fish was low at 19 kg per ha. Yellow perch were most numerous, exhibiting a decline in growth rate to age III, then increasing when the fish reached a size to be piscivorous. Fish-cultural implications are briefly discussed.
Far Ultraviolet Spectroscopy of Three Long Period Nova-Like Variables, V363 Aur, AC Cnc and RZ Gru
Bisol, Alexandra; Sion, E. M.
2011-01-01
We have selected three nova-like variables: V363 Aur, RZ Gru and AC Cnc, all of which are UX UMa types, having similar orbital periods well beyond the 3 to 4 hour range where most nova-likes are found. All should have very similar secondary stars given the fact that they their physical parameters are so similar. V363 Aur is a bona fide SW Sex star, and AC Cnc is a probable one, while RZ Gru is not a member of the SW Sex subclass. Our objective is to carry out the first synthetic spectral analysis of far ultraviolet spectra of the three systems using state-of-the-art models both of accretion disks and photospheres. Therefore we shall compare the distances we obtain from the best fitting synthetic spectral models to other distance estimates in the literature. We present model-derived accretion rates and distances for all three systems. The FUV flux range of RZ Gru and V363 Aur is dominated by radiation from an optically thick, steady state, accretion but for AC Cnc, we find that a hot white dwarf accounts for 70% of the FUV flux. We compare the FUV characteristics and physical properties of these three long period nova-like systems to the properties of other nova-likes at shorter periods. This work was supported in part by NSF grant AST0807892 to Villanova University.
Murray, Jock
2003-10-01
The Medical Humanities Program at Dalhousie University Faculty of Medicine in Nova Scotia, Canada, was initiated in 1992 to incorporate the medical humanities into the learning and experiences of medical students. The goal of the program was to gain acceptance as an integral part of the medical school. The program assumed a broad concept of the medical humanities that includes medical history, literature, music, art, multiculturalism, philosophy, epistemology, theology, anthropology, professionalism, history of alternative therapies, writing, storytelling, health law, international medicine, and ethics. Phase I of the program has provided the same elective and research opportunities in the medical humanities that are available to the students in clinical and basic sciences, and has encouraged and legitimized the involvement of the humanities in the life and learning of the medical student through a wide array of programs and activities. Phase II will focus on further incorporation of the humanities into the curriculum. Phase III will be the development of a graduate program in medical humanities to train more faculty who will incorporate the humanities into their teaching and into the development of education programs.
Indústria fonográfica e a Nova Produção Independente: o futuro da música brasileira?
Directory of Open Access Journals (Sweden)
Leonardo De Marchi
2008-09-01
Full Text Available Neste artigo, relaciona-se a rápida consolidação da indústria fonográfica independente no Brasil, ou Nova Produção Independente, às transformações promovidas pelas novas tecnologias da informação e da comunicação e pela recente economia do entretenimento. Argumenta-se que o surgimento dessas empresas se dá não por uma “crise” da indústria de música, mas pela complexificação da cadeia produtiva da fonografia, reorganizada pelo surgimento de novas tecnologias e hábitos de consumo de gravações sonoras na era digital. Palavras-chave: Indústria fonográfica brasileira; produção independente; novas tecnologias da informação e da comunicação. ABSTRACT In the article, the fast consolidation of the Brazilian phonographic independent industry, or New Independent Production, is related to the transformations promoted by the new information and communication technologies and the new entertainment economy. As argued, the appearance of these companies does not result from a “crisis” of the music industry, but from the complexification of the phonographic productive chain, reorganized by the appearance of new technologies and habits of consumption of sound recordings in the digital era. Keywords: Brazilian phonographic industry; indies; new information and communication technologies.
International Nuclear Information System (INIS)
Sauter, H.; Meyder, R.; Philipp, P.; Samstag, M.
1995-01-01
The NOVA program was continued with turbulent, vertical, upward two-phase flow experiments. The development of a local gas distribution along the test section was visualized by X-ray tomography. (orig.)
A Trojan Horse Approach to the Production of {sup 18}F in Novae
Energy Technology Data Exchange (ETDEWEB)
Cognata, M. La; Pizzone, R. G.; Cherubini, S.; Gulino, M.; Rapisarda, G. G.; Spitaleri, C. [INFN—Laboratori Nazionali del Sud, Catania (Italy); José, J. [Departament de Física, EEBE, Universitat Politècnica de Catalunya, E-08019 Barcelona (Spain); Hernanz, M., E-mail: lacognata@lns.infn.it [Institut d’Estudis Espacials de Catalunya, E-08034 Barcelona (Spain)
2017-09-01
Crucial information on nova nucleosynthesis can be potentially inferred from γ -ray signals powered by {sup 18}F decay. Therefore, the reaction network producing and destroying this radioactive isotope has been extensively studied in the last years. Among those reactions, the {sup 18}F(p, α ){sup 15}O cross-section has been measured by means of several dedicated experiments, both using direct and indirect methods. The presence of interfering resonances in the energy region of astrophysical interest has been reported by many authors including the recent applications of the Trojan Horse Method. In this work, we evaluate what changes are introduced by the Trojan Horse data in the {sup 18}F(p, α ){sup 15}O astrophysical factor recommended in a recent R-matrix analysis, accounting for existing direct and indirect measurements. Then the updated reaction rate is calculated and parameterized and implications of the new results on nova nucleosynthesis are thoroughly discussed.
Measurement of Muon Neutrino Disappearance with the NOvA Experiment
Energy Technology Data Exchange (ETDEWEB)
Vinton, Luke [Sussex U.
2018-01-01
The NOvA experiment consists of two functionally identical tracking calorimeter detectors which measure the neutrino energy and flavour composition of the NuMI beam at baselines of 1~km and 810~km. Measurements of neutrino oscillation parameters are extracted by comparing the neutrino energy spectrum in the far detector with predictions of the oscillated neutrino energy spectra that are made using information extracted from the near detector. Observation of muon neutrino disappearance allows NOvA to make measurements of the mass squared splitting $\\Delta m^2_{32}$ and the mixing angle $\\theta_{23}$. The measurement of $\\theta_{23}$ will provide insight into the make-up of the third mass eigenstate and probe the muon-tau symmetry hypothesis that requires $\\theta_{23} = \\pi/4$. This thesis introduces three methods to improve the sensitivity of NOvA's muon neutrino disappearance analysis. First, neutrino events are separated according to an estimate of their energy resolution to distinguish well resolved events from events that are not so well resolved. Second, an optimised neutrino energy binning is implemented that uses finer binning in the region of maximum muon neutrino disappearance. Third, a hybrid selection is introduced that selects muon neutrino events with greater efficiency and purity. The combination of these improvements produces an increase in the sensitivity of the analysis equivalent to collecting 40-100\\% more data across the range of possible values of $\\Delta m^2_{32}$ and $\\sin^2\\theta_{23}$. This thesis presents new results using a 14~ktonne detector equivalent exposure of $6.05\\times 10^{20}$~protons~on~target. A fit to the far detector data, assuming normal hierarchy, produces $\\Delta m^2_{32}=2.45^{+0.087}_{-0.079}\\times10^{-3}~\\text{eV}^2$ and $\\sin^2\\theta_{23}$ in the range 0.429~-~0.593 with two statistically degenerate best fit points at 0.481 and 0.547. This measurement is consistent with maximal mixing where $\\theta
Dwarf novae in outburst: monitoring WX Hydri with IUE
International Nuclear Information System (INIS)
Hassall, B.J.M.; Pringle, J.E.; Verbunt, F.
1985-01-01
WX Hydri has been monitored with the IUE satellite. The data obtained during the beginning of an outburst show that the rise of the optical precedes that of the ultraviolet flux. The observations during quiescence, together with archival data, indicate that the ultraviolet continuum and line fluxes decrease steadily between outbursts. The implications of the observations for the theoretical models of dwarf nova outbursts are discussed. It is concluded that the variable mass transfer model can accommodate the observations, but that difficulties arise for the disc instability model. (author)
CERN. Geneva
2012-01-01
The NOvA experiment at Fermi National Accelerator Lab, has been designed and optimized to perform a suite of measurements critical to our understanding of the neutrino’s properties, their oscillations and their interactions. NOvA presents a unique set of data acquisition and computing challenges due to the immense size of the detectors, the data volumes that are generated through the continuous digitization of the frontend systems, and the need to buffer the full data stream to allow for highly asynchronous triggering and extraction of physics events. These challenges are compounded by the stringent timing and synchronization requirements that are placed on the acquisition systems by the need to precisely correlate information between the accelerator complex and the remote detector locations. The NOvA Data Acquisition system has been designed and built to meets these challenges. The system utilizes a highly modular, novel acquisition and event building scheme, which has been deployed on a large hierarch...
Wang, P; Afriyie-Gyawu, E; Tang, Y; Johnson, N M; Xu, L; Tang, L; Huebner, H J; Ankrah, N-A; Ofori-Adjei, D; Ellis, W; Jolly, P E; Williams, J H; Wang, J-S; Phillips, T D
2008-05-01
The efficacy of NovaSil clay (NS) to reduce aflatoxin (AF) biomarkers of exposure was evaluated in 656 blood samples and 624 urine samples collected from study participants during a 3-month phase IIa clinical intervention trial in Ghana. NS was delivered before meals via capsules. Serum AFB (1)-albumin adduct was measured by radioimmunoassay and urinary AFM (1) metabolites were quantified by immunoaffinity-high-performance liquid chromatography (HPLC)-fluorescence methods. Levels of AFB (1) -albumin adduct in serum samples collected at baseline and at 1 month were similar (p = 0.2354 and p = 0.3645, respectively) among the placebo (PL), low dose (LD, 1.5 g NS day (-1)), and high dose (HD, 3.0 g NS day (-1)) groups. However, the levels of AFB (1)-albumin adduct at 3 months were significantly decreased in both the LD group (p clay can be used to reduce effectively the bioavailability of dietary AF based on a reduction of AF-specific biomarkers.
Directory of Open Access Journals (Sweden)
Juliano Issakowicz
2014-03-01
Full Text Available The aim of this study was to evaluate the carcass and meat traits of Morada Nova, Santa Ines and ½ Ile de France ½ Texel lambs finished in feedlot. Weight and proportion of meatcuts, measures of carcass size and color, tenderness, cooking loss and ultimate pH of meat from 10 Morada Nova, 6 Santa Ines and 10 ½ Ile de France ½ Texel were evaluated. The lambs were finished in collective pens, fed ad libitum with 50% corn silage and 50% concentrate and slaughtered at about six months old. Analysis of variance was performed by the procedure PROC GLM of SAS (SAS Inst., Inc., Cary, NC and means were compared by Tukey test at 5% significance. The Morada Nova lambs had values of 14.1 kg, 13.9 kg, 0.240 kg/cm, 56.2 cm and 35.8 cm for hot and cold carcass weight, compactness index, hip and leg circumference respectively and these values were lower (P <0.05 to values observed in Santa Ines (19.4 kg, 18.8 kg, 0.283 cm/kg, 64.6 cm and 40.0 cm and in ½ Ile de France ½ Texel (18.6 kg, 18.2 kg, 0.305 cm/kg; 65.4 cm and 41.6 cm lambs. The hot and cold carcass yield did not differ (P> 0.05 among genetic groups. The scores for conformation and fat cover were higher (P <0.05 in ½ Ile de France ½ Texel lambs (2.4 and 3.0 and the carcass length was greater in Santa Ines lambs (66.3 cm. The ½ Ile de France ½ Texel lambs had smaller (P<0.05 proportion of neck and greater of leg (9.10% and 33.1% compared to Morada Nova lambs (10.3% and 30.4% and Santa Inês (10.9% and 31.6%. The weight of shoulder, leg, rack, ribs and flank was lower (P<0.05 in Morada Nova (1.306, 2.127 kg, 0.999 kg, 0.775 kg and 0.433 kg respectively compared to Santa Inês (1.820 kg, 2.972 kg, 1.355 kg, 0.959 and 0.509 kg and ½ Ile de France ½ Texel (1.791 kg, 3.007 kg, 1.212 kg, 1.016 kg and 0.563 kg. The neck was heavier in Santa Ines (1.038 kg which differed (P <0.05 from the other genetic groups (0.725 kg for Morada Nova and 0.830 kg for ½ Ile de France x ½ Texel lambs. The ½ Ile de
'Haruna': uma nova mutação somática natural da videira 'Itália'
Directory of Open Access Journals (Sweden)
Adriane Marinho de Assis
2013-03-01
Full Text Available O objetivo deste estudo foi descrever as principais características físico-químicas e produtivas da uva fina de mesa 'Haruna', uma nova mutação natural originada da cv. Itália, em Uraí-PR, Brasil. O formato das bagas, elipsoide alongado bastante expressivo, é uma das características que mais difere essa nova mutação da uva 'Itália'. As bagas apresentam coloração verde-clara, tendendo ao amarelo na maturação plena, com pincel e polpa verde, crocante, firme, textura carnosa e de sabor moscatel, enquanto os cachos apresentam formato cilíndrico-cônico. O ciclo, bem como o desempenho produtivo e a suscetibilidade às doenças fúngicas assemelham- se aos da cv. Itália. Durante a maturação plena, apresenta teor médio de sólidos solúveis de 16,2ºBrix, superior à 'Itália, 0,5% de ácido tartárico e índice de maturação de 31,2. Trata-se de uma nova cultivar de uva fina de mesa com bom potencial de cultivo no Brasil.
Heterothalamus rupestris, espécie nova de Asteraceae do Rio Grande do Sul.
Directory of Open Access Journals (Sweden)
Leonardo Paz Deble
2010-08-01
Full Text Available Na revisão botânica do gênero Heterothalamus Less., foi descoberta uma nova espécie, endêmica da Serra do Sudeste do Rio Grande do Sul (Brasil que, a seguir, é descrita, ilustrada e comparada com sua espécie afim.
The HEPCloud Facility: elastic computing for High Energy Physics – The NOvA Use Case
Energy Technology Data Exchange (ETDEWEB)
Fuess, S. [Fermilab; Garzoglio, G. [Fermilab; Holzman, B. [Fermilab; Kennedy, R. [Fermilab; Norman, A. [Fermilab; Timm, S. [Fermilab; Tiradani, A. [Fermilab
2017-03-15
The need for computing in the HEP community follows cycles of peaks and valleys mainly driven by conference dates, accelerator shutdown, holiday schedules, and other factors. Because of this, the classical method of provisioning these resources at providing facilities has drawbacks such as potential overprovisioning. As the appetite for computing increases, however, so does the need to maximize cost efficiency by developing a model for dynamically provisioning resources only when needed. To address this issue, the HEPCloud project was launched by the Fermilab Scientific Computing Division in June 2015. Its goal is to develop a facility that provides a common interface to a variety of resources, including local clusters, grids, high performance computers, and community and commercial Clouds. Initially targeted experiments include CMS and NOvA, as well as other Fermilab stakeholders. In its first phase, the project has demonstrated the use of the “elastic” provisioning model offered by commercial clouds, such as Amazon Web Services. In this model, resources are rented and provisioned automatically over the Internet upon request. In January 2016, the project demonstrated the ability to increase the total amount of global CMS resources by 58,000 cores from 150,000 cores - a 25 percent increase - in preparation for the Recontres de Moriond. In March 2016, the NOvA experiment has also demonstrated resource burst capabilities with an additional 7,300 cores, achieving a scale almost four times as large as the local allocated resources and utilizing the local AWS s3 storage to optimize data handling operations and costs. NOvA was using the same familiar services used for local computations, such as data handling and job submission, in preparation for the Neutrino 2016 conference. In both cases, the cost was contained by the use of the Amazon Spot Instance Market and the Decision Engine, a HEPCloud component that aims at minimizing cost and job interruption. This paper
Cotta-Schønberg, Michael
2015-01-01
During his stay in Siena, in the spring of 1459, Pope Pius II received a number of embassies from the rulers of Europe coming to present the declaration of their lord’s obedience to the Apostolic See and the new pope. In his oration, Quotiens nova, to the ambassadors of Duke Louis of Savoy, the pope asserts the papal supremacy in all matters, spiritual and temporal, by virtue of the unlimited mission entrusted to the Apostle Peter by Jesus Christ. This mission and the power of the apostolic o...
Development Application - Terra Nova Development - Development Application Summary
International Nuclear Information System (INIS)
1996-01-01
This summary is part of the application for approval of the development of the Terra Nova Field off the coast of Newfoundland, prepared and submitted by Petro-Canada, on behalf of, and with the cooperation of its co-proponents. The full application consists of five parts, comprising the development plan itself, the Canada-Newfoundland benefits plan detailing commitments with regards to contracts and employment, the environmental impact statement concerning the impact of development on the physical and biological environment, and a statement of socio-economic impacts, characterizing existing and projected impacts of the development on the fisheries, industry, employment, demography, social and public infrastructures and facilities, and socio-cultural issues
Interpretation of eclipsing light curves of dwarf novae
International Nuclear Information System (INIS)
Matvienko, A.N.; Cherepashchuk, A.M.; Yagola, A.G.
1988-01-01
The method for interpretation of eclipsing light curves of dwarf novae is proposed, taking into account the influence of the hot spot situated in the outer part of the disk-like envelope surrounding a white dwarf. This method is applied to the analysis of the eclipsing light curves of the system Z Cha in the quiet and active stages. It is shown that the optical luminosity of the hot spot in the system Z Cha in the active stage is 3-5 times greater than that in the quiet stage. Radius of the disk-like envelope in the active stage is more than twice greater than that in the quiet stage
Multiwavelength monitoring of the dwarf nova VW Hydri
International Nuclear Information System (INIS)
Amerongen, S. van; Damen, E.; Groot, M.; Kraakman, H.; Parakijs, J. van
1987-01-01
Results are presented of five-colour photometric observations (Walraven system) of VW Hyi, made between 1984 July and November, as part of a long-term multiwavelength study of this dwarf nova. The average orbital light and colour curves during quiescence are accurately defined. Apart from a slow decay following outburst during the first quarter of a quiescent interval, neither the average brightness nor the maximum and minimum brightness show a significant secular trend between outbursts. The 3σ upper limits to a secular change in average brightness during the last three-quarters of a quiescent interval range between 0.16 and 0.20 mag in the five passbands. (author)
Directory of Open Access Journals (Sweden)
Andrew Molloy
2010-03-01
Full Text Available Canadian governments are facing significant human resource management challenges due to pending retirements, projected labour market shortages and the workplace expectations of New Professionals. This paper explores human resource recruitment planning initiatives, which have been undertaken by Nova Scotia municipalities, in order to attract and retain a new generation of municipal government managers. We will argue, in line with a recent Association of Municipal Administrators (AMA of Nova Scotia municipal report that Nova Scotia municipalities must take intergenerational issues into account, for management succession planning to be successful. Our exploration of municipal succession planning will take place in the context of a larger study, which we have done on “New Professional” recruitment, retention and development initiatives in Canada
Energy Technology Data Exchange (ETDEWEB)
Ellermann, T.; Hertel, O.; Ambelas Skjoeth, C.; Kemp, K.; Monies, C.
2004-12-01
This report presents measurements and calculations from the atmospheric part of NOVA 2003 and covers results for 2003. It summarises the main results concerning concentrations and depositions of nitrogen, phosphorous and sulphur compounds related to eutrofication and acidification and selected heavy metals. Depositions of atmospheric compounds to Danish marine waters as well as land surface are presented. The measurements in the monitoring programme are supplemented with model calculations of concentrations and depositions of nitrogen and sulphur compounds to Danish land surfaces as well as marine waters, fjords and bays using the ACDEP model (Atmospheric Chemistry and Deposition). The model is a so-called trajectory model and simulates the physical and chemical processes in the atmosphere using meteorological and emission data input. (BA)
Arandas, Janaina Kelli Gomes; Alves, Ângelo Giuseppe Chaves; Facó, Olivardo; Belchior, Ernandes Barboza; Shiotsuki, Luciana; de Arruda Leite, Paulo Márcio Barbosa; Ribeiro, Maria Norma
2017-10-01
The implementation of sustainable breeding programs requires genetic breeding strategies that are appropriate for the reality production systems. It is also essential that the choice of animal selection criteria be based on breeders' knowledge and objectives. This work is an ethno-zootechnical study of the Morada Nova sheep breed and its crossbreeds. The goals of this study were to register and analyze indigenous breeders' knowledge and practices regarding animal selection criteria and to generate technical information to support a participatory breeding program of the breed. This study was conducted in the Morada Nova municipality in the state of Ceará, Brazil. Semi-structured interviews were evaluated using two groups of individuals, purebred Morada Nova sheep breeders (RMN, n = 13) and breeders of Morada Nova crossbreeds (MMN, n = 48). Interview questions were used to identify local selection criteria adopted by each group in the choice of animals for breeding. Data from the interviews were submitted to frequency distribution analysis and the Shapiro-Wilk test to verify their distribution. Later, the Kruskal-Wallis test was used to compare the two groups of farmers based on that information, in addition to multivariate statistical analysis and evaluation of Smith salience index. Breeders in the RMN group used selection criteria related to breed standards, such as pelage color. In contrast, breeders of the MMN group used criteria related to productivity, such as body conformation and milk production. Breeders should be engaged in the development of breeding programs, and it is important to consider their preferences and objectives when evaluating breeding animals.