Directory of Open Access Journals (Sweden)
Ângelo Zambam de MATTOS
Full Text Available ABSTRACT Background - Terlipressin and noradrenaline are the best studied treatments for hepatorenal syndrome, and there is no evidence of superiority of one over the other regarding to efficacy. While the former drug is more costly, the latter requires admission into an intensive care unit. Objective - The aim of this study was to perform an economic evaluation, comparing treatments for hepatorenal syndrome with terlipressin and noradrenaline. Methods - For the economic evaluation, a cost-minimization analysis was performed. Direct medical costs of the two treatment strategies were compared under the perspective of the Brazilian Public Health System as the third-party payer. A probabilistic sensitivity analysis was performed. Results - The costs of treatments with terlipressin or noradrenaline were 287.77 and 2,960.45 International Dollars (Int$ respectively. Treatment using terlipressin would save Int$2,672.68 for the Public Health System for each hospital admission related to hepatorenal syndrome. In the probabilistic sensitivity analysis, it was verified that the cost of the treatment with noradrenaline could vary between Int$2,326.53 and Int$3,644.16, while costs related to the treatment using terlipressin are not variable. Conclusion - The treatment strategy using terlipressin was more economical than that using noradrenaline under the perspective of the Brazilian Public Health System as the third-party payer.
Nguyen, Hai T; Guiard, Bruno P; Bacq, Alexandre; David, Denis J; David, Indira; Quesseveur, Gaël; Gautron, Sophie; Sanchez, Connie; Gardier, Alain M
2013-01-01
BACKGROUND AND PURPOSE Escitalopram, the S(+)-enantiomer of citalopram is the most selective 5-HT reuptake inhibitor approved. Although all 5-HT selective reuptake inhibitors (SSRIs) increase extracellular levels of 5-HT ([5-HT]ext). some also enhance, to a lesser extent, extracellular levels of noradrenaline ([NA]ext). However, the mechanisms by which SSRIs activate noradrenergic transmission in the brain remain to be determined. EXPERIMENTAL APPROACH This study examined the effects of escitalopram, on both [5-HT]ext and [NA]ext in the frontal cortex (FCx) of freely moving wild-type (WT) and mutant mice lacking the 5-HT transporter (SERT−/−) by using intracerebral microdialysis. We explored the possibilities that escitalopram enhances [NA]ext, either by a direct mechanism involving the inhibition of the low- or high-affinity noradrenaline transporters, or by an indirect mechanism promoted by [5-HT]ext elevation. The forced swim test (FST) was used to investigate whether enhancing cortical [5-HT]ext and/or [NA]ext affected the antidepressant-like activity of escitalopram. KEY RESULTS In WT mice, a single systemic administration of escitalopram produced a significant increase in cortical [5-HT]ext and [NA]ext. As expected, escitalopram failed to increase cortical [5-HT]ext in SERT−/− mice, whereas its neurochemical effects on [NA]ext persisted in these mutants. In WT mice subjected to the FST, escitalopram increased swimming parameters without affecting climbing behaviour. Finally, escitalopram, at relevant concentrations, failed to inhibit cortical noradrenaline and 5-HT uptake mediated by low-affinity monoamine transporters. CONCLUSIONS AND IMPLICATIONS These experiments suggest that escitalopram enhances, although moderately, cortical [NA]extin vivo by a direct mechanism involving the inhibition of the high-affinity noradrenaline transporter (NET). PMID:22233336
Stefankiv, Iu S; Babskyĭ, A M; Shostakovska, Y V
1995-01-01
A single administration of a physiological dose of noradrenaline to animals. in contrast to adrenaline, stimulates the respiration of mitochondria not only under oxidation of FAD-dependent Krebbs cycle substrate of the succinase but also HAD-dependent substrate of alpha-ketoglutarate. In the both cases the phosphorylation rate increases, since the action of noradrenaline, separating the respiration and oxidative phosphorylation, was not found. Noradrenaline increases the capacity of mitochondria to more actively absorb calcium ions under oxidation of succinate than under that of alpha-ketoglutarate.
Adeprene influence on the turnover rate of brain noradrenaline
International Nuclear Information System (INIS)
Tyutyulkova, N.I.; Gorancheva, J.I.; Ankov, V.K.
1978-01-01
The influence of Adeprene - Bulgarian antidepressant - on the content and the turnover rate of the rat brain noradrenaline was studied. The animals were injected intraperitoneally during 5 days with 20 mg/kg Adeprene. One hour after the last administration of Adeprene, Tyrosine, labelled with 14 C was injected. The animals were sacrified on the 1st, 2nd and 4th hours after the injection of 14 C-Tyrosine. The tyrosine and noradrenaline concentration were determined spectrofluorimetrically the concentration of the compounds labelled with 14 C by means of a liquid scintillator. The turnover rate constant of noradrenaline was calculated on the basis of the obtained results and the respective formula. It was established that under the influence of Adeprene, the noradrenaline concentration in the brain rises from 0,5 g/g in the control animals to 0,6 in treated mice. The turnover rate constant of noradrenaline, however, drops to 0,9 g/g/hour as compared to 0,15 g/g/hours in the controls. The determination of the turnover rate provides an idea about the intensity of utilization and synthesis of the mediator and is considered consequently as a more radiosensitive index for the neuronal activity then the total amine content. (A.B.)
Dopamine versus noradrenaline in septic shock
Directory of Open Access Journals (Sweden)
Bo Xu
2011-10-01
Full Text Available BackgroundThe ‘Surviving Sepsis’ Campaign guidelines recommend theuse of dopamine or noradrenaline as the first vasopressor inseptic shock. However, information that guides clinicians inchoosing between dopamine and noradrenaline as the firstvasopressor in patients with septic shock is limited.ObjectiveThis article presents a review of the literature regarding theuse of dopamine versus noradrenaline in patients with septicshock.ResultsTwo randomised controlled trials (RCT and two largeprospective cohort studies were analysed. RCT data showeddopamine was associated with increased arrhythmic events.One cohort study found dopamine was associated with higher30-day mortality. The other cohort study found noradrenalinewas associated with higher 28-day mortality.DiscussionData on the use of dopamine versus noradrenaline in patientswith septic shock is limited. Following the recent SOAP IIstudy, there is now strong evidence that the use of dopaminein septic shock is associated with significantly morecardiovascular adverse events, compared tonoradrenaline.ConclusionNoradrenaline should be used as the initial vasopressor inseptic shock to avoid the arrhythmic events associatedwith dopamine.
International Nuclear Information System (INIS)
Henseling, M.; Eckert, E.; Trendelenburg, U.
1976-01-01
Rabbit aortic strips (nerve-free, reserpine pretreated or normal) whose noradrenaline-metabolizing enzymes were inhibited (by in vitro treatment with 0.5 mM pargyline for 30 min and by the presence of 0.1 mM U-0521) were exposed to 1.18 μM 3 H-(+-)noradrenaline for 30 min (in most experiments). At the end of the incubation some strips were used for anlysis of radioactivity (i.e., of noradrenaline and its metabolites), while for others the efflux of radioactivity was determined during 240 min of wash out with amine-free solution. An estimate of the original distribution of the amine into the various extraneuronal and neuronal compartments of the tissue was obtained by compartmental analysis of the efflux curves. Extracellular amine distributes into 'compartment I + II' (characterized by a half time for efflux of 14 C-sorbitol. The extraneuronal accumulation of noradrenaline is a quickly equilibrating process which involves compartments III and IV (with half times for efflux of 3 and 11 min, respectively). Compartment IV represents not only extraneuronally but also neuronally distributed noradrenaline. The neuronal accumulation of noradrenaline is a slowly equilibrating process which can be subdivided into axoplasmic and vesicular accumulation. The results support the view that the rate of relaxation (of strips initially exposed to noradrenaline and then washed out) is affected by the efflux of unchanged amine form extraneuronal and neuronal stores. (orig./GSE) [de
Energy Technology Data Exchange (ETDEWEB)
Henseling, M; Eckert, E; Trendelenburg, U [Wuerzburg Univ. (Germany, F.R.). Inst. fuer Pharmakologie und Toxikologie
1976-01-01
Rabbit aortic strips (nerve-free, reserpine pretreated or normal) whose noradrenaline-metabolizing enzymes were inhibited (by in vitro treatment with 0.5 mM pargyline for 30 min and by the presence of 0.1 mM U-0521) were exposed to 1.18 ..mu..M /sup 3/H-(+-)noradrenaline for 30 min (in most experiments). At the end of the incubation some strips were used for anlysis of radioactivity (i.e., of noradrenaline and its metabolites), while for others the efflux of radioactivity was determined during 240 min of wash out with amine-free solution. An estimate of the original distribution of the amine into the various extraneuronal and neuronal compartments of the tissue was obtained by compartmental analysis of the efflux curves. Extracellular amine distributes into 'compartment I + II' (characterized by a half time for efflux of < 1 min); compartment size and half time for efflux were similar to those obtained for /sup 14/C-sorbitol. The extraneuronal accumulation of noradrenaline is a quickly equilibrating process which involves compartments III and IV (with half times for efflux of 3 and 11 min, respectively). Compartment IV represents not only extraneuronally but also neuronally distributed noradrenaline. The neuronal accumulation of noradrenaline is a slowly equilibrating process which can be subdivided into axoplasmic and vesicular accumulation. The results support the view that the rate of relaxation (of strips initially exposed to noradrenaline and then washed out) is affected by the efflux of unchanged amine form extraneuronal and neuronal stores.
Energy Technology Data Exchange (ETDEWEB)
Eckert, E; Henseling, M; Gescher, A; Trendelenburg, U [Wuerzburg Univ. (Germany, F.R.). Inst. fuer Pharmakologie und Toxikologie
1976-01-01
Rabbit aortic strips (nerve-free, reserpinepretreated or normal) whose noradrenaline-metabolizing enzymes were inhibited (by in vitro treatment with 0.5 mM pargyline for 30 min and by the presence of 0.1 mM U-0521) were exposed to 1.18 ..mu..M labelled (-)- or (+)noradrenaline for 30 min. At the end of the incubation period some strips were used for analysis of radioactivity (i.e., of noradrenaline and its metabolites), while for others the efflux of radioactivity was determined during 250 min of washout with amine-free solution. An estimate of the original distribution of the amine into the various extraneuronal and neuronal compartments of the tissue was obtained by compartmental analysis of the efflux curves. The mechanisms responsible for the accumulation of radioactivity in extraneuronal and axoplasmic compartments lack stereoselectivity; the rate constants for the efflux of radioactivity from these compartments are the same for (-)- and (+)noradrenaline. Despite the use of enzyme inhibitors, the 'late neuronal efflux' of radioactivity (i.e., the efflux collected between the 200th and 250th min of wash out) contained a considerable proportion of metabolites of noradrenaline. The metabolism of noradrenaline was stereoselective: while dihydroxyphenylglycol (DOPEG) was the predominant metabolite in the efflux from strips incubated with (-)noradrenaline, a considerable part of the efflux from strips incubated with the (+)isomer consisted of dihydroxymandelic acid and 'O-methylated and deaminated' metabolites (in addition to DOPEG).
International Nuclear Information System (INIS)
Eckert, E.; Henseling, M.; Gescher, A.; Trendelenburg, U.
1976-01-01
Rabbit aortic strips (nerve-free, reserpinepretreated or normal) whose noradrenaline-metabolizing enzymes were inhibited (by in vitro treatment with 0.5 mM pargyline for 30 min and by the presence of 0.1 mM U-0521) were exposed to 1.18 μM labelled (-)- or (+)noradrenaline for 30 min. At the end of the incubation period some strips were used for analysis of radioactivity (i.e., of noradrenaline and its metabolites), while for others the efflux of radioactivity was determined during 250 min of washout with amine-free solution. An estimate of the original distribution of the amine into the various extraneuronal and neuronal compartments of the tissue was obtained by compartmental analysis of the efflux curves. The mechanisms responsible for the accumulation of radioactivity in extraneuronal and axoplasmic compartments lack stereoselectivity; the rate constants for the efflux of radioactivity from these compartments are the same for (-)- and (+)noradrenaline. Despite the use of enzyme inhibitors, the 'late neuronal efflux' of radioactivity (i.e., the efflux collected between the 200th and 250th min of wash out) contained a considerable proportion of metabolites of noradrenaline. The metabolism of noradrenaline was stereoselective: while dihydroxyphenylglycol (DOPEG) was the predominant metabolite in the efflux from strips incubated with (-)noradrenaline, a considerable part of the efflux from strips incubated with the (+)isomer consisted of dihydroxymandelic acid and 'O-methylated and deaminated' metabolites (in addition to DOPEG). (orig/GSE) [de
Central noradrenaline transporter availability in highly obese, non-depressed individuals
Energy Technology Data Exchange (ETDEWEB)
Hesse, Swen; Sabri, Osama [University of Leipzig, Department of Nuclear Medicine, Leipzig (Germany); Leipzig University Medical Centre, Integrated Treatment and Research Centre (IFB) Adiposity Diseases, Leipzig (Germany); Becker, Georg-Alexander; Bresch, Anke; Luthardt, Julia; Patt, Marianne; Meyer, Philipp M. [University of Leipzig, Department of Nuclear Medicine, Leipzig (Germany); Rullmann, Michael [University of Leipzig, Department of Nuclear Medicine, Leipzig (Germany); Leipzig University Medical Centre, Integrated Treatment and Research Centre (IFB) Adiposity Diseases, Leipzig (Germany); Max Planck Institute for Human Cognitive and Brain Sciences, Leipzig (Germany); Hankir, Mohammed K.; Zientek, Franziska; Reissig, Georg; Fenske, Wiebke K. [Leipzig University Medical Centre, Integrated Treatment and Research Centre (IFB) Adiposity Diseases, Leipzig (Germany); Arelin, Katrin [Max Planck Institute for Human Cognitive and Brain Sciences, Leipzig (Germany); University of Leipzig, Day Clinic for Cognitive Neurology, Leipzig (Germany); Lobsien, Donald [University of Leipzig, Department of Neuroradiology, Leipzig (Germany); Mueller, Ulrich [University of Cambridge, Department of Psychiatry and Behavioural and Clinical Neuroscience Institute, Cambridge (United Kingdom); Baldofski, S.; Hilbert, Anja [Leipzig University Medical Centre, Integrated Treatment and Research Centre (IFB) Adiposity Diseases, Leipzig (Germany); University of Leipzig, Department of Medical Psychology and Medical Sociology, Leipzig (Germany); Blueher, Matthias [University of Leipzig, Department of Internal Medicine, Leipzig (Germany); Fasshauer, Mathias; Stumvoll, Michael [Leipzig University Medical Centre, Integrated Treatment and Research Centre (IFB) Adiposity Diseases, Leipzig (Germany); University of Leipzig, Department of Internal Medicine, Leipzig (Germany); Ding, Yu-Shin [New York University School of Medicine, Departments of Radiology and Psychiatry, New York, NY (United States)
2017-06-15
The brain noradrenaline (NA) system plays an important role in the central nervous control of energy balance and is thus implicated in the pathogenesis of obesity. The specific processes modulated by this neurotransmitter which lead to obesity and overeating are still a matter of debate. We tested the hypothesis that in vivo NA transporter (NAT) availability is changed in obesity by using positron emission tomography (PET) and S,S-[{sup 11}C]O-methylreboxetine (MRB) in twenty subjects comprising ten highly obese (body mass index BMI > 35 kg/m{sup 2}), metabolically healthy, non-depressed individuals and ten non-obese (BMI < 30 kg/m{sup 2}) healthy controls. Overall, we found no significant differences in binding potential (BP{sub ND}) values between obese and non-obese individuals in the investigated brain regions, including the NAT-rich thalamus (0.40 ± 0.14 vs. 0.41 ± 0.18; p = 0.84) though additional discriminant analysis correctly identified individual group affiliation based on regional BP{sub ND} in all but one (control) case. Furthermore, inter-regional correlation analyses indicated different BP{sub ND} patterns between both groups but this did not survive testing for multiple comparions. Our data do not find an overall involvement of NAT changes in human obesity. However, preliminary secondary findings of distinct regional and associative patterns warrant further investigation. (orig.)
Central noradrenaline transporter availability in highly obese, non-depressed individuals
International Nuclear Information System (INIS)
Hesse, Swen; Sabri, Osama; Becker, Georg-Alexander; Bresch, Anke; Luthardt, Julia; Patt, Marianne; Meyer, Philipp M.; Rullmann, Michael; Hankir, Mohammed K.; Zientek, Franziska; Reissig, Georg; Fenske, Wiebke K.; Arelin, Katrin; Lobsien, Donald; Mueller, Ulrich; Baldofski, S.; Hilbert, Anja; Blueher, Matthias; Fasshauer, Mathias; Stumvoll, Michael; Ding, Yu-Shin
2017-01-01
The brain noradrenaline (NA) system plays an important role in the central nervous control of energy balance and is thus implicated in the pathogenesis of obesity. The specific processes modulated by this neurotransmitter which lead to obesity and overeating are still a matter of debate. We tested the hypothesis that in vivo NA transporter (NAT) availability is changed in obesity by using positron emission tomography (PET) and S,S-["1"1C]O-methylreboxetine (MRB) in twenty subjects comprising ten highly obese (body mass index BMI > 35 kg/m"2), metabolically healthy, non-depressed individuals and ten non-obese (BMI < 30 kg/m"2) healthy controls. Overall, we found no significant differences in binding potential (BP_N_D) values between obese and non-obese individuals in the investigated brain regions, including the NAT-rich thalamus (0.40 ± 0.14 vs. 0.41 ± 0.18; p = 0.84) though additional discriminant analysis correctly identified individual group affiliation based on regional BP_N_D in all but one (control) case. Furthermore, inter-regional correlation analyses indicated different BP_N_D patterns between both groups but this did not survive testing for multiple comparions. Our data do not find an overall involvement of NAT changes in human obesity. However, preliminary secondary findings of distinct regional and associative patterns warrant further investigation. (orig.)
Saito, Takayuki; Inagaki, Satoru; Sakurai, Kaoru; Okuda, Katsuji; Ishihara, Kazuyuki
2011-03-01
Periodontitis, an infectious disease caused by periodontopathic bacteria, including Porphyromonas gingivalis, is reported to be accelerated by stress, under which noradrenaline levels are increased in the bloodstream. The purpose of this study was to evaluate the effects of noradrenaline on P. gingivalis. P. gingivalis was incubated in the presence of 25μM, 50μM, or 100μM adrenaline or noradrenaline at 37°C for 12, 24 or 36h and growth was evaluated by OD(660). Auto-inducer-2 (AI-2) was measured by luminescence of Vibrio harveyi BB 170. Expression of P. gingivalis genes was evaluated using a microarray and RT-PCR. Rgp activity of arg-gingipainA and B (Rgp) was measured with a synthetic substrate. Growth of P. gingivalis FDC381 was inhibited by noradrenaline at 24 and 36h. Growth inhibition by noradrenaline increased dose-dependently. Inhibition of growth partially recovered with addition of propranolol. AI-2 production from P. gingivalis showed a marked decrease with addition of noradrenaline compared with peak production levels in the control group. Microarray analysis revealed an increase in expression in 18 genes and a decrease in expression in 2 genes. Amongst these genes, expression of the protease arg-gingipainB (RgpB) gene, a major virulence factor of P. gingivalis, was further analysed. Expression of rgpB showed a significant increase with addition of noradrenaline, which was partially reduced by addition of propranolol. Cell-associated Rgp activity also increased with addition of noradrenaline. These results suggest that stressors influence the expression of the virulence factors of P. gingivalis via noradrenaline. Copyright © 2010 Elsevier Ltd. All rights reserved.
Serotonin and noradrenaline reuptake inhibitors improve micturition control in mice.
Directory of Open Access Journals (Sweden)
Marco Redaelli
Full Text Available Poor micturition control may cause profound distress, because proper voiding is mandatory for an active social life. Micturition results from the subtle interplay of central and peripheral components. It involves the coordination of autonomic and neuromuscular activity at the brainstem level, under the executive control of the prefrontal cortex. We tested the hypothesis that administration of molecules acting as reuptake inhibitors of serotonin, noradrenaline or both may exert a strong effect on the control of urine release, in a mouse model of overactive bladder. Mice were injected with cyclophosphamide (40 mg/kg, to increase micturition acts. Mice were then given one of four molecules: the serotonin reuptake inhibitor imipramine, its metabolite desipramine that acts on noradrenaline reuptake, the serotonin and noradrenaline reuptake inhibitor duloxetine or its active metabolite 4-hydroxy-duloxetine. Cyclophosphamide increased urine release without inducing overt toxicity or inflammation, except for increase in urothelium thickness. All the antidepressants were able to decrease the cyclophosphamide effects, as apparent from longer latency to the first micturition act, decreased number of urine spots and volume of released urine. These results suggest that serotonin and noradrenaline reuptake inhibitors exert a strong and effective modulatory effect on the control of urine release and prompt to additional studies on their central effects on brain areas involved in the social and behavioral control of micturition.
Plasma clearance of noradrenaline does not change with age in normal subjects
DEFF Research Database (Denmark)
Hilsted, J; Christensen, N J; Larsen, S
1985-01-01
Noradrenaline kinetics (plasma concentrations, plasma clearance and appearance rates) were investigated in seven elderly healthy subjects and in six young healthy subjects. Forearm venous plasma noradrenaline concentrations were higher in the elderly subjects compared with the young subjects. Pla....... Plasma clearance of noradrenaline was identical in the two groups. The increase in plasma noradrenaline concentration, with age, probably reflects an increased sympathetic nervous activity.......Noradrenaline kinetics (plasma concentrations, plasma clearance and appearance rates) were investigated in seven elderly healthy subjects and in six young healthy subjects. Forearm venous plasma noradrenaline concentrations were higher in the elderly subjects compared with the young subjects...
Jackson, Helen C; Bearham, M Clair; Hutchins, Lisa J; Mazurkiewicz, Sarah E; Needham, Andrew M; Heal, David J
1997-01-01
Sibutramine is a novel 5-hydroxytryptamine (5-HT) and noradrenaline reuptake inhibitor (serotonin- noradrenaline reuptake inhibitor, SNRI) which is currently being developed as a treatment for obesity. Sibutramine has been shown to decrease food intake in the rat. In this study we have used a variety of monoamine receptor antagonists to examine the pharmacological mechanisms underlying sibutramine-induced hypophagia. Individually-housed male Sprague-Dawley rats were maintained on reversed phase lighting with free access to food and water. Drugs were administered at 09 h 00 min and food intake was monitored over the following 8 h dark period. Sibutramine (10 mg kg−1, p.o.) produced a significant decrease in food intake during the 8 h following drug administration. This hypophagic response was fully antagonized by the α1-adrenoceptor antagonist, prazosin (0.3 and 1 mg kg−1, i.p.), and partially antagonized by the β1-adrenoceptor antagonist, metoprolol (3 and 10 mg kg−1, i.p.) and the 5-HT receptor antagonists, metergoline (non-selective; 0.3 mg kg−1, i.p.); ritanserin (5-HT2A/2C; 0.1 and 0.5 mg kg−1, i.p.) and SB200646 (5-HT2B/2C; 20 and 40 mg kg−1, p.o.). By contrast, the α2-adrenoceptor antagonist, RX821002 (0.3 and 1 mg kg−1, i.p.) and the β2-adrenoceptor antagonist, ICI 118,551 (3 and 10 mg kg−1, i.p.) did not reduce the decrease in food intake induced by sibutramine. These results demonstrate that β1-adrenoceptors, 5-HT2A/2C-receptors and particularly α1-adrenoceptors, are involved in the effects of sibutramine on food intake and are consistent with the hypothesis that sibutramine-induced hypophagia is related to its ability to inhibit the reuptake of both noradrenaline and 5-HT, with the subsequent activation of a variety of noradrenaline and 5-HT receptor systems. PMID:9283694
Leptin inhibits and ghrelin augments hypothalamic noradrenaline release after stress.
Kawakami, Akio; Okada, Nobukazu; Rokkaku, Kumiko; Honda, Kazufumi; Ishibashi, Shun; Onaka, Tatsushi
2008-09-01
Metabolic conditions affect hypothalamo-pituitary-adrenal responses to stressful stimuli. Here we examined effects of food deprivation, leptin and ghrelin upon noradrenaline release in the hypothalamic paraventricular nucleus (PVN) and plasma adrenocorticotropic hormone (ACTH) concentrations after stressful stimuli. Food deprivation augmented both noradrenaline release in the PVN and the increase in plasma ACTH concentration following electrical footshocks (FSs). An intracerebroventricular injection of leptin attenuated the increases in hypothalamic noradrenaline release and plasma ACTH concentrations after FSs, while ghrelin augmented these responses. These data suggest that leptin inhibits and ghrelin facilitates neuroendocrine stress responses via noradrenaline release and indicate that a decrease in leptin and an increase in ghrelin release after food deprivation might contribute to augmentation of stress-induced ACTH release in a fasting state.
Directory of Open Access Journals (Sweden)
Leif eHertz
2014-09-01
Full Text Available Lactate is a versatile metabolite with important roles in modulation of brain glucose utilization rate (CMRglc, diagnosis of brain-injured patients, redox- and receptor-mediated signaling, memory, and alteration of gene transcription. Neurons and astrocytes release and accumulate lactate using equilibrative monocarboxylate transporters that carry out net transmembrane transport of lactate only until intra- and extracellular levels reach equilibrium. Astrocytes have much faster lactate uptake than neurons and shuttle more lactate among gap junction-coupled astrocytes than to nearby neurons. Lactate diffusion within syncytia can provide precursors for oxidative metabolism and glutamate synthesis and facilitate its release from endfeet to perivascular space to stimulate blood flow. Lactate efflux from brain during activation underlies the large underestimation of CMRglc with labeled glucose and fall in CMRO2/CMRglc ratio. Receptor-mediated effects of lactate on locus coeruleus neurons include noradrenaline release in cerebral cortex and c-AMP-mediated stimulation of astrocytic gap junctional coupling, thereby enhancing its dispersal and release from brain. Lactate transport is essential for its multifunctional roles.
DEFF Research Database (Denmark)
Glisezinski, I. de; Larrouy, D.; Bajzova, M.
2009-01-01
The relative contribution of noradrenaline (norepinephrine) and adrenaline (epinephrine) in the control of lipid mobilization in subcutaneous adipose tissue (SCAT) during exercise was evaluated in men treated with a somatostatin analogue, octreotide. Eight lean and eight obese young men matched...... of octreotide suppressed plasma insulin and growth hormone levels at rest and during exercise. It blocked the exercise-induced increase in plasma adrenaline while that of noradrenaline was unchanged. Plasma natriuretic peptides (NPs) level was higher at rest and during exercise under octreotide infusion in lean...... individuals. In conclusion, blockade of beta-adrenergic receptors during exercise performed during infusion of octreotide (blocking the exercise-induced rise in adrenaline but not that of noradrenaline) does not alter the exercise-induced lipolysis. This suggests that adrenaline is the main adrenergic agent...
Alcántara-Hernández, Rocío; Hernández-Méndez, Aurelio; Romero-Ávila, M Teresa; Alfonzo-Méndez, Marco A; Pupo, André S; García-Sáinz, J Adolfo
2017-12-01
In LNCaP cells that stably express α 1A -adrenergic receptors, oxymetazoline increased intracellular calcium and receptor phosphorylation, however, this agonist was a weak partial agonist, as compared to noradrenaline, for calcium signaling. Interestingly, oxymetazoline-induced receptor internalization and desensitization displayed greater effects than those induced by noradrenaline. Phorbol myristate acetate induced modest receptor internalization and minimal desensitization. α 1A -Adrenergic receptor interaction with β-arrestins (colocalization/coimmunoprecipitation) was induced by noradrenaline and oxymetazoline and, to a lesser extent, by phorbol myristate acetate. Oxymetazoline was more potent and effective than noradrenaline in inducing ERK 1/2 phosphorylation. Mass spectrometric analysis of immunopurified α 1A -adrenergic receptors from cells treated with adrenergic agonists and the phorbol ester clearly showed that phosphorylated residues were present both at the third intracellular loop and at the carboxyl tail. Distinct phosphorylation patterns were observed under the different conditions. The phosphorylated residues were: a) Baseline and all treatments: T233; b) noradrenaline: S220, S227, S229, S246, S250, S389; c) oxymetazoline: S227, S246, S381, T384, S389; and d) phorbol myristate acetate: S246, S250, S258, S351, S352, S401, S402, S407, T411, S413, T451. Our novel data, describing the α 1A -AR phosphorylation sites, suggest that the observed different phosphorylation patterns may participate in defining adrenoceptor localization and action, under the different conditions examined. Copyright © 2017 Elsevier B.V. All rights reserved.
Attempt to separate the fluorescence spectra of adrenaline and noradrenaline using chemometrics
DEFF Research Database (Denmark)
Nikolajsen, Rikke P; Hansen, Åse Marie; Bro, R
2000-01-01
An investigation was conducted on whether the fluorescence spectra of the very similar catecholamines adrenaline and noradrenaline could be separated using chemometric methods. The fluorescence landscapes (several excitation and emission spectra were measured) of two data sets with respectively 16...... regression (Unfold-PLSR) on the larger data set and parallel factor analysis (PARAFAC) of the six samples of the smaller set showed that there was no difference between the fluorescence landscapes of adrenaline and noradrenaline. It can be concluded that chemometric separation of adrenaline and noradrenaline...
International Nuclear Information System (INIS)
Michelena, P.; Moro, M.A.; Castillo, C.J.; Garcia, A.G.
1991-01-01
We have performed binding experiments of (a)[3H]quinuclidinyl benzilate to partially purified membranes from noradrenaline- and adrenaline-containing chromaffin cells and (b) [3H]N-methyl-quinuclidinyl benzilate to acutely isolated, or 48-h cultured, chromaffin cells subpopulations. Using this approach, we obtained enough evidence to conclude (1st) that muscarinic receptors are present in both noradrenaline- and adrenaline containing cells; (2nd) that noradrenaline cells contain in fact 2-3 fold higher density of those receptors; and (3rd) that those receptors undergo plastic changes upon chronic culturing of the cells
Effect of noradrenaline on production of methoxyindoles by rat pineal gland in organ culture
International Nuclear Information System (INIS)
Morton, D.J.
1987-01-01
This report examined the effect of noradrenaline on production of methoxyindoles by the pineal gland in organ culture. Pineal glands were incubated in pairs in 95μl culture medium containing 5-hydroxy [2- 14 C]tryptamine creatinine sulphate (0,1 mM) and noradrenaline (NA) (0,5-100 μM). The results indicated that noradrenaline appeared to have a characteristic action on pineal metabolism. An increase in production of both N-acetylserotonin and melatonin by the pineal after noradrenaline treatment was observed. The overall production of methoxyindoles followed a very similar trend to that of N-acetylserotonin and melatonin, which suggests some degree of noradrenergic control over HIOMT levels
Achterberg, E J Marijke; van Kerkhof, Linda W M; Servadio, Michela; van Swieten, Maaike M H; Houwing, Danielle J; Aalderink, Mandy; Driel, Nina V; Trezza, Viviana; Vanderschuren, Louk J M J
2016-02-01
Social play behavior, abundant in the young of most mammalian species, is thought to be important for social and cognitive development. Social play is highly rewarding, and as such, the expression of social play depends on its pleasurable and motivational properties. Since the motivational properties of social play have only sporadically been investigated, we developed a setup in which rats responded for social play under a progressive ratio schedule of reinforcement. Dopaminergic neurotransmission plays a key role in incentive motivational processes, and both dopamine and noradrenaline have been implicated in the modulation of social play behavior. Therefore, we investigated the role of dopamine and noradrenaline in the motivation for social play. Treatment with the psychostimulant drugs methylphenidate and cocaine increased responding for social play, but suppressed its expression during reinforced play periods. The dopamine reuptake inhibitor GBR-12909 increased responding for social play, but did not affect its expression, whereas the noradrenaline reuptake inhibitor atomoxetine decreased responding for social play as well as its expression. The effects of methylphenidate and cocaine on responding for social play, but not their play-suppressant effects, were blocked by pretreatment with the dopamine receptor antagonist α-flupenthixol. In contrast, pretreatment with the α2-adrenoceptor antagonist RX821002 prevented the play-suppressant effect of methylphenidate, but left its effect on responding for social play unaltered. In sum, the present study introduces a novel method to study the incentive motivational properties of social play behavior in rats. Using this paradigm, we demonstrate dissociable roles for dopamine and noradrenaline in social play behavior: dopamine stimulates the motivation for social play, whereas noradrenaline negatively modulates the motivation for social play behavior and its expression.
Noradrenaline and isoproterenol kinetics in diabetic patients with and without autonomic neuropathy
DEFF Research Database (Denmark)
Dejgaard, Anders; Hilsted, J; Christensen, N J
1986-01-01
Noradrenaline and isoproterenol kinetics using intravenous infusion of L-3H-NA and of 3H-isoproterenol were investigated in eight Type 1 (insulin-dependent) diabetic patients without neuropathy and in eight Type 1 diabetic patients with autonomic neuropathy matched for age, sex and duration...... with autonomic failure (p less than 0.01). The disappearance of L-3H-noradrenaline from plasma after the infusion of L-3H-noradrenaline had been stopped was not different in patients with and without neuropathy. The metabolic clearance of isoproterenol was not influenced by the presence of autonomic failure...
Rotational Spectra of Adrenaline and Noradrenaline
Cortijo, V.; López, J. C.; Alonso, J. L.
2009-06-01
The emergence of Laser Ablation Molecular Beam Fourier Transform Microwave (LA-MB-FTMW) spectroscopy has rendered accessible the gas-phase study of solid biomolecules with high melting points. Among the biomolecules to benefit from this technique, neurotransmitters have received special attention due to the lack of experimental information and their biological relevance. As a continuation of the we present the study of adrenaline and noradrenaline. The comparison between the experimental rotational and ^{14}N nuclear quadrupole coupling constants and those calculated ab initio provide a definitive test for molecular structures and confirm unambiguously the identification of four conformers of adrenaline and three conformers of noradrenaline. Their relative population in the jet has been evaluated by relative intensity measurements of selected rotational transitions. The most abundant conformer in both neurotransmitters present an extended AG configuration with a O-H\\cdotsN hydrogen bond in the side chain. J.L. Alonso, M.E. Sanz, J.C. López and V. Cortijo, J. Am. Chem. Soc. (in press), 2009
Ramel, A; Wagner, K; Elmadfa, I
2004-01-01
Objectives: To investigate noradrenaline concentrations, neutrophil counts, plasma antioxidants, and lipid oxidation products before and after acute resistance exercise. Methods: 17 male participants undertook a submaximal resistance exercise circuit (10 exercises; 75% of the one repetition maximum; mean (SD) exercise time, 18.6 (1.1) minutes). Blood samples were taken before and immediately after exercise and analysed for plasma antioxidants, noradrenaline, neutrophils, and lipid oxidation products. Wilcoxon's signed-rank test and Pearson's correlation coefficient were used for calculations. Results: Neutrophils, noradrenaline, fat soluble antioxidants, and lipid oxidation products increased after exercise. Noradrenaline concentrations were associated with higher antioxidant concentrations. Neutrophils were related to higher concentrations of conjugated dienes. Conclusions: Submaximal resistance exercise increases plasma antioxidants. This might reflect enhanced antioxidant defence in response to the oxidative stress of exercise, though this is not efficient for inhibiting lipid oxidation. The correlation between noradrenaline concentrations and plasma antioxidants suggests a modulating role of the stress hormone. Neutrophils are a possible source of oxidative stress after resistance exercise. PMID:15388566
Reduced plasma noradrenaline during angiotensin II-induced acute hypertension in man
DEFF Research Database (Denmark)
Henriksen, J H; Kastrup, J; Christensen, N J
1985-01-01
1. Plasma noradrenaline and adrenaline concentrations were measured in ten subjects before, during and after intravenous infusion of angiotensin II (ANG II) in order to determine the sympathoadrenal response of ANG II challenge in man. In five subjects ganglionic blockade was additionally performed...... by intravenous infusion of trimethaphan. 2. During ANG II infusion mean arterial blood pressure increased by 30% (P adrenaline decreased less. 3. During ganglionic blockade plasma noradrenaline decreased significantly (P
International Nuclear Information System (INIS)
Dvoretskij, A.I.; Kulikova, I.A.
1993-01-01
Whole-body X-irradiation with doses of 0.155 and 0.310 C/kg was shown to modify in different ways the activating effects of noradrenaline and serotonin, as well as a biphase effect of dopamine of neuronal membranes. The resulting effect was a function of a combination of radiation doses and neurotransmitter concentrations and thus showed different modes of interaction between neurotransmitter and ion-transport systems of brain cells in radiation sickness
Gunduz, Ergun; Arun, Oguzhan; Bagci, Sengal Taylan; Oc, Bahar; Salman, Alper; Yilmaz, Setenay Arzu; Celik, Cetin; Duman, Ates
2015-05-01
To assess the effects of propofol and sevoflurane on the contraction elicited by dopamine, adrenaline and noradrenaline on isolated human umbilical arteries. Umbilical arteries were cut into endothelium-denuded spiral strips and suspended in organ baths containing Krebs-Henseleit solution bubbled with O2 +CO2 mixture. Control contraction to phenylephrine (10(-5) M) was recorded. Response curves were obtained to 10(-5) M dopamine, 10(-5) M adrenaline or 10(-5) M noradrenaline. Afterwards, either cumulative propofol (10(-6) M, 10(-5) M and 10(-4) M) or cumulative sevoflurane (1.2%, 2.4% and 3.6%) was added to the organ bath, and the responses were recorded. Responses are expressed percentage of phenylephrine-induced contraction (mean ± standard deviation) (P adrenaline and noradrenaline (P adrenaline. High and highest concentrations of sevoflurane caused significantly higher relaxation compared with the high and highest concentrations of propofol on the contraction elicited by noradrenaline. Dopamine, adrenaline and noradrenaline elicit contractions in human umbilical arteries, and noradrenaline causes the highest contraction. Both propofol and sevoflurane inhibit these contractions in a dose-dependent manner. Propofol caused greater relaxation in the contractions elicited by dopamine and adrenaline while sevoflurane caused greater relaxation in the contraction elicited by noradrenaline. © 2014 The Authors. Journal of Obstetrics and Gynaecology Research © 2014 Japan Society of Obstetrics and Gynecology.
Directory of Open Access Journals (Sweden)
A. Géloën
2015-01-01
Full Text Available Progress over the last 50 years has led to a decline in mortality from ≈70% to ≈20% in the best series of patients with septic shock. Nevertheless, refractory septic shock still carries a mortality close to 100%. In the best series, the mortality appears related to multiple organ failure linked to comorbidities and/or an intense inflammatory response: shortening the period that the subject is exposed to circulatory instability may further lower mortality. Treatment aims at reestablishing circulation within a “central” compartment (i.e., brain, heart, and lung but fails to reestablish a disorganized microcirculation or an adequate response to noradrenaline, the most widely used vasopressor. Indeed, steroids, nitric oxide synthase inhibitors, or donors have not achieved overwhelming acceptance in the setting of septic shock. Counterintuitively, α2-adrenoceptor agonists were shown to reduce noradrenaline requirements in two cases of human septic shock. This has been replicated in rat and sheep models of sepsis. In addition, some data show that α2-adrenoceptor agonists lead to an improvement in the microcirculation. Evidence-based documentation of the effects of alpha-2 agonists is needed in the setting of human septic shock.
DEFF Research Database (Denmark)
Berg, Ronan M. G.; Plovsing, Ronni R.; Bailey, Damian M.
2015-01-01
Vasopressor support is used widely for maintaining vital organ perfusion pressure in septic shock, with implications for dynamic cerebral autoregulation (dCA). This study investigated whether a noradrenaline-induced steady state increase in mean arterial blood pressure (MAP) would enhance d......, noradrenaline administration was associated with a decrease in gain (1.18 (1.12-1.35) vs 0.93 (0.87-0.97) cm/mmHg per s; P vs 0.94 (0.81-1.10) radians; P = 0.58). After LPS, noradrenaline administration changed neither gain (0.91 (0.85-1.01) vs 0.87 (0.......81-0.97) cm/mmHg per s; P = 0.46) nor phase (1.10 (1.04-1.30) vs 1.37 (1.23-1.51) radians; P = 0.64). The improvement of dCA to a steady state increase in MAP is attenuated during an LPS-induced systemic inflammatory response. This may suggest that vasopressor treatment with noradrenaline offers no additional...
International Nuclear Information System (INIS)
Quach, T.T.; Rose, C.; Schwartz, J.C.
1978-01-01
Different agents have been investigated for their effects on [ 3 H] glycogen synthesized in mouse cortical slices. Of these noradrenaline, serotonin and histamine induced clear concentration-dependent glycogenesis. [ 3 H] glycogen hydrolysis induced by noradrenaline appears to be mediated by beta-adrenergic receptors because it is completely prevented by timolol, while phentolamine is ineffective. It seems to involve cyclic AMP because it is potentiated in the presence of isobutylmethylxanthine; in addition dibutyryl cyclic AMP (but not dibutyryl cyclic GMP) promotes glycogenolysis. Lower concentrations of noradrenaline were necessary for [ 3 H] glycogen hydrolysis (ECsub(50) 0.5μM) than for stimulation of cyclic AMP accumulation (ECsub(50) = 8μM). After subchronic reserpine treatment the concentration-response curve to noradrenaline was significantly shifted to the left (ECsub(50) = 0.09 +- 0.02 μM as compared with 0.49 +- 0.08μM in saline-pretreated mice) without modifications of either the basal [ 3 H] glycogen level, maximal glycogenolytic effect, or the dibutyryl cAMP-induced glycogenolytic response. In addition to noradrenaline, clear concentration-dependent [ 3 H] glycogen hydrolysis was observed in the presence of histamine or serotonin. In contrast to the partial [ 3 H] glycogen hydrolysis elicited by these biogenic amines, depolarization of the slices by 50 mM K + provoked a nearly total [ 3 H] glycogen hydrolysis. (author)
Pudovkina, O; Kawahara, Y; de Vries, J.B; Westerink, B.H.C.
2001-01-01
The present study was undertaken to investigate and compare the properties of noradrenaline release in the locus coeruleus (LC) and prefrontal cortex (PFC). For that aim the dual-probe microdialysis technique was applied for simultaneous detection of noradrenaline levels in the LC and PFC in
Wortley, K E; Heal, D J; Stanford, S C
1999-01-01
The effects of sibutramine (0.25–10 mg kg−1 i.p.) on extracellular noradrenaline concentration in the frontal cortex and hypothalamus of freely-moving rats were investigated using microdialysis. The role of presynaptic α2-adrenoceptors in modulating the effects of sibutramine in these brain areas was also determined.Sibutramine induced an increase in extracellular noradrenaline concentration, the magnitude of which paralleled dose, in both brain areas. In the cortex, this increase was gradual and sustained, whereas in the hypothalamus it was more rapid and of shorter duration.In both the cortex and hypothalamus, pretreatment of rats with the α2-adrenoceptor antagonist RX821002 (3 mg kg−1 i.p.) potentiated increases in the accumulation of extracellular noradrenaline induced by sibutramine (10 mg kg−1 i.p.), by 7 and 10 fold respectively. RX821002 also reduced the latency of sibutramine to reach its maximum effect in the cortex, but not in the hypothalamus.Infusion of RX821002 (1 μM) via the probe increased the accumulation of extracellular noradrenaline induced by sibutramine (10 mg kg−1 i.p.) in both brain areas. In the hypothalamus, the effects of RX821002 on the accumulation of noradrenaline induced by sibutramine were 2 fold greater than those in the cortex.These findings support evidence that sibutramine inhibits the reuptake of noradrenaline in vivo, but that the accumulation of extracellular noradrenaline is limited by noradrenergic activation of presynaptic α2-adrenoceptors. Furthermore, the data suggest that terminal α2-adrenoceptors in the hypothalamus exert a greater inhibitory effect over the control of extracellular noradrenaline accumulation than do those in the cortex. PMID:10516646
Directory of Open Access Journals (Sweden)
Mehdi Ghorbani
2015-03-01
Full Text Available Common purslane (Portulaca oleracea L. is an annual plant as one of the natural sources for noradrenaline hormone. In this research, hairy root culture of purslane was established by using Agrobacterium rhizogenes strain ATCC 15834. In the following, Box-Behnken model of response surface methodology (RSM was employed to optimize B5 medium for the growth of P. oleracea L. hairy root line. According to the results, modelling and optimization conditions, including sucrose, CaCl2.H2O, H2PO4 and NO3-/NH4+ concentrations on maximum dry weight (0.155 g and noradrenaline content (0.36 mg.g-1 DW was predicted. These optimal conditions predicted by RSM were confirmed the enhancement of noradrenaline production as an application potential for production by hairy root cultures.
Role of adrenal hormones in the synthesis of noradrenaline in cardiac sympathetic neurones
Bhagat, B.
1969-01-01
1. Adrenalectomy or adrenal demedullation affected neither the levels of endogenous catecholamines in the rat heart nor the accumulation of 3H-noradrenaline 1 hr after its intravenous administration. 2. Twenty-four hours after intravenous administration of labelled amine, however, its retention was markedly reduced in the heart of adrenalectomized or demedullated rats. Ganglionic blockade prevented this reduction. 3. Rate calculations from the decline of catecholamine levels after blockade of synthesis with α-methyl-tyrosine showed that cardiac synthesis of noradrenaline increased about four-fold after demedullation and about three-fold after adrenalectomy. This increase in synthesis may compensate for the loss of circulating catecholamines. 4. There was no change in catechol-o-methyl-transferase activity, but monoamine oxidase activity was increased in the homogenates of the heart of adrenalectomized and demedullated rats. The increase in the cardiac monoamine oxidase activity was markedly greater in the adrenalectomized rats than in the demedullated rats. 5. It is suggested that adrenal cortex insufficiency may modulate the rate of synthesis of noradrenaline and monoamine oxidase activity in cardiac sympathetic neurones. PMID:5360339
Directory of Open Access Journals (Sweden)
Mariam Sabbar
2018-03-01
Full Text Available Background: Lead neurotoxicity is a major health problem known as a risk factor for neurodegenerative diseases, including the manifestation of parkinsonism-like disorder. While lead is known to preferentially accumulate in basal ganglia, the mechanisms underlying behavioral disorders remain unknown. Here, we investigated the neurophysiological and biochemical correlates of motor deficits induced by sub-chronic injections of lead.Methods: Sprague Dawely rats were exposed to sub-chronic injections of lead (10 mg/kg, i.p. or to a single i.p. injection of 50 mg/kg N-(2-chloroethyl-N-ethyl-2-bromobenzylamine hydrochloride (DSP-4, a drug known to induce selective depletion of noradrenaline. Rats were submitted to a battery of behavioral tests, including the open field for locomotor activity and rotarod for motor coordination. Electrophysiological recordings were carried out in three major basal ganglia nuclei, the subthalamic nucleus (STN, globus pallidus (GP, and substantia nigra pars reticulata (SNr. At the end of experiments, post-mortem tissue level of the three monoamines (dopamine, noradrenaline, and serotonin and their metabolites has been determined using HPLC.Results: Lead intoxication significantly impaired exploratory and locomotor activity as well as motor coordination. It resulted in a significant reduction in the level of noradrenaline in the cortex and dopamine and its metabolites, DOPAC, and HVA, in the striatum. The tissue level of serotonin and its metabolite 5-HIAA was not affected in the two structures. Similarly, DSP-4, which induced a selective depletion of noradrenaline, significantly decreased exploratory, and locomotor activity as well as motor coordination. L-DOPA treatment did not improve motor deficits induced by lead and DSP-4 in the two animal groups. Electrophysiological recordings showed that both lead and DSP-4 did not change the firing rate but resulted in a switch from the regular normal firing to irregular and
Food-dependent exercise-induced anaphylaxis with a high level of plasma noradrenaline.
Kato, Yukihiko; Nagai, Ayako; Saito, Masuyoshi; Ito, Tomonobu; Koga, Michiyuki; Tsuboi, Ryoji
2007-02-01
Ingesting certain foods sometimes triggers anaphylaxis when followed by exercise (food-dependent exercise-induced anaphylaxis, FDEIA). Specific food-induced mucocutaneous urticaria may also progress to anaphylaxis (oral allergy syndrome, OAS). A positive skin test and/or radioallergosorbent test (RAST) to the foods suggest involvement of immunoglobulin (Ig)E-anaphylaxis in both disorders. The triggering foods and initial target organs are usually different in each case. In the present study, a 32-year-old male reported dyspnea accompanied by wheals, and symptoms of low blood pressure while walking after eating Chinese noodles and donuts. He also reported uncomfortable sensations in his mouth and throat after ingesting melon. Exercise challenge tests were administered. Serum histamine, plasma adrenaline, noradrenaline and dopamine were measured pre- and post-test. No symptoms were induced by exercise or by the ingestion of any single food item before exercise. However, numerous wheals appeared when exercise followed the combined ingestion of foods. Likewise, the sequence of eating pancakes and then exercising resulted in numerous wheals and anaphylaxis. Olopatadine hydrochloride and ketotifen fumarate completely inhibited this anaphylaxis. The skin prick tests resulted in fruit-induced erythema and wheals. The results of these tests with wheat, butter and sugar were negative, and no symptoms were induced by the exercise test after ingestion of watermelon, melon or apple. The anaphylactoid symptoms were accompanied by a significant increase of plasma noradrenaline. In this case, not only wheat, but sugar and butter may induce the onset of FDEIA. There was no significant correlation between the intensity of the symptoms and the serum histamine levels in the present case. Noradrenaline may be involved in the onset of FDEIA, since noradrenaline may selectively inhibit T-helper (Th)1 functions while favoring Th2 responses. The tests showed no cross-reactivity between the
Wortley, K E; Hughes, Z A; Heal, D J; Stanford, S C
1999-01-01
The effects of sibutramine (0.25–10 mg kg−1, i.p.) on extracellular noradrenaline concentration in the frontal cortex of halothane-anaesthetized rats were compared with those of d-amphetamine (1–3 mg kg−1, i.p.) using in vivo microdialysis. The role of presynaptic α2-adrenoceptors in modulating the effects of these drugs on extracellular noradrenaline concentration were also investigated by pretreating rats with the selective α2-adrenoceptor antagonist, RX821002.Sibutramine induced a gradual and sustained increase in extracellular noradrenaline concentration. The dose-response relationship was described by a bell-shaped curve with a maximum effect at 0.5 mg kg−1. In contrast, d-amphetamine induced a rapid increase in extracellular noradrenaline concentration, the magnitude of which paralleled drug dose.Pretreatment with the α2-adrenoceptor antagonist, RX821002 (dose 3 mg kg−1, i.p.) increased by 5 fold the accumulation of extracellular noradrenaline caused by sibutramine (10 mg kg−1) and reduced the latency of sibutramine to reach its maximum effect from 144–56 min.RX821002-pretreatment increased by only 2.5 fold the increase in extracellular noradrenaline concentration caused by d-amphetamine alone (10 mg kg−1) and had no effect on the latency to reach maximum.These findings support evidence that sibutramine acts as a noradrenaline uptake inhibitor in vivo and that the effects of this drug are blunted by indirect activation of presynaptic α2-adreno-ceptors. In contrast, the rapid increase in extracellular noradrenaline concentration induced by d-amphetamine is consistent with this being mainly due to an increase in Ca2+-independent release of noradrenaline. PMID:10482917
The neuropharmacology of serotonin and noradrenaline in depression.
Nutt, David J
2002-06-01
Several classes of antidepressant drug exist, divided into three broad families, the monoamine reuptake inhibitors, the monoamine oxidase inhibitors and the monoamine receptor antagonists. All these drugs have a common pharmacological effect, to raise the synaptic concentrations of noradrenaline and serotonin. Although different drugs have different relative selectivity for noradrenaline and serotonin systems, these two neurotransmitter pathways work in parallel and in a coherent manner to produce the same final antidepressant response. The lag-time in the onset of action of antidepressants can be explained by the activation of inhibitory autoreceptors on serotonergic and noradrenergic neurones which initially attenuate the effects of antidepressants on synaptic transmitter levels. Over time, these autoreceptors desensitize, allowing the emergence of an overt antidepressant response. This theory has led to the proposition that antagonists at these autoreceptors such as pindolol may be useful adjuncts to antidepressant treatment, in order to hasten the appearance of a clinical response. Evidence for the clinical validity of this idea remains equivocal, however. The use of central monoamine depletion studies has demonstrated that it is elevated synaptic monoamine levels themselves, rather than some downstream postsynaptic changes in, for example, receptor sensitivity, that are responsible for the therapeutic effect of antidepressant drugs. Taken together, the data collected over the last 40 years have allowed the emergence of a unified monoamine hypothesis of antidepressant drug action.
International Nuclear Information System (INIS)
Barth, A.
1984-01-01
A comparative evaluation of two radioenzymatic procedures to determine the concentration of noradrenaline in the plasma - with linearity, sensitivity, specifity and accuracy serving as test criteria - led to the following results: In view of a probability of error in the order of 2% both methods were judged to show a satisfactory sensitivity. The specific of the COMT assay, by contrast with that of the PNMT assay, was found to be wanting, as the noradrenaline measurements in the presence of other biogenic amines were biassed in such a way that the values determined were higher than the actual concentrations. During antihypertensive treatment even minimal changes in the noradrenaline concentration can be ascertained on a quantitative basis. If suitable hardware is available, the COMT assay permits up to 25 single determinations to be carried out per day, while the number of double determinations is restricted to 7 per day. One advantage, however, lies in the fact that several catecholamines in the plasma can be detected simultaneously, if required. In cases where the noradrenaline concentration alone is to be determined for clinical purposes, preference should be given to the PNMT assay, as both tests showed equal linearity and sensitivity. (TRV) [de
Kiriakov, A; Khlebarova, M; Staneva-stoicheva, D; Panova, I
1975-01-01
The authors examined the changes in arterial blood pressure and the content of Noradrenaline in the myocardium, brain and aorta of rats with hypertension due to nephrectomy and treatment with desoxycorticosterone and NaCl, and after a chronic 6-month treatment of hypertension with various antihypertensive means. The most significant reduction of noradrenaline in the three of the examined tissues was found in rats, which received dic. sulfyram (100 mg/kg per os). Clondine (10 mkg/kg, per os) manifested the strongest hypotensive effect and lowered the level of noradrenaline in the myocardium, while it was raised in the aorta. Reserpine (10 mkg/kg, s. c) induced a clear reduction of Noradrenaline content in the brain, but an increase in the other two tissues. Insignificant hypotensive effect was observed in animals, treated with guanetidine (0.5 mg/kg, per os), which did not affect substantially noradrenaline in the examined organs. The increase of noradrenaline level was established in the three of the organs of animals, treated with alpha-methyl-DOFA (25 mg/kg, per os). Furosemide (1 mg/kg, s.c.) induced a statistically significant elevation of noradrenaline in the aorta, but was noneffective to noradrenaline in the myocardium and brain.
Feltmann, Kristin; Konradsson-Geuken, Åsa; De Bundel, Dimitri; Lindskog, Maria; Schilström, Björn
2015-12-01
Patients suffering from major depression often experience memory deficits even after the remission of mood symptoms, and many antidepressant drugs do not affect, or impair, memory in animals and humans. However, some antidepressant drugs, after a single dose, enhance cognition in humans (Harmer et al., 2009). To compare different classes of antidepressant drugs for their potential as memory enhancers, we used a version of the novel object recognition task in which rats spontaneously forget objects 24 hr after their presentation. Antidepressant drugs were injected systemically 30 min before or directly after the training phase (Session 1 [S1]). Post-S1 injections were used to test for specific memory-consolidation effects. The noradrenaline reuptake inhibitors reboxetine and atomoxetine, as well as the serotonin noradrenaline reuptake inhibitor duloxetine, injected prior to S1 significantly enhanced recognition memory. In contrast, the serotonin reuptake inhibitors citalopram and paroxetine and the cyclic antidepressant drugs desipramine and mianserin did not enhance recognition memory. Post-S1 injection of either reboxetine or citalopram significantly enhanced recognition memory, indicating an effect on memory consolidation. The fact that citalopram had an effect only when injected after S1 suggests that it may counteract its own consolidation-enhancing effect by interfering with memory acquisition. However, pretreatment with citalopram did not attenuate reboxetine's memory-enhancing effect. The D1/5-receptor antagonist SCH23390 blunted reboxetine's memory-enhancing effect, indicating a role of dopaminergic transmission in reboxetine-induced recognition memory enhancement. Our results suggest that antidepressant drugs specifically inhibiting noradrenaline reuptake enhance cognition and may be beneficial in the treatment of cognitive symptoms of depression. (c) 2015 APA, all rights reserved).
International Nuclear Information System (INIS)
Xiao, Deli; Liu, Shubo; Liang, Liyun; Bi, Yanping
2016-01-01
Epoxy propyl bonded magnetic microspheres were prepared by atomic layer deposition using Fe 3 O 4 -SiO 2 microspheres as a core support material. Then, a restricted-access magnetic sorbent was prepared that contains diol groups on the external surface and m-aminophenylboronic acid groups on the internal surface. This kind of microspheres achieved excellent specific adsorption of the ortho-dihydroxy compounds (dopamine, adrenaline and noradrenaline). Following desorption with sorbitol, the ortho-dihydroxy compounds were quantified by HPLC. The limits of detection for dopamine, adrenaline and noradrenaline were 0.074, 0.053 and 0.095 μg mL −1 , respectively. Recoveries from spiked mice serum samples range from 80.2 to 89.1 %. (author)
International Nuclear Information System (INIS)
Bucher, B.; Neuburger, J.; Illes, P.
1991-01-01
In isolated rat tail arteries preincubated with [3H]noradrenaline, electrical field stimulation evoked the overflow of tritium. Phorbol 12-myristate 13-acetate (PMA), a protein kinase C (PKC) activating phorbol ester, time-dependently increased the overflow at 1 mumol/L but not at 0.1 mumol/L. In contrast, the overflow was not altered by phorbol 13-acetate (PA, 1 mumol/L), which does not influence the activity of PKC. Polymyxin B (70 mumol/L), an inhibitor of PKC, depressed the overflow when given alone and, in addition, attenuated the effect of PMA, 1 mumol/L. The selective alpha 2-adrenoceptor agonist B-HT 933 depressed the overflow; PMA, 1 mumol/L, did not interfere with the effect of B-HT 933, 10 mumol/L. The results provide evidence for the participation of prejunctionally located PKC in the release of noradrenaline. However, PKC does not seem to be involved in the alpha 2-adrenoceptor-agonist-mediated inhibition of noradrenaline release
Tonic inhibition by orphanin FQ/nociceptin of noradrenaline neurotransmission in the amygdala
Kawahara, Y; Hesselink, M.B.; van Scharrenburg, G; Westerink, B.H.C.
2004-01-01
The present microdialysis study investigated whether nociceptin/orphanin FQ exerts a tonic inhibition of the release of noradrenaline in the basolateral nucleus of the amygdala in awake rats. The non-peptide competitive nociceptin/orphanin FQ (N/OFQ) peptide receptor antagonist J-113397 (20 mg/kg
Na+-independent, nifedipine-resistant rat afferent arteriolar Ca2+ responses to noradrenaline
DEFF Research Database (Denmark)
Salomonsson, Max; Braunstein, Thomas Hartig; von Holstein-Rathlou, Niels-Henrik
2010-01-01
Abstract Aim: In rat afferent arterioles we investigated the role of Na(+) entry in noradrenaline (NA)-induced depolarization and voltage-dependent Ca(2+) entry together with the importance of the transient receptor potential channel (TRPC) subfamily for non-voltage-dependent Ca(2+) entry. Methods...
Agnisola, Claudio; Randall, David J; Taylor, Edwin W
2003-01-01
The possible interactions between inhibitory vagal control of the heart and circulating levels of catecholamines in dogfish (Squalus acanthias) were studied using an in situ preparation of the heart, which retained intact its innervation from centrally cut vagus nerves. The response to peripheral vagal stimulation typically consisted of an initial cardiac arrest, followed by an escape beat, leading to renewed beating at a mean heart rate lower than the prestimulation rate (partial recovery). Cessation of vagal stimulation led to a transient increase in heart rate, above the prestimulation rate. This whole response was completely abolished by 10(-4) M atropine (a muscarinic cholinergic antagonist). The degree of vagal inhibition was evaluated in terms of both the initial, maximal cardiac interval and the mean heart rate during partial recovery, both expressed as a percentage of the prestimulation heart rate. The mean prestimulation heart rate of this preparation (36+/-4 beats min(-1)) was not affected by noradrenaline but was significantly reduced by 10(-4) M nadolol (a beta-adrenergic receptor antagonist), suggesting the existence of a resting adrenergic tone arising from endogenous catecholamines. The degree of vagal inhibition of heart rate varied with the rate of stimulation and was increased by the presence of 10(-8) M noradrenaline (the normal in vivo level in routinely active fish), while 10(-7) M noradrenaline (the in vivo level measured in disturbed or deeply hypoxic fish) reduced the cardiac response to vagal stimulation. In the presence of 10(-7) M noradrenaline, 10(-4) M nadolol further reduced the vagal response, while 10(-4) M nadolol + 10(-4) M phentolamine had no effect, indicating a complex interaction between adrenoreceptors, possibly involving presynaptic modulation of vagal inhibition.
Stress at birth: plasma noradrenaline concentrations of women in labour and in cord blood.
Messow-Zahn, K; Sarafoff, M; Riegel, K P
1978-03-15
Radioenzymatically measured plasma noradrenaline concentrations, present at birth in umbilical veins of 19 healthy, 17 acutely asphyxiated, and 9 chronically distressed newborn infants were found to be elevated above maternal values proportional to the degree of distress and to plasma H ion concentrations.
Wijnen, H.J.L.M.; Kloet, E.R. de; Versteeg, D.H.G.; Jong, Wybren de
1980-01-01
The noradrenaline concentration and the α-methyl-para-tyrosine (α-MPT)-induced disappearance of noradrenaline were determined in several nuclei of the hypothalamus and the medulla oblongata of renal hypertensive rats (two-kidney Goldblatt hypertension). A decreased α-MPT-induced disappearance of
Functional adaptation of the human β-cells after frequent exposure to noradrenaline
DEFF Research Database (Denmark)
Dela, Flemming
2015-01-01
KEY POINTS: Trained people produce less insulin than untrained; there is an adaptation of the insulin-producing cells to the trained state. The mechanism behind this adaptation is not known, but some sort of memory must be introduced into the insulin-producing cells. Here it is shown that this me......KEY POINTS: Trained people produce less insulin than untrained; there is an adaptation of the insulin-producing cells to the trained state. The mechanism behind this adaptation is not known, but some sort of memory must be introduced into the insulin-producing cells. Here it is shown...... that this memory is introduced by 10 daily intravenous infusions of noradrenaline, mimicking the increases that occur during a 10 day training programme. Thus, after the infusion period, the subjects produced less insulin in response to the same stimulus. It is concluded that exercise-induced increases...... in noradrenaline is most likely the stimulus that introduces a memory in the insulin-producing cells. ABSTRACT: Physical training decreases glucose- and arginine-stimulated insulin secretion. The mechanism by which the pancreatic β-cells adapt to the training status of the individual is not known. We hypothesized...
[Presence of conjugated noradrenaline in the walls of the nest of Vespula germanica Linné].
Lecomte, J; Bourdon, V; Damas, J; Leclercq, M; Leclercq, J
1976-01-01
Conjugated noradrenaline (NA) has been identified as a constituant of the walls of a Vespid wasp: Vespula germanica Linne. Concentrations range between 1,8 mug/g (external wall) and 18 mug/g (internal structure). Probably NA originates from the saliva of the Hymenoptera.
COPPES, RP; SMIT, J; BENTHEM, L; VANDERLEEST, J; ZAAGSMA, J
1995-01-01
The effect of intravenously applied (-)adrenaline, taken up by and released from sympathetic nerves, on swimming exercise-induced noradrenaline overflow in permanently cannulated adrenal demedullated rats was studied. Adrenaline (100 ng/min) was infused for 2 h, during which a plasma concentration
DEFF Research Database (Denmark)
Terkelsen, Astrid Juhl; Gierthmühlen, Janne; Petersen, Lars J.
2013-01-01
and in healthy volunteers. Seven patients and nine controls completed whole-body cooling (sympathetic activation) and heating (sympathetic inhibition) induced by a whole-body thermal suit with simultaneous measurement of the skin temperature, skin blood flow, and release of dermal noradrenaline. CRPS pain...
Kim, Youngsoo; Elmenhorst, David; Weisshaupt, Angela; Wedekind, Franziska; Kroll, Tina; McCarley, Robert W; Strecker, Robert E; Bauer, Andreas
2015-10-01
Although chronic sleep restriction frequently produces long-lasting behavioural and physiological impairments in humans, the underlying neural mechanisms are unknown. Here we used a rat model of chronic sleep restriction to investigate the role of brain adenosine and noradrenaline systems, known to regulate sleep and wakefulness, respectively. The density of adenosine A1 and A2a receptors and β-adrenergic receptors before, during and following 5 days of sleep restriction was assessed with autoradiography. Rats (n = 48) were sleep-deprived for 18 h day(-1) for 5 consecutive days (SR1-SR5), followed by 3 unrestricted recovery sleep days (R1-R3). Brains were collected at the beginning of the light period, which was immediately after the end of sleep deprivation on sleep restriction days. Chronic sleep restriction increased adenosine A1 receptor density significantly in nine of the 13 brain areas analysed with elevations also observed on R3 (+18 to +32%). In contrast, chronic sleep restriction reduced adenosine A2a receptor density significantly in one of the three brain areas analysed (olfactory tubercle which declined 26-31% from SR1 to R1). A decrease in β-adrenergic receptors density was seen in substantia innominata and ventral pallidum which remained reduced on R3, but no changes were found in the anterior cingulate cortex. These data suggest that chronic sleep restriction can induce long-term changes in the brain adenosine and noradrenaline receptors, which may underlie the long-lasting neurocognitive impairments observed in chronic sleep restriction. © 2015 European Sleep Research Society.
RADIONUCLIDE TRANSPORT MODELS UNDER AMBIENT CONDITIONS
Energy Technology Data Exchange (ETDEWEB)
S. Magnuson
2004-11-01
The purpose of this model report is to document the unsaturated zone (UZ) radionuclide transport model, which evaluates, by means of three-dimensional numerical models, the transport of radioactive solutes and colloids in the UZ, under ambient conditions, from the repository horizon to the water table at Yucca Mountain, Nevada.
Vinera, Jennifer; Kermen, Florence; Sacquet, Joëlle; Didier, Anne; Mandairon, Nathalie; Richard, Marion
2015-01-01
Noradrenaline contributes to olfactory-guided behaviors but its role in olfactory learning during adulthood is poorly documented. We investigated its implication in olfactory associative and perceptual learning using local infusion of mixed a1-ß adrenergic receptor antagonist (labetalol) in the adult mouse olfactory bulb. We reported that…
Del Arco, Alberto; Ronzoni, Giacomo; Mora, Francisco
2015-07-01
A dysfunction of prefrontal cortex has been associated with the exacerbated response to stress observed in schizophrenic patients and high-risk individuals to develop psychosis. The hypofunction of NMDA glutamatergic receptors induced by NMDA antagonists produces cortico-limbic hyperactivity, and this is used as an experimental model to resemble behavioural abnormalities observed in schizophrenia. The aim of the present study was to investigate whether injections of NMDA antagonists into the medial prefrontal cortex of the rat change (1) the increases of dopamine, noradrenaline and corticosterone concentrations produced by acute stress in amygdala, and (2) the acquisition of aversive memory related to a stressful event. Male Wistar rats were implanted with guide cannulae to perform microdialysis and bilateral microinjections (0.5 μl/side) of the NMDA antagonist 3-[(R)-2-carboxypiperazin-4-yl]-propyl-1-phophonic acid (CPP) (25 and 100 ng). Prefrontal injections were performed 60 min before restraint stress in microdialysis experiments, or training (footshock; 0.6 mA, 2 s) in inhibitory avoidance test. Retention latency was evaluated 24 h after training as an index of aversive memory. Acute stress increased amygdala dialysate concentrations of dopamine (160% of baseline), noradrenaline (145% of baseline) and corticosterone (170% of baseline). Prefrontal injections of CPP did not change the increases of dopamine, noradrenaline or corticosterone produced by stress. In contrast, CPP significantly reduced the retention latency in the inhibitory avoidance test. These results suggest that the hypofunction of prefrontal NMDA receptors does not change the sensitivity to acute stress of dopamine and noradrenaline projections to amygdala but impairs the acquisition of aversive memory.
Noradrenaline and Parkinson's disease
Directory of Open Access Journals (Sweden)
Claire eDelaville
2011-05-01
Full Text Available Parkinson’s disease (PD is characterized by the degeneration of dopamine (DA neurons in the substantia nigra pars compacta, and motor symptoms including bradykinesia, rigidity and tremor at rest. These symptoms are manifest when around 70% of striatal DA is lost. In addition to motor deficits, PD is also characterized by the manifestation of non-motor symptoms. However, depletion of DA alone in animal models has failed to simultaneously elicit both the motor and non-motor deficits of PD because the disease is a multi-system disorder that features a profound loss of other neurotransmitter systems. There is growing evidence that additional loss of noradrenaline (NA neurons of the locus coeruleus, the principal source of NA in the brain, could be involved in the clinical expression of motor as well as in non-motor deficits. In the present review, we analyzed the latest data obtained from animal models of parkinsonism and from parkinsonian patients providing evidence for the implication of NA in the pathophysiology of PD. Recent studies have shown that NA depletion alone or combined with DA depletion resulted in motor as well as in non-motor dysfunctions. In addition, by using selective agonists and antagonists of alpha receptors we, and others, have shown that α2 receptors are implicated in the control of motor activity and that α2 receptor antagonists can improve PD motor symptoms as well as L-Dopa-induced dyskinesia. Here we provide arguments that the loss of NA neurons in PD has an impact on all PD symptoms and that the association of NAergic agents to dopaminergic medication can be beneficial in the treatment of the disease.
Noradrenaline spillover during exercise in active versus resting skeletal muscle in man
DEFF Research Database (Denmark)
Savard, G; Strange, S; Kiens, Bente
1987-01-01
Increases in plasma noradrenaline (NA) concentration occur during moderate to heavy exercise in man. This study was undertaken to examine the spillover of NA from both resting and contracting skeletal muscle during exercise. Six male subjects performed one-legged knee-extension so that all...... in the exercising leg than in the resting leg both during 50% and 100% leg exercise. These results suggest that contracting skeletal muscle may contribute to a larger extent than resting skeletal muscle to increasing the level of plasma NA during exercise. Contractile activity may influence the NA spillover from...
Hydro-dynamic Solute Transport under Two-Phase Flow Conditions.
Karadimitriou, Nikolaos K; Joekar-Niasar, Vahid; Brizuela, Omar Godinez
2017-07-26
There are abundant examples of natural, engineering and industrial applications, in which "solute transport" and "mixing" in porous media occur under multiphase flow conditions. Current state-of-the-art understanding and modelling of such processes are established based on flawed and non-representative models. Moreover, there is no direct experimental result to show the true hydrodynamics of transport and mixing under multiphase flow conditions while the saturation topology is being kept constant for a number of flow rates. With the use of a custom-made microscope, and under well-controlled flow boundary conditions, we visualized directly the transport of a tracer in a Reservoir-on-Chip (RoC) micromodel filled with two immiscible fluids. This study provides novel insights into the saturation-dependency of transport and mixing in porous media. To our knowledge, this is the first reported pore-scale experiment in which the saturation topology, relative permeability, and tortuosity were kept constant and transport was studied under different dynamic conditions in a wide range of saturation. The critical role of two-phase hydrodynamic properties on non-Fickian transport and saturation-dependency of dispersion are discussed, which highlight the major flaws in parametrization of existing models.
The Transport of Radioactive Materials under special arrangement
International Nuclear Information System (INIS)
Biaggio, A.L.; Vietri, J.R.L.
1993-01-01
The Agency's Regulations for the Safe Transport of Radioactive Material rule the international transport of these materials and provide the basis of national and regional regulations. The Regulations establish the technical, operational and administrative requirements which shall be accomplished to carry out the transport of radioactive materials (RAM). They also allow the transport in different conditions of those currently applicable and, in such cases, establish that the transport shall be made under special arrangement. To approve a transport under special arrangement the involved Competent Authority shall be satisfied that the alternative provisions are adequate to ensure that the overall level of safety in transport and in-transit storage is at least equivalent to that which would be provided if all the applicable requirements had been met (para. 2ll of the International Atomic Energy Agency Safety Series No. 6). This paper explains some difficulties the Argentine Competent. Authority has experienced trying by comparing the equivalence between the level of safety resulting from the compliance with current requirements and the overall level of safety which is provided by the application of alternative provisions. As most of the experience gained come from the transport of RAM by road, only this mode of transport is considered. (J.P.N.)
Tse, W S; Bond, A J
2006-09-01
The aim of the present study was to explore the role of noradrenaline on the social behaviour of healthy volunteers when they were interacting with a familiar person, their flatmate. Interaction with the flatmate was explored in a cooperative game situation. Ten pairs of same-sex healthy volunteer flatmates aged 18-25 years were recruited for the experiment. All volunteers gave written informed consent and the study was approved by the institutional ethical committee. A randomised, double blind, placebo-controlled crossover trial of reboxetine versus placebo was conducted. In each of the 10 pairs of volunteers, one (subject) volunteered to take the tablets and the other (flatmate) received no treatment. Reboxetine (4 mg/bd) and placebo were administered orally as identical capsules for 2 weeks. The subjects were randomly assigned to receive either reboxetine or placebo first and there was a two-week washout period following the first treatment. At baseline and the end of each treatment, they filled in the Beck Depression Inventory (BDI), Social Adapation Self-Evaluation Scale (SASS), and Aggression Questionnaire (AQ). Then, they were instructed to play the Tangrams game. This task elicits face-valid social behaviours such as cooperation, giving commands and unilateral grasps. Analysis of covariance showed that there was a statistical trend for reboxetine treatment to increase commands (p=0.055). This study presents preliminary evidence that two weeks' enhancement of noradrenaline transmission induced by reboxetine makes healthy volunteers more self-confident and assertive.
Radionuclide Transport Models Under Ambient Conditions
International Nuclear Information System (INIS)
Moridis, G.; Hu, Q.
2000-01-01
The purpose of this Analysis/Model Report (AMR) is to evaluate (by means of 2-D semianalytical and 3-D numerical models) the transport of radioactive solutes and colloids in the unsaturated zone (UZ) under ambient conditions from the potential repository horizon to the water table at Yucca Mountain (YM), Nevada. This is in accordance with the ''AMR Development Plan U0060, Radionuclide Transport Models Under Ambient Conditions'' (CRWMS M and O 1999a). This AMR supports the UZ Flow and Transport Process Model Report (PMR). This AMR documents the UZ Radionuclide Transport Model (RTM). This model considers: the transport of radionuclides through fractured tuffs; the effects of changes in the intensity and configuration of fracturing from hydrogeologic unit to unit; colloid transport; physical and retardation processes and the effects of perched water. In this AMR they document the capabilities of the UZ RTM, which can describe flow (saturated and/or unsaturated) and transport, and accounts for (a) advection, (b) molecular diffusion, (c) hydrodynamic dispersion (with full 3-D tensorial representation), (d) kinetic or equilibrium physical and/or chemical sorption (linear, Langmuir, Freundlich or combined), (e) first-order linear chemical reaction, (f) radioactive decay and tracking of daughters, (g) colloid filtration (equilibrium, kinetic or combined), and (h) colloid-assisted solute transport. Simulations of transport of radioactive solutes and colloids (incorporating the processes described above) from the repository horizon to the water table are performed to support model development and support studies for Performance Assessment (PA). The input files for these simulations include transport parameters obtained from other AMRs (i.e., CRWMS M and O 1999d, e, f, g, h; 2000a, b, c, d). When not available, the parameter values used are obtained from the literature. The results of the simulations are used to evaluate the transport of radioactive solutes and colloids, and
Bergh, Marianne Skov-Skov; Bogen, Inger Lise; Andersen, Jannike Mørch; Øiestad, Åse Marit Leere; Berg, Thomas
2018-01-01
A novel ion pair reversed phase ultra high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method for simultaneous determination of the stress hormones adrenaline, noradrenaline and corticosterone in rodent blood was developed and fully validated. Separations were performed on an Acquity HSS T3 column (2.1mm i.d.×100mm, 1.8μm) with gradient elution and a runtime of 5.5min. The retention of adrenaline and noradrenaline was substantially increased by employing the ion pair reagent heptafluorobutyric acid (HFBA). Ion pair reagents are usually added to the mobile phase only, but we demonstrate for the first time that including HFBA to the sample reconstitution solvent as well, has a major impact on the chromatography of these compounds. The stability of adrenaline and corticosterone in rodent blood was investigated using the surrogate analytes adrenaline-d 3 and corticosterone-d 8 . The applicability of the described method was demonstrated by measuring the concentration of stress hormones in rodent blood samples. Copyright © 2017 Elsevier B.V. All rights reserved.
Noradrenaline increases the expression and release of Hsp72 by human neutrophils.
Giraldo, E; Multhoff, G; Ortega, E
2010-05-01
The blood concentration of extracellular 72kDa heat shock protein (eHsp72) increases under conditions of stress, including intense exercise. However, the signal(s), source(s), and secretory pathways in its release into the bloodstream have yet to be clarified. The aim of the present study was to evaluate the role of noradrenaline (NA) as a stress signal on the expression and release of Hsp72 by circulating neutrophils (as a source), all within a context of the immunophysiological regulation during exercise-induced stress in sedentary and healthy young (21-26years) women. The expression of Hsp72 on the surface of isolated neutrophils was determined by flow cytometry, and its release by cultured isolated neutrophils was determined by ELISA. Incubation with cmHsp70-FITC showed that neutrophils express Hsp72 on their surface under basal conditions. In addition, cultured isolated neutrophils (37 degrees C and 5% CO(2)) also released Hsp72 under basal conditions, with this release increasing from 10min to 24h in the absence of cell damage. NA at 10(-9)-10(-5)M doubled the percentage of neutrophils expressing Hsp72 after 60min and 24h incubation. NA also stimulated (by about 20%) the release of Hsp72 after 10min of incubation. (1) Hsp72 is expressed on the surface of isolated neutrophils under basal conditions, and this expression is augmented by NA. (2) Isolated neutrophils can also release Hsp72 under cultured basal conditions in the absence of cell death, and NA can increase this release. These results may contribute to confirming the hypothesis that NA can act as a "stress signal" for the increased eHsp72 in the context of exercise stress, with a role for neutrophils as a source for the expression and, to a lesser degree, the release of Hsp72 after activation by NA. Copyright 2010 Elsevier Inc. All rights reserved.
Cardinal, R; Nadeau, R; Laurent, C; Boudreau, G; Armour, J A
1996-09-01
To investigate the capacity of efferent sympathetic neurons to modulate the failing heart, stellate ganglion stimulation was performed in dogs with biventricular heart failure induced by rapid ventricular pacing (240 beats/min) for 4-6 weeks. Less noradrenaline was released from cardiac myoneural junctions into coronary sinus blood in response to left stellate ganglion stimulation in anesthetized failing heart preparations (582 pg/mL, lower and upper 95% confidence intervals of 288 and 1174 pg/mL, n = 19) compared with healthy heart preparations (6391 pg/mL, 95% confidence intervals of 4180 and 9770 pg/mL, n = 14; p < 0.001). There was substantial adrenaline extraction by failing hearts (49 +/- 6%), although it was slightly lower than in healthy heart preparations (65 +/- 9%, p = 0.055). In contrast with healthy heart preparations, no net release of adrenaline occurred during stellate ganglion stimulation in any of the failing heart preparations, and ventricular tissue levels of adrenaline fell below the sensitivity limit of the HPLC technique. In failing heart preparations, maximal electrical stimulation of right or left stellate ganglia resulted in minimal augmentation of left ventricular intramyocardial (17%) and chamber (12%) systolic pressures. These indices were augmented by 145 and 97%, respectively, following exogenous noradrenaline administration. Thus, the cardiac efferent sympathetic neurons' reduced capacity to release noradrenaline and modify cardiac function can contribute to reduction of sympathetic support to the failing heart.
A quasilinear model for solute transport under unsaturated flow
International Nuclear Information System (INIS)
Houseworth, J.E.; Leem, J.
2009-01-01
We developed an analytical solution for solute transport under steady-state, two-dimensional, unsaturated flow and transport conditions for the investigation of high-level radioactive waste disposal. The two-dimensional, unsaturated flow problem is treated using the quasilinear flow method for a system with homogeneous material properties. Dispersion is modeled as isotropic and is proportional to the effective hydraulic conductivity. This leads to a quasilinear form for the transport problem in terms of a scalar potential that is analogous to the Kirchhoff potential for quasilinear flow. The solutions for both flow and transport scalar potentials take the form of Fourier series. The particular solution given here is for two sources of flow, with one source containing a dissolved solute. The solution method may easily be extended, however, for any combination of flow and solute sources under steady-state conditions. The analytical results for multidimensional solute transport problems, which previously could only be solved numerically, also offer an additional way to benchmark numerical solutions. An analytical solution for two-dimensional, steady-state solute transport under unsaturated flow conditions is presented. A specific case with two sources is solved but may be generalized to any combination of sources. The analytical results complement numerical solutions, which were previously required to solve this class of problems.
Noradrenaline and dopamine levels in acute cerveau isolé in the cat.
Szikszay, M; Benedek, G; Obál, F; Obál, F
1980-01-01
Noradrenaline (NA) and dopamine (DA) levels were studied in the forebrain of acute immobilized cats and in cerveau isolé preparations. A gradual decrease in NA and DA was observed one and two hours after high mesencephalic transection, while the amount of NA increased in acute immobilized cats after the cessation of ether anaesthesia. These changes in NA level are consistent with the observations suggesting an inverse relationship between NA and cortical deactivation. The decrease of DA with an exaggeration of spindle activity and increased synchronizing effect of basal forebrain stimulation indicate that the spindle-increasing effect of DA suggested by several authors requires the contribution of the brain stem.
Grivel, Jeremy; Cvetkovic, Vesna; Bayer, Laurence; Machard, Danièle; Tobler, Irene; Mühlethaler, Michel; Serafin, Mauro
2005-04-20
Sleep deprivation is accompanied by the progressive development of an irresistible need to sleep, a phenomenon whose mechanism has remained elusive. Here, we identified for the first time a reflection of that phenomenon in vitro by showing that, after a short 2 h period of total sleep deprivation, the action of noradrenaline on the wake-promoting hypocretin/orexin neurons changes from an excitation to an inhibition. We propose that such a conspicuous modification of responsiveness should contribute to the growing sleepiness that accompanies sleep deprivation.
Lifescience Database Archive (English)
Full Text Available 3975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens Align...lue sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline transporter... 31 2.1 sp...|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid... 30 4.7 >sp|P23975|SC6A2_HUMAN Sodium-dependent noradrenaline
Varazzani, Chiara; San-Galli, Aurore; Gilardeau, Sophie; Bouret, Sebastien
2015-05-20
Motivation determines multiple aspects of behavior, including action selection and energization of behavior. Several components of the underlying neural systems have been examined closely, but the specific role of the different neuromodulatory systems in motivation remains unclear. Here, we compare directly the activity of dopaminergic neurons from the substantia nigra pars compacta and noradrenergic neurons from the locus coeruleus in monkeys performing a task manipulating the reward/effort trade-off. Consistent with previous reports, dopaminergic neurons encoded the expected reward, but we found that they also anticipated the upcoming effort cost in connection with its negative influence on action selection. Conversely, the firing of noradrenergic neurons increased with both pupil dilation and effort production in relation to the energization of behavior. Therefore, this work underlines the contribution of dopamine to effort-based decision making and uncovers a specific role of noradrenaline in energizing behavior to face challenges. Copyright © 2015 the authors 0270-6474/15/357866-12$15.00/0.
Versteeg, D.H.G.; Ree, J.M. van; Provoost, Abraham P.; Jong, Wybren de
1974-01-01
Endogenous noradrenaline levels are elevated in medulla oblongata, mesencephalon, pons and thalamus of adult rats which had been treated with 6-hydroxydopamine on days 1, 2, 8 and 15 after birth. Levels in spinal cord, cerebellum, hippocampus/amygdala and cortex are depressed, whereas no significant
CFTR mediates noradrenaline-induced ATP efflux from DRG neurons.
Kanno, Takeshi; Nishizaki, Tomoyuki
2011-09-24
In our earlier study, noradrenaline (NA) stimulated ATP release from dorsal root ganglion (DRG) neurons as mediated via β(3) adrenoceptors linked to G(s) protein involving protein kinase A (PKA) activation, to cause allodynia. The present study was conducted to understand how ATP is released from DRG neurons. In an outside-out patch-clamp configuration from acutely dissociated rat DRG neurons, single-channel currents, sensitive to the P2X receptor inhibitor PPADS, were evoked by approaching the patch-electrode tip close to a neuron, indicating that ATP is released from DRG neurons, to activate P2X receptor. NA increased the frequency of the single-channel events, but such NA effect was not found for DRG neurons transfected with the siRNA to silence the cystic fibrosis transmembrane conductance regulator (CFTR) gene. In the immunocytochemical study using acutely dissociated rat DRG cells, CFTR was expressed in neurons alone, but not satellite cells, fibroblasts, or Schwann cells. It is concluded from these results that CFTR mediates NA-induced ATP efflux from DRG neurons as an ATP channel.
Selective noradrenaline depletion impairs working memory and hippocampal neurogenesis.
Coradazzi, Marino; Gulino, Rosario; Fieramosca, Francesco; Falzacappa, Lucia Verga; Riggi, Margherita; Leanza, Giampiero
2016-12-01
Noradrenergic neurons in the locus coeruleus play a role in learning and memory, and their loss is an early event in Alzheimer's disease pathogenesis. Moreover, noradrenaline may sustain hippocampal neurogenesis; however, whether are these events related is still unknown. Four to five weeks following the selective immunotoxic ablation of locus coeruleus neurons, young adult rats underwent reference and working memory tests, followed by postmortem quantitative morphological analyses to assess the extent of the lesion, as well as the effects on proliferation and/or survival of neural progenitors in the hippocampus. When tested in the Water Maze task, lesioned animals exhibited no reference memory deficit, whereas working memory abilities were seen significantly impaired, as compared with intact or sham-lesioned controls. Stereological analyses confirmed a dramatic noradrenergic neuron loss associated to reduced proliferation, but not survival or differentiation, of 5-bromo-2'deoxyuridine-positive progenitors in the dentate gyrus. Thus, ascending noradrenergic afferents may be involved in more complex aspects of cognitive performance (i.e., working memory) possibly via newly generated progenitors in the hippocampus. Copyright © 2016 Elsevier Inc. All rights reserved.
Radionuclide Transport Models Under Ambient Conditions
International Nuclear Information System (INIS)
Moridis, G.; Hu, Q.
2001-01-01
The purpose of Revision 00 of this Analysis/Model Report (AMR) is to evaluate (by means of 2-D semianalytical and 3-D numerical models) the transport of radioactive solutes and colloids in the unsaturated zone (UZ) under ambient conditions from the potential repository horizon to the water table at Yucca Mountain (YM), Nevada
Lifescience Database Archive (English)
Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S
Structural Evaluation on HIC Transport Packaging under Accident Conditions
International Nuclear Information System (INIS)
Chung, Sung Hwan; Kim, Duck Hoi; Jung, Jin Se; Yang, Ke Hyung; Lee, Heung Young
2005-01-01
HIC transport packaging to transport a high integrity container(HIC) containing dry spent resin generated from nuclear power plants is to comply with the regulatory requirements of Korea and IAEA for Type B packaging due to the high radioactivity of the content, and to maintain the structural integrity under normal and accident conditions. It must withstand 9 m free drop impact onto an unyielding surface and 1 m drop impact onto a mild steel bar in a position causing maximum damage. For the conceptual design of a cylindrical HIC transport package, three dimensional dynamic structural analysis to ensure that the integrity of the package is maintained under all credible loads for 9 m free drop and 1 m puncture conditions were carried out using ABAQUS code.
Koopmans, Sietse Jan; Ruis, Marko; Dekker, Ruud; van Diepen, Hans; Korte, Mechiel; Mroz, Zdzislaw
2005-07-21
Social stress occurs in intensive pig farming due to aggressive behavior. This stress may be reduced at elevated dietary levels of tryptophan (TRP). In this study, we compared the effects of high (13.2%) vs. normal (3.4%) dietary TRP to large neutral amino acid (LNAA) ratios on behavior and stress hormones in catheterized pigs ( approximately 50 kg BW), which were exposed to social stress by placing them twice into the territory of a dominant pig ( approximately 60 kg) for 15 min. Pre-stress plasma TRP concentrations were 156+/-15 vs. 53+/-6 micromol/l (psocial confrontations, pigs on the high vs. normal TRP diets show a tendency towards reduced active avoidance behavior (3.2+/-1.1 vs. 6.7+/-1.2 min, psocial confrontations, the post-stress plasma cortisol, noradrenaline and adrenaline concentrations and/or curves (from +5 min to 2 h) were lower/steeper (psurplus TRP in diets for pigs (1) does not significantly affect behavior when exposed to social stress, (2) reduces basal plasma cortisol and noradrenaline concentrations, (3) does not affect the immediate hormonal response to stress, and (4) reduces the long-term hormonal response to stress. In general, pigs receiving high dietary TRP were found to be less affected by stress.
GPR40/FFAR1 deficient mice increase noradrenaline levels in the brain and exhibit abnormal behavior
Directory of Open Access Journals (Sweden)
Fuka Aizawa
2016-12-01
Full Text Available The free fatty acid receptor 1 (GPR40/FFAR1 is a G protein-coupled receptor, which is activated by long chain fatty acids. We have previously demonstrated that activation of brain GPR40/FFAR1 exerts an antinociceptive effect that is mediated by the modulation of the descending pain control system. However, it is unclear whether brain GPR40/FFAR1 contributes to emotional function. In this study, we investigated the involvement of GPR40/FFAR1 in emotional behavior using GPR40/FFAR1 deficient (knockout, KO mice. The emotional behavior in wild and KO male mice was evaluated at 9–10 weeks of age by the elevated plus-maze test, open field test, social interaction test, and sucrose preference test. Brain monoamines levels were measured using LC–MS/MS. The elevated plus-maze test and open field tests revealed that the KO mice reduced anxiety-like behavior. There were no differences in locomotor activity or social behavior between the wild and KO mice. In the sucrose preference test, the KO mice showed reduction in sucrose preference and intake. The level of noradrenaline was higher in the hippocampus, medulla oblongata, hypothalamus and midbrain of KO mice. Therefore, these results suggest that brain GPR40/FFAR1 is associated with anxiety- and depression-related behavior regulated by the increment of noradrenaline in the brain.
DEFF Research Database (Denmark)
Henriksen, Jens Henrik Sahl; Christensen, N J; Ring-Larsen, H
1981-01-01
indicates that sympathetic nervous activity is enhanced in patients with cirrhosis. Based on the above positive correlation between NA and heart rate and the significant release of NA from the kidney, it may be hypothesized that the increased sympathetic nervous activity especially involves heart and kidney......Plasma noradrenaline (NA) and adrenaline (A) concentrations were related to various haemodynamic parameters in fifteen patients with cirrhosis. In supine position at rest plasma NA and A in peripheral venous blood were significantly higher in patients with cirrhosis than in normal subjects. Mean...
One-dimensional radionuclide transport under time-varying conditions
International Nuclear Information System (INIS)
Gelbard, F.; Olague, N.E.; Longsine, D.E.
1990-01-01
This paper discusses new analytical and numerical solutions presented for one-dimensional radionuclide transport under time-varying fluid-flow conditions including radioactive decay. The analytical solution assumes that all radionuclides have identical retardation factors, and is limited to instantaneous releases. The numerical solution does not have these limitations, but is tested against the limiting case given for the analytical solution. Reasonable agreement between the two solutions was found. Examples are given for the transport of a three-member radionuclide chain transported over distances and flow rates comparable to those reported for Yucca Mountain, the proposed disposal site for high-level nuclear waste
Grishchenko, V I; Koliada, L D; Demidenko, D I
1977-01-01
Melatonin content in the epiphysis, serotonin, noradrenaline, dopamine-in the hypothalamus, gonadotropins--in the hypophysis of rats was studied under normal conditions and following ovariectomy; regularly of the estral cycle phases was studied as well. Two series of experiments were conducted on 120 rats with regular estral cycles. The animals were divided into groups according to the estral cycle phase. Melatonin concentration in the epiphysis, serotonin, noradrenaline, dopamine--in the hypothalamus was subject to variations coinciding with the estral cycle phases. Serotonin, noradrenaline, and dopamine content decreased in the hypophysis of ovariectomized rats in comparison with control; melatonin content rose in the epiphysis. There was no complete extinction of the estral cycle in the course of investigation (20 days). The action of castration on the sexual cycle depended on the phase at which the rats were subjected to ovariectomy. A reverse relationship existed between the melatonin content in the epiphysis and serotonin content in the hypothalamus, this serving as one of the important factors in the regulation of the sexual function.
Dempsey, Paddy C; Sacre, Julian W; Larsen, Robyn N; Straznicky, Nora E; Sethi, Parneet; Cohen, Neale D; Cerin, Ester; Lambert, Gavin W; Owen, Neville; Kingwell, Bronwyn A; Dunstan, David W
2016-12-01
Prolonged sitting is increasingly recognized as a ubiquitous cardiometabolic risk factor, possibly distinct from lack of physical exercise. We examined whether interrupting prolonged sitting with brief bouts of light-intensity activity reduced blood pressure (BP) and plasma noradrenaline in type 2 diabetes (T2D). In a randomized crossover trial, 24 inactive overweight/obese adults with T2D (14 men; mean ± SD; 62 ± 6 years) consumed standardized meals during 3 × 8 h conditions: uninterrupted sitting (SIT); sitting + half-hourly bouts of walking (3.2 km/h for 3-min) (light-intensity walking); and sitting + half-hourly bouts of simple resistance activities for 3 min (SRAs), each separated by 6-14 days washout. Resting seated BP was measured hourly (mean of three recordings, ≥20-min postactivity). Plasma noradrenaline was measured at 30-min intervals for the first hour after meals and hourly thereafter. Compared with SIT, mean resting SBP and DBP were significantly reduced (P light-intensity walking (mean ± SEM; -14 ± 1/-8 ± 1 mmHg) and SRA (-16 ± 1/-10 ± 1 mmHg), with a more pronounced effect for SRA (P light-intensity walking). Similarly, mean plasma noradrenaline was significantly reduced for both light-intensity walking (-0.3 ± 0.1 nmol/l) and SRA (-0.6 ± 0.1 nmol/l) versus SIT, with SRA lower than light-intensity walking (P light-intensity walking (-3 ± 1 bpm; P light-intensity walking or SRA reduces resting BP and plasma noradrenaline in adults with T2D, with SRA being more effective. Given the ubiquity of sedentary behaviors and poor adherence to structured exercise, this approach may have important implications for BP management in patients with T2D.
Directory of Open Access Journals (Sweden)
Akay AP
2015-11-01
Full Text Available Aynur Pekcanlar Akay,1 Gamze Capa Kaya,2,3 Burak Baykara,1 Yusuf Demir,2,3 Handan Özek,1 Sevay Alsen,1 Mine Sencan Eren,2,3 Neslihan Inal Emiroglu,1 Turkan Ertay,2,3 Yesim Ozturk,4 Suha Miral,1 Hatice Durak,2,3 Evren Tufan4 1Department of Child and Adolescent Psychiatry, 2Department of Nuclear Medicine, 3Department of Pediatrics, Dokuz Eylul University Medical Faculty, Izmir, 4Department of Child and Adolescent Psychiatry, Abant İzzet Baysal University, Bolu, Turkey Abstract: Attention deficit/hyperactivity disorder is one of the most common neurodevelopmental disorders. The pathophysiology is thought to involve noradrenaline and dopamine. The role of dopamine transporter (DAT was evaluated in imaging studies using mostly dopamine reuptake inhibitors. Atomoxetine is a selective noradrenaline reuptake inhibitor. Here we report the results of a pilot study conducted to evaluate changes in striatal DAT after 8 weeks of atomoxetine treatment. Our results suggest that 8 weeks of atomoxetine treatment may change striatal DAT bioavailability as measured via SPECT but that change was not correlated with genotype or clinical improvement. Keywords: neuroimaging, dopamine, noradrenaline, SLC6A3 protein, human, pragmatic clinical trial, pilot study
Tariff Policy and Transport Costs under Reciprocal Dumping
Jun Oshiro
2011-01-01
This paper analyzes tariff competition by investigating the strategic interactions among firms that are highly mobile across national boundaries. Although high transport costs yield a geographic dispersion of the industry, sufficiently low transport costs result in a core-periphery location where nobody bears tariff burdens. In any case, the world economy would be in a much better position under an international coordination scheme. An economy is only required to enforce a weak international ...
Gouw, M. A.; Wilffert, B.; Wermelskirchen, D.; van Zwieten, P. A.
1990-01-01
We determined the contribution of intracellular Ca2+ to the noradrenaline (NA, 3 X 10(-5) mmol/l)-induced contraction of the isolated guinea pig aorta. Since only about 55% of the NA-induced contraction could be attributed to intracellular Ca2+ release, we assumed that a Ca2+ influx component
GPR40/FFAR1 deficient mice increase noradrenaline levels in the brain and exhibit abnormal behavior.
Aizawa, Fuka; Nishinaka, Takashi; Yamashita, Takuya; Nakamoto, Kazuo; Kurihara, Takashi; Hirasawa, Akira; Kasuya, Fumiyo; Miyata, Atsuro; Tokuyama, Shogo
2016-12-01
The free fatty acid receptor 1 (GPR40/FFAR1) is a G protein-coupled receptor, which is activated by long chain fatty acids. We have previously demonstrated that activation of brain GPR40/FFAR1 exerts an antinociceptive effect that is mediated by the modulation of the descending pain control system. However, it is unclear whether brain GPR40/FFAR1 contributes to emotional function. In this study, we investigated the involvement of GPR40/FFAR1 in emotional behavior using GPR40/FFAR1 deficient (knockout, KO) mice. The emotional behavior in wild and KO male mice was evaluated at 9-10 weeks of age by the elevated plus-maze test, open field test, social interaction test, and sucrose preference test. Brain monoamines levels were measured using LC-MS/MS. The elevated plus-maze test and open field tests revealed that the KO mice reduced anxiety-like behavior. There were no differences in locomotor activity or social behavior between the wild and KO mice. In the sucrose preference test, the KO mice showed reduction in sucrose preference and intake. The level of noradrenaline was higher in the hippocampus, medulla oblongata, hypothalamus and midbrain of KO mice. Therefore, these results suggest that brain GPR40/FFAR1 is associated with anxiety- and depression-related behavior regulated by the increment of noradrenaline in the brain. Copyright © 2016 The Authors. Production and hosting by Elsevier B.V. All rights reserved.
Gouw, M.A.M.; Wilffert, B.; Wermelskirchen, D.; Van Zwieten, P.A.
1990-01-01
We determined the contribution of intracellular Ca2+to the noradrenaline (NA, 3 x 10-5mmol/l)-induced contraction of the isolated guinea pig aorta. Since only about 55% of the NA-induced contraction could be attributed to intracellular Ca2+release, we assumed that a Ca2+influx component contributes
Minimizing the effects of restraint and human interaction on the endocrine physiology of animals is essential for collection of accurate physiological measurements. Our objective was to compare stress-induced cortisol (CORT) and noradrenalin (NorA) responses in automated versus manual blood sampling...
Fletcher, P. J.; Paterson, I. A.
1989-01-01
1. The effects on food intake in rats of injection of m- and p-octopamine into the paraventricular nucleus (PVN) of the hypothalamus were examined, and compared to the effects of noradrenaline (NA). 2. m-Octopamine injected into the PVN induced a dose-dependent increase in food intake, with the maximal effect occurring at a dose of 25 nmol. p-Octopamine did not elicit eating unless it was administered to animals pretreated with the monoamine oxidase inhibitor, pargyline. 3. The effects of pre...
Géranton, Sandrine M; Heal, David J; Stanford, S Clare
2004-03-01
There is extensive evidence for functional interactions between central noradrenergic and serotonergic neurones. Here, dual-probe microdialysis was used in freely-moving rats to compare the effects of 5-HT on noradrenergic transmission in the rat frontal cortex and hypothalamus. We studied the effects of the 5-HT synthesis inhibitor, para-chlorophenylalanine (pCPA; which depleted 5-HT stores in both the frontal cortex and the hypothalamus), on spontaneous efflux of noradrenaline and on the noradrenergic responses to d-amphetamine, and the monoamine reuptake inhibitor, BTS 54 354. pCPA pretreatment alone did not affect spontaneous noradrenaline efflux in either brain region, whether or not alpha2-autoreceptors were inactivated by administration of the alpha2-antagonist, atipamezole (1 mg/kg i.p). However, in the frontal cortex, pCPA pretreatment augmented the amplitude of, and prolonged, the noradrenergic response to local infusion of d-amphetamine (10 microM). In contrast, pCPA abolished the increase in cortical noradrenaline efflux induced by local infusion of BTS 54 354 (50 microM). In the hypothalamus, pCPA did not affect the amplitude of the response to either of these agents but did prolong the effects of d-amphetamine on noradrenaline efflux. These findings suggest that serotonergic transmission has complex effects on the noradrenergic response to drugs that increase noradrenergic transmission in the frontal cortex, but has less influence in the hypothalamus.
Lepschy, M; Filip, T; Palme, R G
2014-10-01
Besides enzymatic inactivation, catecholamines bind non-enzymatically and irreversible to proteins. The physiological impact of these catecholamine adducts is still unclear. We therefore collected basic data about the distribution of catecholamine adducts in the rat after repeated intravenous administration of (3)H-adrenaline and (3)H-noradrenaline. In all animals radioactivity in blood increased until the last injection on Day 7 and decreased then slowly close to background values (plasma) or remained higher (erythrocytes). In all sampled tissues radioactivity could be found, but only in hair high amounts remained present even after 3 weeks. Half-life of rat serum albumin loaded with (3)H-adrenaline or (3)H-noradrenaline was not altered. This study provides basic knowledge about the distribution of catecholamines or their adducts, but physiological effects could not be demonstrated. However, for the first time deposition and accumulation of catecholamines (adducts) in the hair could be proven, suggesting that hair might be used for evaluating long term stress. Copyright © 2014 Elsevier Ltd. All rights reserved.
Strategies for optical transport network recovery under epidemic network failures
DEFF Research Database (Denmark)
Ruepp, Sarah Renée; Fagertun, Anna Manolova; Kosteas, Vasileios
2015-01-01
The current trend in deploying automatic control plane solutions for increased flexibility in the optical transport layer leads to numerous advantages for both the operators and the customers, but also pose challenges related to the stability of the network and its ability to operate in a robust...... manner under different failure scenarios. This work evaluates two rerouting strategies and proposes four policies for failure handling in a connection-oriented optical transport network, under generalized multiprotocol label switching control plane. The performance of the strategies and the policies......, and that there exist a clear trade-off between policy performance and network resource consumption, which must be addressed by network operators for improved robustness of their transport infrastructures. Applying proactive methods for avoiding areas where epidemic failures spread results in 50% less connections...
Role of glycogenolysis in memory and learning: regulation by noradrenaline, serotonin and ATP
Directory of Open Access Journals (Sweden)
Marie Elizabeth Gibbs
2016-01-01
Full Text Available This paper reviews the role played by glycogen breakdown (glycogenolysis and glycogen re-synthesis in memory processing in two different chick brain regions, (1 the hippocampus and (2 the avian equivalent of the mammalian cortex, the intermediate medial mesopallium (IMM. Memory processing is regulated by the neuromodulators noradrenaline and serotonin soon after training and glycogen breakdown and re-synthesis are involved. In day-old domestic chicks, memory formation is dependent on the breakdown of glycogen (glycogenolysis at three specific times during the first 60 min after learning (around 2.5, 30 and 55 min. The chicks learn to discriminate in a single trial between beads of two colours and tastes. Inhibition of glycogen breakdown by the inhibitor of glycogen phosphorylase 1,4-dideoxy-1,4-imino-D-arabinitol (DAB given at specific times prior to the formation of long-term memory prevents memory forming. Noradrenergic stimulation of cultured chicken astrocytes by a selective β2-adrenergic (AR agonist reduces glycogen levels and we believe that in vivo this triggers memory consolidation at the second stage of glycogenolysis. Serotonin acting at 5-HT2B receptors acts on the first stage, but not on the second. We have shown that noradrenaline, acting via post-synaptic α2-ARs, is also responsible for the synthesis of glycogen and our experiments suggest that there is a readily accessible labile pool of glycogen in astrocytes which is depleted within 10 min if glycogen synthesis is inhibited. Endogenous ATP promotion of memory consolidation at 2.5 and 30 min is also dependent on glycogen breakdown. ATP acts at P2Y1 receptors and the action of thrombin suggests that it causes the release of internal calcium ([Ca2+]i] in astrocytes. Glutamate and GABA, the primary neurotransmitters in the brain, cannot be synthesized in neurons de novo. Neurons rely on astrocytic glutamate synthesis, requiring glycogenolysis.
Study on multimodal transport route under low carbon background
Liu, Lele; Liu, Jie
2018-06-01
Low-carbon environmental protection is the focus of attention around the world, scientists are constantly researching on production of carbon emissions and living carbon emissions. However, there is little literature about multimodal transportation based on carbon emission at home and abroad. Firstly, this paper introduces the theory of multimodal transportation, the multimodal transport models that didn't consider carbon emissions and consider carbon emissions are analyzed. On this basis, a multi-objective programming 0-1 programming model with minimum total transportation cost and minimum total carbon emission is proposed. The idea of weight is applied to Ideal point method for solving problem, multi-objective programming is transformed into a single objective function. The optimal solution of carbon emission to transportation cost under different weights is determined by a single objective function with variable weights. Based on the model and algorithm, an example is given and the results are analyzed.
Transport properties in GaTe under hydrostatic pressure
International Nuclear Information System (INIS)
Gouskov, L.; Carvalho, M.
1980-01-01
First results of the resistivity rho(perpendicular) and rho(parallel)(perpendicular and parallel to the normal to the cleavage plane) under hydrostatic pressure (1 bar <= P <= 3 kbar) on GaTe grown by the Bridgman method, are given and discussed. The analysis of electrical transport properties of GaTe under pressure, indicates a complex nature of the acceptor level in this material. The activation energy Esub(a) has a negative pressure coefficient which is sample dependent. The comparison of the variations of rho(parallel) and rho(perpendicular) versus pressure shows that the activation energy E of the rho(parallel)/rho(perpendicular) ratio has also a negative pressure coefficient which can be justified in the frame of a one-dimensional disorder model proposed by Maschke and Schmid, in order to explain the transport properties in the direction of the normal to the cleavage plane. (author)
Characterizing fate and transport properties in karst aquifers under different hydrologic conditions
Rodriguez, E.; Padilla, I. Y.
2017-12-01
Karst landscapes contain very productive aquifers. The hydraulic and hydrogeological characteristics of karst aquifers make these systems capable of storing and transporting large amount of water, but also highly vulnerable to contamination. Their extremely heterogeneous nature prevents accurate prediction in contaminant fate and transport. Even more challenging is to understand the impact of hydrologic conditions changes on fate and transport processes. This studies aims at characterizing fate and transport processes in the karst groundwater system of northern Puerto Rico under different hydrologic conditions. The study involves injecting rhodamine and uranine dyes into a sinkhole, and monitoring concentrations at a spring. Results show incomplete recovery of tracers, but breaking curves can be used to estimate advective, dispersive and mass transfer characteristic of the karst system. Preliminary results suggest significant differences in fate and transport characteristics under different hydrologic conditions.
Suprachiasmatic modulation of noradrenaline release in the ventrolateral preoptic nucleus.
Saint-Mleux, Benoît; Bayer, Laurence; Eggermann, Emmanuel; Jones, Barbara E; Mühlethaler, Michel; Serafin, Mauro
2007-06-13
As the major brain circadian pacemaker, the suprachiasmatic nucleus (SCN) is known to influence the timing of sleep and waking. We thus investigated here the effect of SCN stimulation on neurons of the ventrolateral preoptic nucleus (VLPO) thought to be involved in promoting sleep. Using an acute in vitro preparation of the rat anterior hypothalamus/preoptic area, we found that whereas single-pulse stimulations of the SCN evoked standard fast ionotropic IPSPs and EPSPs, train stimulations unexpectedly evoked a long-lasting inhibition (LLI). Such LLIs could also be evoked in VLPO neurons by pressure application of NMDA within the SCN, indicating the specific activation of SCN neurons. This LLI was shown to result from the presynaptic facilitation of noradrenaline release, because it was suppressed in presence of yohimbine, a selective antagonist of alpha2-adrenoreceptors. The LLI depended on the opening of a potassium conductance, because it was annulled at E(K) and could be reversed below E(K). These results show that the SCN can provide an LLI of the sleep-promoting VLPO neurons that could play a role in the circadian organization of the sleep-waking cycle.
Directory of Open Access Journals (Sweden)
Yukari Tanaka
Full Text Available Irritable bowel syndrome (IBS often comorbids mood and anxiety disorders. Corticotropin-releasing hormone (CRH is a major mediator of the stress response in the brain-gut axis, but it is not clear how CRH agonists change human brain responses to interoceptive stimuli. We tested the hypothesis that brain activation in response to colorectal distention is enhanced after CRH injection in IBS patients compared to healthy controls. Brain H215O- positron emission tomography (PET was performed in 16 male IBS patients and 16 age-matched male controls during baseline, no distention, mild and intense distention of the colorectum using barostat bag inflation. Either CRH (2 μg/kg or saline (1:1 was then injected intravenously and the same distention protocol was repeated. Plasma adrenocorticotropic hormone (ACTH, serum cortisol and plasma noradrenaline levels were measured at each stimulation. At baseline, CRH without colorectal distention induced more activation in the right amygdala in IBS patients than in controls. During intense distention after CRH injection, controls showed significantly greater activation than IBS patients in the right amygdala. Plasma ACTH and serum cortisol secretion showed a significant interaction between drug (CRH, saline and distention. Plasma noradrenaline at baseline significantly increased after CRH injection compared to before injection in IBS. Further, plasma noradrenaline showed a significant group (IBS, controls by drug by distention interaction. Exogenous CRH differentially sensitizes brain regions of the emotional-arousal circuitry within the visceral pain matrix to colorectal distention and synergetic activation of noradrenergic function in IBS patients and healthy individuals.
A Literature Review On Multimodal Freight Transportation Planning Under Disruptions
Rosyida, E. E.; Santosa, B.; Pujawan, I. N.
2018-04-01
This paper reviews publication that focuses on multimodal freight transportation planning under disruptions. In this paper, disruptions are specified by the level of the disruptions occurs and the scope of its effect. This becomes an important distinction since the cause and effect that may occur at different levels. The failure to make this distinction has implications for how we understand and manage. The reviewed papers include those that develop framework, model, and technical procedure for freight transportation. Finally, we provide an outlook of future research directions on the domain of transportation planning.
International Nuclear Information System (INIS)
Bregman, B.; Le Saux, F.; Maurin, Y.; Trottier, S.; Chauvel, P.
1985-01-01
Several studies indicate that brain noradrenaline (NA) depletion facilitates the occurrence of epileptogenic syndromes in various animal models. In cobalt-induced epilepsy in the rat, seizure activity is associated with a cortical NA denervation. In order to search for cortical adrenoceptor modifications, inonophoretic studies and adrenoceptor binding assays were performed. At the period of maximal seizure activity, there was a significant supersensitivity of cortial neurons to the ionophoretic application of NA. An increase in the density of β-adrenoceptor binding sites was observed. No modification in α 1 - and α 2 -adrenoceptor binding sites was found. This suggests that in cobalt-induced epilepsy there is a denervation supersensitivity which rests on a selective involvement of β-adrenoceptors. (Author)
Lorenzo, Daniel; Velluti, Julio C
2004-01-01
The noradrenergic modulation of neuronal properties has been described at different levels of the mammalian brain. Although the anatomical characteristics of the noradrenergic system are well known in reptiles, functional data are scarce. In our study the noradrenergic modulation of cortical electrogenesis in the turtle medial cortex was studied in vitro using a combination of field and intracellular recordings. Turtle EEG consists of a low voltage background interspersed by spontaneous large sharp waves (LSWs). Noradrenaline (NA, 5-40 microM) induced (or enhanced) the generation of LSWs in a dose-dependent manner. Pharmacological experiments suggest the participation of alpha and beta receptors in this effect. In medial cortex neurons NA induced a hyperpolarization of the resting potential and a decrease of input resistance. Both effects were observed also after TTX treatment. Noradrenaline increased the response of the cells to depolarizing pulses, resulting in an upward shift of the frequency/current relation. In most cells the excitability change was mediated by a decrease of the spike voltage threshold resulting in the reduction of the amount of depolarization needed to fire the cell (voltage threshold minus resting potential). As opposed to the mechanisms reported in mammalian neurons, no changes in the frequency adaptation or the post-train afterhyperpolarization were observed. The NA effects at the cellular level were not reproduced by noradrenergic agonists. Age- and species-dependent properties in the pharmacology of adrenergic receptors could be involved in this result. Cellular effects of NA in turtle cortex are similar to those described in mammals, although the increase in cellular excitability seems to be mediated by a different mechanism. Copyright 2004 S. Karger AG, Basel
Owen, P. J.; Marriott, D. B.; Boarder, M. R.
1989-01-01
1. It has been suggested that neuronal voltage-sensitive calcium channels (VSCC) may be divided into dihydropyridine (DHP)-sensitive (L) and DHP-insensitive (N and T), and that both the L and the N type channels are attenuated by the peptide blocker omega-conotoxin. Here the effects of omega-conotoxin on release of noradrenaline and uptake of calcium in bovine adrenal chromaffin cells were investigated. 2. Release of noradrenaline in response to 25 mM K+, 65 mM K+, 10 nM bradykinin or 10 microM prostaglandin E1 was not affected by omega-conotoxin in the range 10 nM-1 microM. 3. 45Ca2+ uptake stimulated by high K+ and prostaglandin was attenuated by 1 microM nitrendipine and enhanced by 1 microM Bay K 8644; these calcium fluxes were not modified by 20 nM omega-conotoxin. 4. With superfused rat brain striatal slices in the same medium as the above cell studies, release of dopamine in response to 25 mM K+ was attenuated by 20 nM omega-conotoxin. 5. These results show that in these neurone-like cells, release may be effected by calcium influx through DHP-sensitive but omega-conotoxin-insensitive VSCC, a result inconsistent with the suggestion that omega-conotoxin blocks both L-type and N-type neuronal calcium channels. PMID:2470457
Tutton, P J; Barkla, D H
1989-01-01
The intestinal mucosa receives an adrenergic innervation for which there is no commonly accepted function. However, in recent years, cell kinetic studies have raised the possibility that this innervation may be an important regulator of crypt cell proliferation. The effects of noradrenaline released from adrenergic nerves is terminated principally by re-uptake of the amine into the nerve and this process can be inhibited by the antidepressant drug, desipramine. In this report desipramine is shown to accelerate crypt cell proliferation in intact, but not in chemically sympathectomized rats, thus adding support to the notion that regulation of crypt cell division is an important function of the sympathetic nervous system.
2011-11-28
... for Transportation Expense Reimbursement): Activity Under OMB Review AGENCY: Veterans Benefits... for Transportation Expense Reimbursement (38 CFR 21.8370). OMB Control Number: 2900-0580. Type of... transportation expenses. To be eligible, the child must provide supportive documentation of actual expenses...
International Nuclear Information System (INIS)
Neidhart, B.; Kringe, K.-P.; Deutschmann, P.
1983-01-01
A critical investigation of the separation of free noradrenaline and adrenaline from urine samples revealed serious errors during sample pretreatment using Al 2 O 3 as adsorbent. An exact and rapid pH adjustment of the sample, using thymol-blue as indicator, proved to be the chief prerequisite for precise and accurate results. Increasing temperature and pH favour the oxidative decomposition of the catecholamines during routine analysis. This was examined, using the radiotracer method and liquid scintillation counting. (author)
DEFF Research Database (Denmark)
Blædel, Martin; Sams, Anette; Boonen, Harrie C M
2016-01-01
UNLABELLED: This study investigated the effect of the metabolic syndrome associated risk factors hyperglycemia (glucose [Glc]), hyperinsulinemia (insulin [Ins]) and low-grade inflammation (tumor necrosis factor α [TNFα]) on the vasomotor responses of resistance arteries. Isolated small mesenteric...... arteries from 3-month-old Sprague-Dawley rats, were suspended for 21-23 h in tissue cultures containing either elevated Glc (30 mmol/l), Ins (100 nmol/l), TNFα (100 ng/ml) or combinations thereof. After incubation, the vascular response to noradrenaline (NA), phenylephrine, isoprenaline and NA...... in vascular tone....
DEFF Research Database (Denmark)
Lindgren, Eva M; Nielsen, Ronni; Petrovic, Natasa
2004-01-01
phases, with the highest mRNA levels being found at the time of transition between the phases. PPARgamma2 mRNA levels were downregulated by noradrenaline treatment (EC50, 0.1 microM) in both proliferative and differentiating cells, with a lagtime of 1 h and lasting up to 4 h, after which expression...... was thus to investigate the influence of noradrenaline on PPARgamma gene expression in brown adipocytes. In primary cultures of brown adipocytes, PPARgamma2 mRNA levels were 20-fold higher than PPARgamma1 mRNA levels. PPARgamma expression occurred during both the proliferation and the differentiation...... gradually recovered. The down-regulation was beta-adrenoceptor-induced and intracellularly mediated via cAMP and protein kinase A; the signalling pathway did not involve phosphoinositide 3-kinase, Src, p38 mitogen-activated protein kinase or extracellular-signal-regulated kinases 1 and 2. Treatment...
DEFF Research Database (Denmark)
Fagertun, Anna Manolova; Ruepp, Sarah Renée
2014-01-01
The current trend in deploying automatic control plane solutions for increased flexibility in the optical transport layer leads to numerous advantages for both the operators and the customers, but also pose challenges related to the stability of the network and its ability to operate in a robust...... manner under attacks. This work proposes four policies for failure handling in a connection-oriented optical transport network, under Generalized MultiProtocol Label Switching control plane, and evaluates their performance under multiple correlated large-scale failures. We employ the Susceptible...... of their transport infrastructures. Applying proactive methods for avoiding areas where epidemic failures spread results in 50% less connections requiring recovery, which translates in improved quality of service to customers....
Feenstra, M. G.; Botterblom, M. H.; Mastenbroek, S.
2000-01-01
We used on-line microdialysis measurements of dopamine and noradrenaline extracellular concentrations in the medial prefrontal cortex of awake, freely moving rats during the dark and the light period of the day to study whether (i) basal efflux would be higher in the active, dark period than in the
Sand Transport under Highly Turbulent Airflow on a Beach Surface
Baas, A. C. W.; Jackson, D. W. T.; Cooper, J. A. G.; Lynch, K.; Delgado-Fernandez, I.; Beyers, J. H. M.
2012-04-01
The past decade has seen a growing body of research on the relation between turbulence in the wind and the resultant transport of sediment over active sand surfaces. Widespread use of sonic anemometry and high-frequency sand transport sensors and traps have facilitated recent field studies over dunes and beach surfaces, to move beyond monitoring of mean wind speed and bulk transport to more detailed measurements at much higher spatio-temporal resolutions. In this paper we present results of a field study conducted in the recirculation flow and re-attachment zone on a beach behind a foredune at Magilligan Strand, Northern Ireland. The offshore winds over the foredune at this site are associated with flow separation and reversal located over the beach surface in the lee of the dune row, often strong enough to induce sand transport toward the toe of the foredune ('against' the overall offshore flow). The re-attachment and recirculation zone are associated with strongly turbulent fluid flow and complex streamlines that do not follow the underlying topography. High frequency (25 Hz) wind and sand transport data were collected at a grid of point locations distributed over the beach surface between 35 m to 55 m distance from the 10 m high dune crest, using ultrasonic anemometers at 0.5 m height and co-located load cell traps and Safires at the bed surface. The wind data are used to investigate the role of Reynolds shear stresses and quadrant analysis techniques for identifying burst-sweep events in relation to sand transport events. This includes an assessment of the issues involved with data rotations for yaw, pitch, and roll corrections relative to complex flow streamlines, and the subsequently derived turbulence parameters based on fluctuating vector components (u', v', w'). Results illustrate how transport may exist under threshold mean velocities because of the role played by coherent flow structures, and the findings corroborate previous findings that shear velocity
de Boer, S.F.; Koopmans, S.J.; Slangen, J L; Van der Gugten, J
Plasma noradrenaline (NA), adrenaline (A), corticosterone (CS) and glucose concentrations were determined in blood sampled via a cardiac catheter from freely moving male rats under ad lib fed and 24 hr food deprived conditions using a repeated measures within-subject design. Resting plasma NA and
2012-03-14
... DEPARTMENT OF HOMELAND SECURITY Transportation Security Administration Extension of Agency Information Collection Activity Under OMB Review: Transportation Security Officer (TSO) Medical Questionnaire AGENCY: Transportation Security Administration, DHS. ACTION: 30-day Notice. SUMMARY: This notice...
2010-01-15
... DEPARTMENT OF HOMELAND SECURITY Transportation Security Administration Extension of Agency Information Collection Activity Under OMB Review: Transportation Security Officer (TSO) Medical Questionnaire AGENCY: Transportation Security Administration, DHS. ACTION: 30-day notice. SUMMARY: This notice...
Energy Technology Data Exchange (ETDEWEB)
Cozar, A.; Rodriguez, A.I.; Garijo, P.; Calvo, L.; Vergara, H.
2016-11-01
A total of 72 male lambs of Merina breed were sampled in a 3×2 factorial design, testing three different space allowances treatment (SA) during transport [0.16 m2/animal (SAL; n=24); 0.20 m2/animal (SAM; n=24) and 0.30 m2/animal (SAH; n=24)] and two lairage treatments (TL) during 18 h previous slaughter [fasting (FAST; n=36) vs feeding (FEED; n=36)] on welfare physiological indicators. After transport, glucose and lactate dehydrogenase (LDH) were highest in SAM group and lowest in SAH one (p<0.05). SAL showed intermediate values for both parameters. SA did not affect the rest of the blood parameters studied. TL-FAST treatment decreased glucose values (p<0.001) while increased LDH (p<0.001). Fasting caused an increase (p<0.05) of Red Blood Cell Count values in SAM group. Feed deprivation did not affect cortisol or adrenaline values. Noradrenaline value was higher (p<0.001) in TL-FAST groups than in TL-FEED. In conclusion, under the conditions of this study, a range of space allowance during transport between 0.16 and 0.30 m2/lamb could be recommended without showing major changes on welfare physiological indicators; and feeding could be more appropriate than fasting during lairage. (Author)
Furlong, T M; Pan, M J; Corbit, L H
2015-01-01
Alcohol-related stimuli can trigger relapse of alcohol-seeking behaviors even after extended periods of abstinence. Extinction of such stimuli can reduce their impact on relapse; however, the expression of extinction can be disrupted when testing occurs outside the context where extinction learning took place, an effect termed renewal. Behavioral and pharmacological methods have recently been shown to augment extinction learning; yet, it is not known whether the improved expression of extinction following these treatments remains context-dependent. Here we examined whether two methods, compound–stimulus extinction and treatment with the noradrenaline reuptake inhibitor atomoxetine, would reduce the vulnerability of extinction to a change in context. Following alcohol self-administration, responding was extinguished in a distinct context. After initial extinction, further extinction was given to a target stimulus presented in compound with another alcohol-predictive stimulus intended to augment prediction error (Experiment 1) or after a systemic injection of atomoxetine (1.0 mg kg−1; Experiment 2). A stimulus extinguished as part of a compound elicited less responding than a stimulus receiving equal extinction alone regardless of whether animals were tested in the training or extinction context; however, reliable renewal was not observed in this paradigm. Importantly, atomoxetine enhanced extinction relative to controls even in the presence of a reliable renewal effect. Thus, extinction of alcohol-seeking behavior can be improved by extinguishing multiple alcohol-predictive stimuli or enhancing noradrenaline neurotransmission during extinction training. Importantly, both methods improve extinction even when the context is changed between extinction training and test, and thus could be utilized to enhance the outcome of extinction-based treatments for alcohol-use disorders. PMID:26327688
2012-11-30
... DEPARTMENT OF HOMELAND SECURITY Transportation Security Administration New Agency Information Collection Activity Under OMB Review: Public Transportation Baseline Assessment for Security Enhancement... voluntary site visits with security and operating officials of public transportation systems. This program...
International Nuclear Information System (INIS)
Szenknect, St.
2003-10-01
This work is devoted to the quantification and the identification of the predominant processes involved in strontium and caesium transport in unsaturated soil from Chernobyl Pilot Site under steady flow conditions. The transport and fate of radionuclides in the subsurface is affected by various physical and chemical processes including advective and diffusive transport as well as chemical and biological transformations. Laboratory experiments and the use of a multiple tracer approach allow to isolate the contributions of each elementary process and to control the physico-chemical conditions in the system. To be more representative of the field conditions, we decided to perform column miscible displacement experiments. We perform batch and flow-through reactor experiments to characterize the radionuclides sorption mechanisms. Miscible displacement experiments within homogeneous columns and modeling allow to characterize the hydrodynamic properties of the soil and to describe the radionuclides behaviour under dynamic conditions at different water contents. We show that the water content of porous media affect the transport behaviour of inert and strongly sorbing radionuclides. Our results demonstrate that a parametrized transport model that was calibrated under completely saturated conditions was not able to describe the advective-dispersive transport of reactive solutes under unsaturated steady state conditions. Under our experimental conditions, there is no effect of a decrease of the mean water content on the sorption model parameters, but the transport parameters are modified. We established for the studied soil the relation between hydrodynamic dispersion and water content and the relation between pore water velocity and water content. (author)
Menahem, Adi; Dror, Ishai; Berkowitz, Brian
2016-02-01
The release of pharmaceuticals and personal care products (PPCPs) to the soil-water environment necessitates understanding of PPCP transport behavior under conditions that account for dynamic flow and varying redox states. This study investigates the transport of two organometallic PPCPs, Gd-DTPA and roxarsone (arsenic compound) and their metal salts (Gd(NO3)3, AsNaO2); Gd-DTPA is used widely as a contrasting agent for MRI, while roxarsone is applied extensively as a food additive in the broiler poultry industry. Here, we present column experiments using sand and Mediterranean red sandy clay soil, performed under several redox conditions. The metal salts were almost completely immobile. In contrast, transport of Gd-DTPA and roxarsone was affected by the soil type. Roxarsone was also affected by the different redox conditions, showing delayed breakthrough curves as the redox potential became more negative due to biological activity (chemically-strong reducing conditions did not affect the transport). Mechanisms that include adsorptive retardation for aerobic and nitrate-reducing conditions, and non-adsorptive retardation for iron-reducing, sulfate-reducing and biologically-strong reducing conditions, are suggested to explain the roxarsone behavior. Gd-DTPA is found to be a stable complex, with potential for high mobility in groundwater systems, whereas roxarsone transport through groundwater systems is affected by redox environments, demonstrating high mobility under aerobic and nitrate-reducing conditions and delayed transport under iron-reducing, sulfate-reducing and biologically-strong reducing conditions. Copyright © 2015 Elsevier Ltd. All rights reserved.
Lynch, K.; Jackson, D.; Delgado-Fernandez, I.; Cooper, J. A.; Baas, A. C.; Beyers, M.
2010-12-01
This study examines sand transport and wind speed across a beach at Magilligan Strand, Northern Ireland, under offshore wind conditions. Traditionally the offshore component of local wind regimes has been ignored when quantifying beach-dune sediment budgets, with the sheltering effect of the foredune assumed to prohibit grain entrainment on the adjoining beach. Recent investigations of secondary airflow patterns over coastal dunes have suggested this may not be the case, that the turbulent nature of the airflow in these zones enhances sediment transport potential. Beach sediment may be delivered to the dune toe by re-circulating eddies under offshore winds in coastal areas, which may explain much of the dynamics of aeolian dunes on coasts where the dominant wind direction is offshore. The present study investigated aeolian sediment transport patterns under an offshore wind event. Empirical data were collected using load cell traps, for aeolian sediment transport, co-located with 3-D ultrasonic anemometers. The instrument positioning on the sub-aerial beach was informed by prior analysis of the airflow patterns using computational fluid dynamics. The array covered a total beach area of 90 m alongshore by 65 m cross-shore from the dune crest. Results confirm that sediment transport occurred in the ‘sheltered’ area under offshore winds. Over short time and space scales the nature of the transport is highly complex; however, preferential zones for sand entrainment may be identified. Alongshore spatial heterogeneity of sediment transport seems to show a relationship to undulations in the dune crest, while temporal and spatial variations may also be related to the position of the airflow reattachment zone. These results highlight the important feedbacks between flow characteristics and transport in a complex three dimensional surface.
Sabbar, M; Delaville, C; De Deurwaerdère, P; Benazzouz, A; Lakhdar-Ghazal, N
2012-05-17
Lead intoxication has been suggested as a high risk factor for the development of Parkinson disease. However, its impact on motor and nonmotor functions and the mechanism by which it can be involved in the disease are still unclear. In the present study, we studied the effects of lead intoxication on the following: (1) locomotor activity using an open field actimeter and motor coordination using the rotarod test, (2) anxiety behavior using the elevated plus maze, (3) "depression-like" behavior using sucrose preference test, and (4) subthalamic nucleus (STN) neuronal activity using extracellular single unit recordings. Male Sprague-Dawley rats were treated once a day with lead acetate or sodium acetate (20 mg/kg/d i.p.) during 3 weeks. The tissue content of monoamines was used to determine alteration of these systems at the end of experiments. Results show that lead significantly reduced exploratory activity, locomotor activity and the time spent on the rotarod bar. Furthermore, lead induced anxiety but not "depressive-like" behavior. The electrophysiological results show that lead altered the discharge pattern of STN neurons with an increase in the number of bursting and irregular cells without affecting the firing rate. Moreover, lead intoxication resulted in a decrease of tissue noradrenaline content without any change in the levels of dopamine and serotonin. Together, these results show for the first time that lead intoxication resulted in motor and nonmotor behavioral changes paralleled by noradrenaline depletion and changes in the firing activity of STN neurons, providing evidence consistent with the induction of atypical parkinsonian-like deficits. Copyright © 2012 IBRO. Published by Elsevier Ltd. All rights reserved.
Pontigo, Sofía; Ribera, Alejandra; Gianfreda, Liliana; de la Luz Mora, María; Nikolic, Miroslav; Cartes, Paula
2015-07-01
So far, considerable advances have been achieved in understanding the mechanisms of Si uptake and transport in vascular plants. This review presents a comprehensive update about this issue, but also provides the new insights into the role of Si against mineral stresses that occur in acid soils. Such information could be helpful to understand both the differential Si uptake ability as well as the benefits of this mineral element on plants grown under acidic conditions. Silicon (Si) has been widely recognized as a beneficial element for many plant species, especially under stress conditions. In the last few years, great efforts have been made to elucidate the mechanisms involved in uptake and transport of Si by vascular plants and recently, different Si transporters have been identified. Several researches indicate that Si can alleviate various mineral stresses in plants growing under acidic conditions, including aluminium (Al) and manganese (Mn) toxicities as well as phosphorus (P) deficiency all of which are highly detrimental to crop production. This review presents recent findings concerning the influence of uptake and transport of Si on mineral stress under acidic conditions because a knowledge of this interaction provides the basis for understanding the role of Si in mitigating mineral stress in acid soils. Currently, only four Si transporters have been identified and there is little information concerning the response of Si transporters under stress conditions. More investigations are therefore needed to establish whether there is a relationship between Si transporters and the benefits of Si to plants subjected to mineral stress. Evidence presented suggests that Si supply and its subsequent accumulation in plant tissues could be exploited as a strategy to improve crop productivity on acid soils.
International Nuclear Information System (INIS)
Hoffmann, J.J.M.L.; Willemsen, J.J.; Thien, Th.; Benraad, Th.J.
1982-01-01
During the evaluation of a modified radioenzymatic determination of plasma adrenaline and noradrenaline, it has been found that there exists a highly significant (p 0 C, but only in plasma from patients with essential hypertension. Plasma from normotensive persons exhibits a complete lack of correlation between these factors. The consequences of the hypertension-associated COMT-inhibiting factor for the assays' specifications are discussed and data are presented for comparison with a recently-described uremia-associated COMT-inhibitor (Demassieux et al, Clin Chim Acta 115, 377-391; 1981). (Auth.)
Silicon transport in sputter-deposited tantalum layers grown under ion bombardment
International Nuclear Information System (INIS)
Gallais, P.; Hantzpergue, J.J.; Remy, J.C.; Roptin, D.
1988-01-01
Tantalum was sputter deposited on (111) Si substrate under low-energy ion bombardment in order to study the effects of the ion energy on the silicon transport into the Ta layer. The Si substrate was heated up to 500 0 C during growth. For ion energies up to 180 eV silicon is not transported into tantalum and the growth temperature has no effect. An ion bombardment energy of 280 eV enhances the transport of silicon throughout the tantalum layer. Growth temperatures up to 300 0 C have no effect on the silicon transport which is mainly enhanced by the ion bombardment. For growth temperatures between 300 and 500 0 C, the silicon transport is also enhanced by the thermal diffusion. The experimental depth distribution of silicon is similar to the theoretical depth distribution calculated for the case of an interdiffusion. The ion-enhanced process of silicon transport is characterized by an activation energy of 0.4 eV. Silicon into the layers as-grown at 500 0 C is in both states, amorphous silicide and microcrystalline cubic silicon
2012-04-02
... DEPARTMENT OF HOMELAND SECURITY Transportation Security Administration [Docket No. TSA-2006-26514] Extension of Agency Information Collection Activity Under OMB Review: Rail Transportation Security AGENCY: Transportation Security Administration, DHS. ACTION: 30-day Notice. SUMMARY: This notice announces that the...
Yamashita, A; Koike, Y; Takahashi, A; Hirayama, M; Murakami, N; Sobue, G
1997-08-01
We evaluated plasma noradrenaline (NA) levels at test and during head-up tilt test in 20 patients with sporadic amyotrophic lateral sclerosis (ALS). Their fasting plasma NA levels ranged from 195 to 4227 pg/ml. The average plasma NA level was 483 pg/ml in five ambulatory patients, 341 in two wheelchair-bound patients, 1264 in 11 bedridden patients, and 208 in two respirator-dependent patients whose disability grading was the worst among the four groups. Arterial carbon dioxide (PCO2) was evaluated as a measure of respiratory function. The coefficient of correlation between PCO2 and plasma NA was r = 0.654 (p respiratory failure or lower motor neuron dysfunction may relate to the elevation of plasma NA levels. In the two bedridden patients, plasma NA levels and heart rate at rest increased significantly as the disease progressed. Cardiovascular responses to head-up tilting were normal. These data suggest that the elevation of plasma NA levels may be related to progression of respiratory failure and lower motor neuron dysfunction. In conclusion, sympathetic hyperactivity in ALS is considered to be not primary, but secondary to somatic motor disabilities and respiratory failure.
Simplified calculation method for radiation dose under normal condition of transport
International Nuclear Information System (INIS)
Watabe, N.; Ozaki, S.; Sato, K.; Sugahara, A.
1993-01-01
In order to estimate radiation dose during transportation of radioactive materials, the following computer codes are available: RADTRAN, INTERTRAN, J-TRAN. Because these codes consist of functions for estimating doses not only under normal conditions but also in the case of accidents, when nuclei may leak and spread into the environment by air diffusion, the user needs to have special knowledge and experience. In this presentation, we describe how, with a view to preparing a method by which a person in charge of transportation can calculate doses in normal conditions, the main parameters upon which the value of doses depends were extracted and the dose for a unit of transportation was estimated. (J.P.N.)
Ohizumi, Y.; Takahashi, M.; Tobe, A.
1982-01-01
In the isolated vas deferens of the guinea-pig, the effects of 2-(4-methylaminobutoxy) diphenylmethane hydrochloride (MCI-2016), a new psychotropic drug, on the contractile response to various agonists or transmural electrical stimulation and on the release of noradrenaline (NA) from the tissue were examined and compared with cocaine. MCI-2016 (3 X 10(-6)M) and cocaine (3 X 10(-5)M) produced a leftward shift (15 and 20 times, respectively) of the dose-response curves for the contractile effec...
A Bingham-plastic model for fluid mud transport under waves and currents
Liu, Chun-rong; Wu, Bo; Huhe, Ao-de
2014-04-01
Simplified equations of fluid mud motion, which is described as Bingham-Plastic model under waves and currents, are presented by order analysis. The simplified equations are non-linear ordinary differential equations which are solved by hybrid numerical-analytical technique. As the computational cost is very low, the effects of wave current parameters and fluid mud properties on the transportation velocity of the fluid mud are studied systematically. It is found that the fluid mud can move toward one direction even if the shear stress acting on the fluid mud bed is much smaller than the fluid mud yield stress under the condition of wave and current coexistence. Experiments of the fluid mud motion under current with fluctuation water surface are carried out. The fluid mud transportation velocity predicted by the presented mathematical model can roughly match that measured in experiments.
Energy Technology Data Exchange (ETDEWEB)
Kandlikar, Satish G. [Rochester Inst. of Technology, Rochester, NY (United States); Lu, Zijie [Rochester Inst. of Technology, Rochester, NY (United States); Rao, Navalgund [Rochester Inst. of Technology, Rochester, NY (United States); Sergi, Jacqueline [Rochester Inst. of Technology, Rochester, NY (United States); Rath, Cody [Rochester Inst. of Technology, Rochester, NY (United States); McDade, Christopher [Rochester Inst. of Technology, Rochester, NY (United States); Trabold, Thomas [General Motors, Honeoye Falls, NY (United States); Owejan, Jon [General Motors, Honeoye Falls, NY (United States); Gagliardo, Jeffrey [General Motors, Honeoye Falls, NY (United States); Allen, Jeffrey [Michigan Technological Univ., Houghton, MI (United States); Yassar, Reza S. [Michigan Technological Univ., Houghton, MI (United States); Medici, Ezequiel [Michigan Technological Univ., Houghton, MI (United States); Herescu, Alexandru [Michigan Technological Univ., Houghton, MI (United States)
2010-05-30
In this program, Rochester Institute of Technology (RIT), General Motors (GM) and Michigan Technological University (MTU) have focused on fundamental studies that address water transport, accumulation and mitigation processes in the gas diffusion layer and flow field channels of the bipolar plate. These studies have been conducted with a particular emphasis on understanding the key transport phenomena which control fuel cell operation under freezing conditions.
Energy Technology Data Exchange (ETDEWEB)
Kwong, S. [National Nuclear Laboratory (United Kingdom); Jivkov, A.P. [Research Centre for Radwaste and Decommissioning and Modelling and Simulation Centre, University of Manchester (United Kingdom)
2012-07-01
Deep geologic disposal of high activity and long-lived radioactive waste is gaining increasing support in many countries, where suitable low permeability geological formation in combination with engineered barriers are used to provide long term waste contaminant and minimise the impacts to the environment and risk to the biosphere. This modelling study examines the solute transport in fractured media under low flow velocities that are relevant to a deep geological environment. In particular, reactive solute transport through fractured media is studied using a 2-D model, that considers advection and diffusion, to explore the coupled effects of kinetic and equilibrium chemical processes. The effects of water velocity in the fracture, matrix porosity and diffusion on solute transport are investigated and discussed. Some illustrative modelled results are presented to demonstrate the use of the model to examine the effects of media degradation on solute transport, under the influences of hydrogeological (diffusion dominant) and microbially mediated chemical processes. The challenges facing the prediction of long term degradation such as cracks evolution, interaction and coalescence are highlighted. The potential of a novel microstructure informed modelling approach to account for these effects is discussed, particularly with respect to investigating multiple phenomena impact on material performance. The GRM code is used to examine the effects of media degradation for a geological waste disposal package, under the combined hydrogeological (diffusion dominant) and chemical effects in low groundwater flow conditions that are typical of deep geological disposal systems. An illustrative reactive transport modelling application demonstrates the use of the code to examine the interplay of kinetic controlled biogeochemical reactive processes with advective and diffusive transport, under the influence of media degradation. The initial model results are encouraging which show the
Brain neurotransmitters and hippocampal proteome in pigs under stress and environmental enrichment
Directory of Open Access Journals (Sweden)
Laura Arroyo
2017-06-01
Full Text Available Stress and wellbeing are psychological conditions that are mediated by the central nervous system. In the brain, stress is mediated mainly by the hypothalamus, which will activate the hypothalamic-pituitary-adrenal (HPA axis, leading to the secretion of cortisol, the paradigmatic stress hormone. Other brain areas as the amygdala, the hippocampus or the prefrontal cortex (PFC are involved in emotions such as happiness, anxiety and fear. Communication between brain areas is achieved by chemical neurotransmitters (NTs, which are secreted by presynaptic neurons to reach postsynaptic neurons, where they will cause a variation in membrane polarization and other cell signaling actions, leading to physiological responses. Amongst these NTs, catecholamines (noradrenaline and dopamine and serotonin play an important role. On the other hand, the adverse effects of stress may be counteracted by housing the individuals under environmental enrichment conditions. This long-term situation should have an effect, not only on NTs, but also on the brain proteome. Under the hypothesis that different stress situations will lead to changes in NT composition that will be specific for crucial brain areas, we have tested the effects of transport stress, handling stress at the slaughterhouse, and the stress-susceptible genotype (Ryr1 on the amine NT concentration in amygdala, hippocampus, PFC and hypothalamus of pigs. The effects of living under environmentally enriched or control conditions on the NT concentration in several brain regions and on the hippocampus proteome has been also analyzed. In conclusion, genetic factors as well as management conditions related to housing, transport and slaughterhouse alter in different degree the catecholaminergic and the serotoninergic neurotransmission in the brain, and give clues about how different individual types are able to react to external challenges. Likewise, environmental enrichment leads to changes in the proteome
Mixed Transportation Network Design under a Sustainable Development Perspective
Directory of Open Access Journals (Sweden)
Jin Qin
2013-01-01
Full Text Available A mixed transportation network design problem considering sustainable development was studied in this paper. Based on the discretization of continuous link-grade decision variables, a bilevel programming model was proposed to describe the problem, in which sustainability factors, including vehicle exhaust emissions, land-use scale, link load, and financial budget, are considered. The objective of the model is to minimize the total amount of resources exploited under the premise of meeting all the construction goals. A heuristic algorithm, which combined the simulated annealing and path-based gradient projection algorithm, was developed to solve the model. The numerical example shows that the transportation network optimized with the method above not only significantly alleviates the congestion on the link, but also reduces vehicle exhaust emissions within the network by up to 41.56%.
Mixed Transportation Network Design under a Sustainable Development Perspective
Qin, Jin; Ni, Ling-lin; Shi, Feng
2013-01-01
A mixed transportation network design problem considering sustainable development was studied in this paper. Based on the discretization of continuous link-grade decision variables, a bilevel programming model was proposed to describe the problem, in which sustainability factors, including vehicle exhaust emissions, land-use scale, link load, and financial budget, are considered. The objective of the model is to minimize the total amount of resources exploited under the premise of meeting all the construction goals. A heuristic algorithm, which combined the simulated annealing and path-based gradient projection algorithm, was developed to solve the model. The numerical example shows that the transportation network optimized with the method above not only significantly alleviates the congestion on the link, but also reduces vehicle exhaust emissions within the network by up to 41.56%. PMID:23476142
Sediment transport under breaking waves
DEFF Research Database (Denmark)
Christensen, Erik Damgaard; Hjelmager Jensen, Jacob; Mayer, Stefan
2000-01-01
The sediment transport in the surf zone is modelled by combining a Navier-Stokes solver, a free surface model, a turbulence model, and a sediment transport model. The flow solver is based on the finite volume technique for non-orthogonal grids. The model is capable of simulating the turbulence...... generated at the surface where the wave breaks as well as the turbulence generated near the bed due to the wave-motion and the undertow. In general, the levels of turbulent kinetic energy are found to be higher than experiments show. This results in an over prediction of the sediment transport. Nevertheless...
Directory of Open Access Journals (Sweden)
Milanović Tamara
2015-01-01
membrane of presynaptic ending is necessary to free the neurotransmitter out of the vesicle, the aim of our work is to study whether Verapamile has effects on the membrane of presynaptic endings of sympathetic nervous system checking the level of catecholamine in serum. The experiment was conducted in 6 healthy dogs which were, after 10-minute-infusion (0.9% NaCl, treated with intravenous bolus veramapile injections in three occasions, in every 5 minutes, until the first signs of intoxication had appeared. This caused bradycardia, heart rhythm disorder and blood pressure drop. In order to determine the level of catecholamine, blood was taken sequentially, in every 5 minutes, before the new dose of verapamile was given. Verapamile (given intravenous significantly decreases the concentration of adrenaline and noradrenaline in the serum of dogs.
Lived experience of involuntary transport under mental health legislation.
Bradbury, Joanne; Hutchinson, Marie; Hurley, John; Stasa, Helen
2017-12-01
Police have historically been responsible for transporting people during a mental health crisis in Australia. A major change to the New South Wales (NSW) Mental Health Act (MHA) in 2007 expanded the range of coercive transportation agencies to include NSW Ambulance (paramedics) and NSW Health (mental health nurses). Anecdotal reports, however, describe a lack of clarity around how these changes should be implemented in practice. This research aims to explore this lack of clarity through qualitative analysis of interviews with people with the lived experience of involuntary transport under the MHA. Sixteen interviews were conducted; most (n = 14) interviews in northern NSW regions: six with people who had been transported (consumers), four with carers, and six with service providers (two police, one paramedic, and three mental health nurses). For consumers and carers, the police response was often perceived as too intense, particularly if the person was not violent. Carers were often conflicted by having to call for emergency intervention. Service providers were frustrated by a lack of a coordinated interagency response, resourcing issues, delays at emergency departments, and lack of adequate training. A central theme across all groups was the importance of communication styles. As one participant (consumer) said: 'Everybody needs a lesson in kindness'. All groups agreed that high-risk situations necessitate police involvement. However, invocation of the MHA during a high-risk situation is fraught with stress and difficulties, leaving little room for empathetic communications. Effective and diverse, evidence-based, early intervention strategies - both consensual and non-consensual - are necessary to reduce the requirement for police involvement in mental health transports. © 2016 Australian College of Mental Health Nurses Inc.
International Nuclear Information System (INIS)
Lozhanets, V.V.; Anosov, A.K.
1986-01-01
The nonapeptide delta-sleep inducing peptide (DSIP) causes specific changes in the encephalogram of recipient animals: It prolongs the phase of long-wave or delta sleep. The cellular mechanism of action of DSIP has not yet been explained. To test the hyporhesis that this peptide or its degradation product may be presynaptic regulators of catecholamine release, the action of Leu-enkephaline, DSIP, and amino acids composing DSIP on release of endogenous noradrenalin (NA) from synaptosomes during depolarization was compared. Subcellular fractions from cerebral hemisphere of noninbred male albino rats were isolated. Lactate dehydrogenase activity was determined in the suspension of synaptosomes before and after addition of 0.5% Triton X-100. The results were subjected to statistical analysis, using the Wilcoxon-Mann-Whitney nonparametric test
Stress and Fatigue in Operators Under Radiofrequency Electromagnetic Radiation and Shift Work
Directory of Open Access Journals (Sweden)
Vangelova K.
2014-12-01
Full Text Available The aim was to study the effect of radiofrequency electromagnetic radiation (EMR on stress indices, health complaints and fatigue of operators working fast-rotating extended shifts. Working conditions, job content, job control, social support, health complaints and fatigue were followed in 220 operators, 110 exposed to EMR and 110 control operators, matched by age and sex. The EMR was measured and time-weighted average (TWA was calculated. The excretion rates of stress hormones cortisol, adrenaline and noradrenaline were followed during the extended shifts in 36 operators, working at different levels of exposure and 24-hour exposure was calculated. The exposed group pointed more problems with the working conditions, including EMR, noise, currents and risk of accidents, more health complaints and higher level of fatigue. The most common health complaints were mental and physical exhaustion after work, pains in the chest, musculoskeletal complaints, headache, and apathy. High level EMR exposure (TWAmean = 3.10 μW/cm2, TWAmax = 137.00 μW/cm2 significantly increased the 24-hour excretion of cortisol and noradrenaline, whereas the increase of adrenaline excretion did not reach significance, as well as hormone excretion rates under low level exposure (TWAmean = 1.89 μW/cm2, TWAmax = 5.24 μW/cm2. In conclusion, higher number of health complaints, higher stress hormone excretion rates and fatigue were found in operators under EMR.
DEFF Research Database (Denmark)
Løland, Claus Juul
2015-01-01
Background: The mammalian neurotransmitter transporters are complex proteins playing a central role in synaptic transmission between neurons by rapid reuptake of neurotransmitters. The proteins which transport dopamine, noradrenaline and serotonin belong to the Neurotransmitter:Sodium Symporters...... (NSS). Due to their important role, dysfunctions are associated with several psychiatric and neurological diseases and they also serve as targets for a wide range of therapeutic and illicit drugs. Despite the central physiological and pharmacological importance, direct evidence on structure......–function relationships on mammalian NSS proteins has so far been unsuccessful. The crystal structure of the bacterial NSS protein, LeuT, has been a turning point in structural investigations. Scope of review: To provide an update on what is known about the binding sites for substrates and inhibitors in the Leu...
International Nuclear Information System (INIS)
Neuhaus, C.P.E.
1982-01-01
The radioenzymatic determination of adrenaline and noradrenaline in human plasma for the diagnosis of pheochromocytomas was put to use after improvements were made with respect to extraction and separation steps. The plasma catecholamines at rest were distinctly higher in patients with pheochromocytomas. The plasma catecholamine level showed a significant increase as well with the glucagon test between the second and fifth minute. The method was not well suited for the localisation diagnostic where the plasma catecholamines were determined in selectively taken blood from the lower vena cava. Overall, however, the radioenzymatic determination of catecholamines in plasma proved itself to be a relatively ponderous, but exact and sensitive method for the measuring of basal catecholamine level and its changes. In the clinical area it is used as a valuable supplement to the contemporary diagnostic of pheochromocytomas. (orig./TRV) [de
A methodology for the evaluation of fuel rod failures under transportation accidents
International Nuclear Information System (INIS)
Rashid, J.Y.R.; Machiels, A.J.
2004-01-01
Recent studies on long-term behavior of high-burnup spent fuel have shown that under normal conditions of stor-age, challenges to cladding integrity from various postulated damage mechanisms, such as delayed hydride crack-ing, stress-corrosion cracking and long-term creep, would not lead to any significant safety concerns during dry storage, and regulatory rules have subsequently been established to ensure that a compatible level of safety is maintained. However, similar safety assurances for spent fuel transportation have not yet been developed, and further studies are currently being conducted to evaluate the conditions under which transportation-related safety issues can be resolved. One of the issues presently under evaluation is the ability and the extent of the fuel as-semblies to maintain non-reconfigured geometry during transportation accidents. This evaluation may determine whether, or not, the shielding, confinement, and criticality safety evaluations can be performed assuming initial fuel assembly geometries. The degree to which spent fuel re-configuration could occur during a transportation accident would depend to a large degree on the number of fuel rod failures and the type and geometry of the failure modes. Such information can only be developed analytically, as there is no direct experimental data that can provide guidance on the level of damage that can be expected. To this end, the paper focuses on the development of a modeling and analysis methodology that deals with this general problem on a generic basis. First consideration is given to defining acci-dent loading that is equivalent to the bounding, although analytically intractable, hypothetical transportation acci-dent of a 9-meter drop onto essentially unyielding surface, which is effectively a condition for impact-limiters de-sign. Second, an analytically robust material constitutive model, an essential element in a successful structural analysis, is required. A material behavior model
Highly loaded behavior of kinesins increases the robustness of transport under high resisting loads.
Directory of Open Access Journals (Sweden)
Woochul Nam
2015-03-01
Full Text Available Kinesins are nano-sized biological motors which walk by repeating a mechanochemical cycle. A single kinesin molecule is able to transport its cargo about 1 μm in the absence of external loads. However, kinesins perform much longer range transport in cells by working collectively. This long range of transport by a team of kinesins is surprising because the motion of the cargo in cells can be hindered by other particles. To reveal how the kinesins are able to accomplish their tasks of transport in harsh intracellular circumstances, stochastic studies on the kinesin motion are performed by considering the binding and unbinding of kinesins to microtubules and their dependence on the force acting on kinesin molecules. The unbinding probabilities corresponding to each mechanochemical state of kinesin are modeled. The statistical characterization of the instants and locations of binding are captured by computing the probability of unbound kinesin being at given locations. It is predicted that a group of kinesins has a more efficient transport than a single kinesin from the perspective of velocity and run length. Particularly, when large loads are applied, the leading kinesin remains bound to the microtubule for long time which increases the chances of the other kinesins to bind to the microtubule. To predict effects of this behavior of the leading kinesin under large loads on the collective transport, the motion of the cargo is studied when the cargo confronts obstacles. The result suggests that the behavior of kinesins under large loads prevents the early termination of the transport which can be caused by the interference with the static or moving obstacles.
Thermal analysis on NAC-STC spent fuel transport cask under different transport conditions
Energy Technology Data Exchange (ETDEWEB)
Xu, Yumei [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Yang, Jian, E-mail: zdhjkz@zju.edu.cn [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Xu, Chao; Wang, Weiping [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Ma, Zhijun [Department of Material Engineering, South China University of Technology, Guangzhou (China)
2013-12-15
Highlights: • Spent fuel cask was investigated as a whole instead of fuel assembly alone. • The cask was successfully modeled and meshed after several simplifications. • Equivalence method was used to calculate the properties of parts. • Both the integral thermal field and peak values are captured to verify safety. • The temperature variations of key parts were also plotted. - Abstract: Transport casks used for conveying spent nuclear fuel are inseparably related to the safety of the whole reprocessing system for spent nuclear fuel. Thus they must be designed according to rigorous safety standards including thermal analysis. In this paper, for NAC-STC cask, a finite element model is established based on some proper simplifications on configurations and the heat transfer mechanisms. Considering the complex components and gaps, the equivalence method is presented to define their material properties. Then an equivalent convection coefficient is introduced to define boundary conditions. Finally, the temperature field is captured and analyzed under both normal and accident transport conditions by using ANSYS software. The validity of numerical calculation is given by comparing its results with theoretical calculation. Obtaining the integral distribution laws of temperature and peak temperature values of all vital components, the security of the cask can be evaluated and verified.
International Nuclear Information System (INIS)
Hansen, S.E.; Hedeskov, C.J.
1977-01-01
A highly sensitive double isotope method for the simultaneous determination of serotonin, dopamine, noradrenaline and adrenaline has been developed. Advantages and limitations of the method are discussed. The mentioned biogenic amines are all present in isolated pancreatic islet tissue from albino mice in concentrations ranging from approximately 5-30 μmol per kg wet weight (0.8-5 x 10 -3 pmol/ng DNA). A somewhat higher content of these amines, especially dopamine, was found in pancreatic acinar tissue. The hypothesis that the impaired glucose-induced insulin secretion during starvation partly is caused by an increased content of biogenic amines in the pancreatic islets was not supported by our experiments which showed an unchanged islet content of these amines after 48 h starvation. (author)
Energy Technology Data Exchange (ETDEWEB)
Hansen, S E; Hedeskov, C J [Copenhagen Univ. (Denmark)
1977-01-01
A highly sensitive double isotope method for the simultaneous determination of serotonin, dopamine, noradrenaline and adrenaline has been developed. Advantages and limitations of the method are discussed. The mentioned biogenic amines are all present in isolated pancreatic islet tissue from albino mice in concentrations ranging from approximately 5-30 ..mu..mol per kg wet weight (0.8-5 x 10/sup -3/ pmol/ng DNA). A somewhat higher content of these amines, especially dopamine, was found in pancreatic acinar tissue. The hypothesis that the impaired glucose-induced insulin secretion during starvation partly is caused by an increased content of biogenic amines in the pancreatic islets was not supported by our experiments which showed an unchanged islet content of these amines after 48 h starvation.
Institutional interactions in developing a transportation system under the Nuclear Waste Policy Act
International Nuclear Information System (INIS)
Denny, S.H.
1986-01-01
The Department of Energy (DOE) recognizes that the success of its efforts to develop and operate a system for transporting nuclear waste under the provisions of the Nuclear Waste Policy Act of 1982 (NWPA) depends in large measure on the effectiveness of Departmental interactions with the affected parties. To ensure the necessary network of communication, the DOE is establishing lines of contact with those who are potential participants in the task of developing the policies and procedures for the NWPA transportation system. In addition, a number of measures have been initiated to reinforce broad-based involvement in program development. The Transportation Institutional Plan provides a preliminary road map of DOE's projected interactions over the next decade and is discussed in this paper
Heat transport and afterheat removal for gas cooled reactors under accident conditions
International Nuclear Information System (INIS)
2001-01-01
The Co-ordinated Research Project (CRP) on Heat Transport and Afterheat Removal for Gas Cooled Reactors Under Accident Conditions was organized within the framework of the International Working Group on Gas Cooled Reactors (IWGGCR). This International Working Group serves as a forum for exchange of information on national programmes, provides advice to the IAEA on international co-operative activities in advanced technologies of gas cooled reactors (GCRs) and supports the conduct of these activities. Advanced GCR designs currently being developed are predicted to achieve a high degree of safety through reliance on inherent safety features. Such design features should permit the technical demonstration of exceptional public protection with significantly reduced emergency planning requirements. For advanced GCRs, this predicted high degree of safety largely derives from the ability of the ceramic coated fuel particles to retain the fission products under normal and accident conditions, the safe neutron physics behaviour of the core, the chemical stability of the core and the ability of the design to dissipate decay heat by natural heat transport mechanisms without reaching excessive temperatures. Prior to licensing and commercial deployment of advanced GCRs, these features must first be demonstrated under experimental conditions representing realistic reactor conditions, and the methods used to predict the performance of the fuel and reactor must be validated against these experimental data. Within this CRP, the participants addressed the inherent mechanisms for removal of decay heat from GCRs under accident conditions. The objective of this CRP was to establish sufficient experimental data at realistic conditions and validated analytical tools to confirm the predicted safe thermal response of advance gas cooled reactors during accidents. The scope includes experimental and analytical investigations of heat transport by natural convection conduction and thermal
Transport in aluminized RDX under shock compression explored using molecular dynamics simulations
International Nuclear Information System (INIS)
Losada, M; Chaudhuri, S
2014-01-01
Shock response of energetic materials is controlled by a combination of mechanical response, thermal, transport, and chemical properties. How these properties interplay in condensed-phase energetic materials is of fundamental interest for improving predictive capabilities. Due to unknown nature of chemistry during the evolution and growth of high-temperature regions within the energetic material (so called hot spots), the connection between reactive and unreactive equations of state contain a high degree of empiricism. In particular, chemistry in materials with high degree of heterogeneity such as aluminized HE is of interest. In order to identify shock compression states and transport properties in high-pressure/temperature (HP-HT) conditions, we use molecular dynamics (MD) simulations in conjunction with the multi-scale shock technique (MSST). Mean square displacement calculations enabled us to track the diffusivity of stable gas products. Among decomposition products, H 2 O and CO 2 are found to be the dominant diffusing species under compression conditions. Heat transport and diffusion rates in decomposed RDX are compared and the comparison shows that around 2000 K, transport can be a major contribution during propagation of the reaction front.
Genesis and Maintenance of Attentional Biases: The Role of the Locus Coeruleus-Noradrenaline System
Directory of Open Access Journals (Sweden)
Mana R. Ehlers
2017-01-01
Full Text Available Emotionally arousing events are typically better remembered than mundane ones, in part because emotionally relevant aspects of our environment are prioritized in attention. Such biased attentional tuning is itself the result of associative processes through which we learn affective and motivational relevance of cues. We propose that the locus coeruleus-noradrenaline (LC-NA system plays an important role in the genesis of attentional biases through associative learning processes as well as their maintenance. We further propose that individual differences in and disruptions of the LC-NA system underlie the development of maladaptive biases linked to psychopathology. We provide support for the proposed role of the LC-NA system by first reviewing work on attentional biases in development and its link to psychopathology in relation to alterations and individual differences in NA availability. We focus on pharmacological manipulations to demonstrate the effect of a disrupted system as well as the ADRA2b polymorphism as a tool to investigate naturally occurring differences in NA availability. We next review associative learning processes that—modulated by the LC-NA system—result in such implicit attentional biases. Further, we demonstrate how NA may influence aversive and appetitive conditioning linked to anxiety disorders as well as addiction and depression.
Long-range transport of air pollution under light gradient wind conditions
International Nuclear Information System (INIS)
Kurita, H.; Sasaki, K.; Muroga, H.; Ueda, H.; Wakamatsu, S.
1985-01-01
The long-range transport of air pollution on clear days under light gradient wind conditions is investigated from an analysis of all days with high oxidant concentrations in 1979 at locations in central Japan that are far from pollutant sources. Surface-level wind and pressure distributions over a 300 x 300 km area were analyzed, together with concentration isopleths of oxidants and suspended particles produced by photochemical reactions
Multi-scale nitrate transport in a sandstone aquifer system under intensive agriculture
Paradis, Daniel; Ballard, Jean-Marc; Lefebvre, René; Savard, Martine M.
2018-03-01
Nitrate transport in heterogeneous bedrock aquifers is influenced by mechanisms that operate at different spatial and temporal scales. To understand these mechanisms in a fractured sandstone aquifer with high porosity, a groundwater-flow and nitrate transport model—reproducing multiple hydraulic and chemical targets—was developed to explain the actual nitrate contamination observed in groundwater and surface water in a study area on Prince Edward Island, Canada. Simulations show that nitrate is leached to the aquifer year-round, with 61% coming from untransformed and transformed organic sources originating from fertilizers and manure. This nitrate reaches the more permeable shallow aquifer through fractures in weathered sandstone that represent only 1% of the total porosity (17%). Some of the nitrate reaches the underlying aquifer, which is less active in terms of groundwater flow, but most of it is drained to the main river. The river-water quality is controlled by the nitrate input from the shallow aquifer. Groundwater in the underlying aquifer, which has long residence times, is also largely influenced by the diffusion of nitrate in the porous sandstone matrix. Consequently, following a change of fertilizer application practices, water quality in domestic wells and the river would change rapidly due to the level of nitrate found in fractures, but a lag time of up to 20 years would be necessary to reach a steady level due to diffusion. This demonstrates the importance of understanding nitrate transport mechanisms when designing effective agricultural and water management plans to improve water quality.
Directory of Open Access Journals (Sweden)
Ye. V. Dzybinskaya
2009-01-01
Full Text Available Objective: to study central hemodynamics, the determinants of myocardial oxygen balance, and the parameters of oxygen transport in various activation of patients after surgery under extracorporeal circulation. Subjects and methods. Thirty-four patients aged 57.8±2.5 years who had coronary heart disease were divided into 2 groups: 1 those with late activation (artificial ventilation time 157±9 min and 2 those with immediate activation (artificial ventilation time 33±6 min. Group 2 patients were, if required, given fentanyl, midazolam, or myorelaxants. Results. During activation, there were no intergroup differences in the mean levels of the major parameters of cardiac pump function, in the determinants of coronary blood flow (coronary perfusion gradients and myocardial oxygen demand (the product of heart rate by systolic blood pressure, and in the parameters of oxygen transport, including arterial lactatemia. After tracheal extubation, the left ventricular pump coefficient was increased considerably (up to 3.8±0.2 and 4.4±0.2 gm/mm Hg/m2 in Groups 1 and 2, respectively; p<0.05 with minimum inotropic support (dopamine and/or dobutamine being used at 2.7±0.3 and 2.4±0.3 mg/kg/min, respectively. In both groups, there were no close correlations between the indices of oxygen delivery and consumption at all stages of the study, which was indicative of no transport-dependent oxygen uptake. Conclusion. When the early activation protocol was followed up, the maximum acceleration of early activation, including that using specific antagonists of anesthetics, has no negative impact on central hemodynamics, the determinants of myocardial oxygen balance and transport in patients operated on under extracorporeal circulation. Key words: early activation, surgery under extracorporeal circulation, tracheal extubation in the operating-room, central hemodynamics, oxygen transport.
Solute transport in a well under slow-purge and no-purge conditions
Plummer, M. A.; Britt, S. L.; Martin-Hayden, J. M.
2010-12-01
Non-purge sampling techniques, such as diffusion bags and in-situ sealed samplers, offer reliable and cost-effective groundwater monitoring methods that are a step closer to the goal of real-time monitoring without pumping or sample collection. Non-purge methods are, however, not yet completely accepted because questions remain about how solute concentrations in an unpurged well relate to concentrations in the adjacent formation. To answer questions about how undisturbed well water samples compare to formation concentrations, and to provide the information necessary to interpret results from non-purge monitoring systems, we have conducted a variety of physical experiments and numerical simulations of flow and transport in and through monitoring wells under low-flow and ambient flow conditions. Previous studies of flow and transport in wells used a Darcy’s law - based continuity equation for flow, which is often justified under the strong, forced-convection flow caused by pumping or large vertical hydraulic potential gradients. In our study, we focus on systems with weakly forced convection, where density-driven free convection may be of similar strength. We therefore solved Darcy’s law for porous media domains and the Navier Stokes equations for flow in the well, and coupled solution of the flow equations to that of solute transport. To illustrate expected in-well transport behavior under low-flow conditions, we present results of three particular studies: (1) time-dependent effluent concentrations from a well purged at low-flow pumping rates, (2) solute-driven density effects in a well under ambient horizontal flow and (3) temperature-driven mixing in a shallow well subject to seasonal temperature variations. Results of the first study illustrate that assumptions about the nature of in-well flow have a significant impact on effluent concentration curves even during pumping, with Poiseuille-type flow producing more rapid removal of concentration differences
Directory of Open Access Journals (Sweden)
Yu-Chun Wang
2013-11-01
Full Text Available Background/Aims: Copper is an essential trace element for normal cellular function and contributes to critical physiological or pathological processes. The aim of the study was to investigate the effects of copper on vascular tone of rat mesenteric artery and compare the effects of copper on noradrenaline (NA and high K+ induced vasoconstriction. Methods: The rat mesenteric arteries were isolated and the vessel tone was measured by using multi wire myograph system in vitro. Blood pressure of carotid artery in rabbits was measured by using physiological data acquisition and analysis system in vivo. Results: Copper dose-dependently blunted NA-induced vasoconstriction of rat mesenteric artery. Copper-induced vasorelaxation was inhibited when the vessels were pretreated with NG-nitro-L-arginine methyl ester (L-NAME. Copper did not blunt high K+-induced vasoconstriction. Copper preincubation inhibited NA-evoked vasoconstriction and the inhibition was not affected by the presence of L-NAME. Copper preincubation showed no effect on high K+-evoked vasoconstriction. Copper chelator diethyldithiocarbamate trihydrate (DTC antagonized the vasoactivity induced by copper in rat mesenteric artery. In vivo experiments showed that copper injection (iv significantly decreased blood pressure of rabbits and NA or DTC injection (iv did not rescue the copper-induced hypotension and animal death. Conclusion: Copper blunted NA but not high K+-induced vasoconstriction of rat mesenteric artery. The acute effect of copper on NA-induced vasoconstriction was depended on nitric oxide (NO, but the effect of copper pretreatment on NA-induced vasoconstriction was independed on NO, suggesting that copper affected NA-induced vasoconstriction by two distinct mechanisms.
Volume Transmission in Central Dopamine and Noradrenaline Neurons and Its Astroglial Targets.
Fuxe, Kjell; Agnati, Luigi F; Marcoli, Manuela; Borroto-Escuela, Dasiel O
2015-12-01
Already in the 1960s the architecture and pharmacology of the brainstem dopamine (DA) and noradrenaline (NA) neurons with formation of vast numbers of DA and NA terminal plexa of the central nervous system (CNS) indicated that they may not only communicate via synaptic transmission. In the 1980s the theory of volume transmission (VT) was introduced as a major communication together with synaptic transmission in the CNS. VT is an extracellular and cerebrospinal fluid transmission of chemical signals like transmitters, modulators etc. moving along energy gradients making diffusion and flow of VT signals possible. VT interacts with synaptic transmission mainly through direct receptor-receptor interactions in synaptic and extrasynaptic heteroreceptor complexes and their signaling cascades. The DA and NA neurons are specialized for extrasynaptic VT at the soma-dendrtitic and terminal level. The catecholamines released target multiple DA and adrenergic subtypes on nerve cells, astroglia and microglia which are the major cell components of the trophic units building up the neural-glial networks of the CNS. DA and NA VT can modulate not only the strength of synaptic transmission but also the VT signaling of the astroglia and microglia of high relevance for neuron-glia interactions. The catecholamine VT targeting astroglia can modulate the fundamental functions of astroglia observed in neuroenergetics, in the Glymphatic system, in the central renin-angiotensin system and in the production of long-distance calcium waves. Also the astrocytic and microglial DA and adrenergic receptor subtypes mediating DA and NA VT can be significant drug targets in neurological and psychiatric disease.
Fernández-Pastor, Begoña; Mateo, Yolanda; Gómez-Urquijo, Sonia; Javier Meana, J
2005-07-01
The origin and regulation of noradrenaline (NA) in the locus coeruleus (LC) is unknown. The neurochemical features of NA overflow (nerve impulse dependence, neurotransmitter synthesis, vesicle storage, reuptake, alpha2-adrenoceptor-mediated regulation) were characterized in the LC. Brain microdialysis was performed in awake rats. Dialysates were analyzed for NA. NA in the LC decreased via local infusion of Ca2+-free medium (-42+/-5%) or the sodium channel blocker tetrodotoxine (TTX) (-47+/-8%) but increased (333+/-40%) via KCl-induced depolarization. The tyrosine hydroxylase (TH) inhibitor alpha-methyl-p-tyrosine (250 mg kg(-1), i.p.) and the vesicle depletory drug reserpine (5 mg kg(-1), i.p.) decreased NA. Therefore, extracellular NA in the LC satisfies the criteria for an impulse flow-dependent vesicular exocytosis of neuronal origin. Local perfusion of the alpha2-adrenoceptor agonist clonidine (0.1-100 microM) decreased NA (E(max)=-79+/-5%) in the LC, whereas the opposite effect (E(max)=268+/-53%) was observed with the alpha2A-adrenoceptor antagonist BRL44408 (0.1-100 microM). This suggests a tonic modulation of NA release through local alpha2A-adrenoceptors. The selective NA reuptake inhibitor desipramine (DMI) (0.1-100 microM) administered into the LC increased NA in the LC (E(max)=223+/-40%) and simultaneously decreased NA in the cingulate cortex, confirming the modulation exerted by NA in the LC on firing activity of noradrenergic cells and on the subsequent NA release in noradrenergic terminals. Synaptic processes underlying NA release in the LC are similar to those in noradrenergic terminal areas. NA in the LC could represent local somatodendritic release, but also the presence of neurotransmitter release from collateral axon terminals.
Directory of Open Access Journals (Sweden)
R.A. Orujov
2017-12-01
Full Text Available Benzene is a widely spread chemical health risk factor. Our research goal was to examine the nervous system state and the blood system state under benzene intoxication during an experiment. An acute experiment was performed on 45 white mice with 5-fold poisoning with benzene; a chronic one was performed on 72 rabbits being under inhalation exposure to benzene during 4 months, its concentrations increasing and fluctuating. We determined the following blood parameters: number of reticulocytes, eosinophils, basocytes, and erythrocytes; erythrocytes sedimentation rate; blood clotting period; blood clot retraction; plasma re-calcification period; plasma tolerance to heparin; prothrombin time; prothrombin index; fibrinogen concentration; blood fibrinolytic activity; acetylcholine and choline esterase contents. We also determined adrenalin, noradrenalin, dopamine, and dihydroxyphenylalanine contents in urine. Acute experiments results revealed that one-time exposure to benzene exerted a narcotic effect on the central nervous system which had an excitation phase and inhibition phase. Under a repeat exposure to benzene animals' drug intoxication was shorter. And here neutrophils / leucocytes gradient first increased to 139.5 % from its standards value and then when down under consequent intoxications. We detected relevant changes in morphological picture of animals' peripheral blood and their central and vegetative nervous system under chronic exposure to intermittent and increasing benzene concentrations. So, our research revealed that effects exerted by benzene in small concentrations led to apparent shifts in white blood and catecholamines (adrenalin, noradrenalin, dopamine, and dihydroxyphenylalanine. We also detected certain signs that cate-cholamines endogenous reserves (dihydroxyphenylalanine were depleted and, and also signs of eosinophils-basocytes disso-ciation; such prognostic signs were considered to be unfavorable as it was exactly at that
Groh, J.; Vanderborght, J.; Puetz, T.; Gerke, H. H.; Rupp, H.; Wollschlaeger, U.; Stumpp, C.; Priesack, E.; Vereecken, H.
2015-12-01
Understanding water flow and solute transport in the unsaturated zone is of great importance for an appropriate land use management strategy. The quantification and prediction of water and solute fluxes through the vadose zone can help to improve management practices in order to limit potential risk on our fresh water resources. Water related solute transport and residence time is strongly affected by preferential flow paths in the soil. Water flow in soils depends on soil properties and site factors (climate or experiment conditions, land use) and are therefore important factors to understand preferential solute transport in the unsaturated zone. However our understanding and knowledge of which on-site properties or conditions define and enhance preferential flow and transport is still poor and mostly limited onto laboratory experimental conditions (small column length and steady state boundary conditions). Within the TERENO SOILCan lysimeter network, which was designed to study the effects of climate change on soil functions, a bromide tracer was applied on 62 lysimeter at eight different test sites between Dec. 2013 and Jan. 2014. The TERENO SOILCan infrastructure offers the unique possibility to study the occurrence of preferential flow and transport of various soil types under different natural transient hydrological conditions and land use (crop, bare and grassland) at eight TERENO SOILCan observatories. Working with lysimeter replicates at each observatory allows defining the spatial variability of preferential transport and flow. Additionally lysimeters in the network were transferred within and between observatories in order to subject them to different rainfall and temperature regimes and enable us to relate the soil type susceptibility of preferential flow and transport not only to site specific physical and land use properties, but also to different transient boundary conditions. Comparison and statistical analysis between preferential flow indicators 5
Delgado, María Graciela; Oliva, Carlos; López, Estefanía; Ibacache, Andrés; Galaz, Alex; Delgado, Ricardo; Barros, L Felipe; Sierralta, Jimena
2018-01-19
The intercellular transport of lactate is crucial for the astrocyte-to-neuron lactate shuttle (ANLS), a model of brain energetics according to which neurons are fueled by astrocytic lactate. In this study we show that the Drosophila chaski gene encodes a monocarboxylate transporter protein (MCT/SLC16A) which functions as a lactate/pyruvate transporter, as demonstrated by heterologous expression in mammalian cell culture using a genetically encoded FRET nanosensor. chaski expression is prominent in the Drosophila central nervous system and it is particularly enriched in glia over neurons. chaski mutants exhibit defects in a high energy demanding process such as synaptic transmission, as well as in locomotion and survival under nutritional stress. Remarkably, locomotion and survival under nutritional stress defects are restored by chaski expression in glia cells. Our findings are consistent with a major role for intercellular lactate shuttling in the brain metabolism of Drosophila.
Carbon dioxide sequestration: Modeling the diffusive and convective transport under a CO2 cap
Allen, Rebecca; Sun, Shuyu
2012-01-01
of low permeability. CO2 from this ‘capped' region diffuses into the fluid underlying it, and the resulting CO2-fluid mixture increases in density. This increase in density leads to gravity-driven convection. Accordingly, diffusive-convective transport
A theoretical model for oxygen transport in skeletal muscle under conditions of high oxygen demand.
McGuire, B J; Secomb, T W
2001-11-01
Oxygen transport from capillaries to exercising skeletal muscle is studied by use of a Krogh-type cylinder model. The goal is to predict oxygen consumption under conditions of high demand, on the basis of a consideration of transport processes occurring at the microvascular level. Effects of the decline in oxygen content of blood flowing along capillaries, intravascular resistance to oxygen diffusion, and myoglobin-facilitated diffusion are included. Parameter values are based on human skeletal muscle. The dependence of oxygen consumption on oxygen demand, perfusion, and capillary density are examined. When demand is moderate, the tissue is well oxygenated and consumption is slightly less than demand. When demand is high, capillary oxygen content declines rapidly with axial distance and radial oxygen transport is limited by diffusion resistance within the capillary and the tissue. Under these conditions, much of the tissue is hypoxic, consumption is substantially less than demand, and consumption is strongly dependent on capillary density. Predicted consumption rates are comparable with experimentally observed maximal rates of oxygen consumption.
Testing ZigBee Motes for Monitoring Refrigerated Vegetable Transportation under Real Conditions
Directory of Open Access Journals (Sweden)
Luis Ruiz-Garcia
2010-05-01
Full Text Available Quality control and monitoring of perishable goods during transportation and delivery services is an increasing concern for producers, suppliers, transport decision makers and consumers. The major challenge is to ensure a continuous ‘cold chain’ from producer to consumer in order to guaranty prime condition of goods. In this framework, the suitability of ZigBee protocol for monitoring refrigerated transportation has been proposed by several authors. However, up to date there was not any experimental work performed under real conditions. Thus, the main objective of our experiment was to test wireless sensor motes based in the ZigBee/IEEE 802.15.4 protocol during a real shipment. The experiment was conducted in a refrigerated truck traveling through two countries (Spain and France which means a journey of 1,051 kilometers. The paper illustrates the great potential of this type of motes, providing information about several parameters such as temperature, relative humidity, door openings and truck stops. Psychrometric charts have also been developed for improving the knowledge about water loss and condensation on the product during shipments.
Transport of nuclear material under the 1971 Brussels Convention
International Nuclear Information System (INIS)
Lagorce, M.
1975-01-01
The legal regime in force before entry into force of the 1971 Brussels Convention relating to civil liability for the maritime carriage of nuclear material created serious difficulties for maritime carriers, regarding both the financial risks entailed and restrictions on enjoyment of the rights granted by civil liability conventions. The 1971 Convention exonerates from liability any person likely to be held liable for nuclear damage under maritime law, provided another person is liable under the nuclear conventions or an equivalent national law. A problem remaining is that of compensation of nuclear damage to the means of transport for countries not having opted for re-inclusion of such damage in the nuclear law regime; this does not apply however to countries having ratified the Convention to date. A feature of the latter is that it establishes as extensively as possible the priority of nuclear law over maritime law. Furthermore the new regime continues to preserve efficiently the interests of victims of nuclear incidents. It is therefore to be hoped that insurers will no longer hesitate to cover international maritime carriage of nuclear material [fr
Alf, Malte F; Duarte, João M N; Schibli, Roger; Gruetter, Rolf; Krämer, Stefanie D
2013-12-01
We addressed the questions of how cerebral glucose transport and phosphorylation change under acute hypoglycemia and what the underlying mechanisms of adaptation are. Quantitative (18)F-FDG PET combined with the acquisition of real-time arterial input function was performed on mice. Hypoglycemia was induced and maintained by insulin infusion. PET data were analyzed with the 2-tissue-compartment model for (18)F-FDG, and the results were evaluated with Michaelis-Menten saturation kinetics. Glucose clearance from plasma to brain (K1,glc) and the phosphorylation rate constant increased with decreasing plasma glucose (Gp), in particular at a Gp of less than 2.5 mmol/L. Estimated cerebral glucose extraction ratios taking into account an increased cerebral blood flow (CBF) at a Gp of less than 2 mmol/L were between 0.14 and 0.79. CBF-normalized K1,glc values were in agreement with saturation kinetics. Phosphorylation rate constants indicated intracellular glucose depletion at a Gp of less than 2-3 mmol/L. When brain regions were compared, glucose transport under hypoglycemia was lowest in the hypothalamus. Alterations in glucose transport and phosphorylation, as well as intracellular glucose depletion, under acute hypoglycemia can be modeled by saturation kinetics taking into account an increase in CBF. Distinct transport kinetics in the hypothalamus may be involved in its glucose-sensing function.
International Nuclear Information System (INIS)
Lu, Miaomiao; Tang, Xiao; Wang, Zifa; Gbaguidi, Alex; Liang, Shengwen; Hu, Ke; Wu, Lin; Wu, Huangjian; Huang, Zhen; Shen, Longjiao
2017-01-01
Wuhan as a megacity of Central China was suffering from severe particulate matter pollution according to previous observation studies, however, the mechanism behind the pollution formation especially the impact of regional chemical transport is still unclear. This study, carried out on the Nested Air Quality Prediction Modeling System (NAQPMS) coupled with an on-line source-tagging module, explores different roles regional transport had in two strong haze episodes over Wuhan in October 2014 and quantitatively assesses the contributions from local and regional sources to PM 2.5 concentration. Validation of predictions based on observations shows modeling system good skills in reproducing key meteorological and chemical features. The first short-time haze episode occurred on 12 October under strong northerly winds, with a hourly PM 2.5 peak of 180 μg m −3 , and was found to be caused primarily by the long-range transport from the northern regions, which contributed 60.6% of the episode's PM 2.5 concentration (versus a total of 32.7% from sources in and near Wuhan). The second episode lasted from the 15–20 October under stable regional large-scale synoptic conditions and weak winds, and had an hourly PM 2.5 peak of 231.0 μg m −3 . In this episode, both the long-distance transport from far regions and short-range transport from the Wuhan-cluster were the primary causes of the haze episode and account for 24.8% and 29.2% of the PM 2.5 concentration respectively. Therefore, regional transport acts as a crucial driver of haze pollution over Wuhan through not only long-range transfer of pollutants, but also short-range aerosol movement under specific meteorological conditions. The present findings highlight the important role of regional transport in urban haze formation and indicate that the joint control of multi city-clusters are needed to reduce the particulate pollution level in Wuhan. - Highlights: • Regional transport impacts studied on two haze
Carbon dioxide sequestration: Modeling the diffusive and convective transport under a CO2 cap
Allen, Rebecca
2012-01-01
A rise in carbon dioxide levels from industrial emissions is contributing to the greenhouse effect and global warming. CO2 sequestration in saline aquifers is a strategy to reduce atmospheric CO2 levels. Scientists and researchers rely on numerical simulators to predict CO2 storage by modeling the fluid transport behaviour. Studies have shown that after CO2 is injected into a saline aquifer, undissolved CO2 rises due to buoyant forces and will spread laterally away from the injection site under an area of low permeability. CO2 from this ‘capped\\' region diffuses into the fluid underlying it, and the resulting CO2-fluid mixture increases in density. This increase in density leads to gravity-driven convection. Accordingly, diffusive-convective transport is important to model since it predicts an enhanced storage capacity of the saline aquifer. This work incorporates the diffusive and convective transport processes into the transport modeling equation, and uses a self-generated code. Discretization of the domain is done with a cell-centered finite difference method. Cases are set up using similar parameters from published literature in order to compare results. Enhanced storage capacity is predicted in this work, similar to work done by others. A difference in the onset of convective transport between this work and published results is noticed and discussed in this paper. A sensitivity analysis is performed on the density model used in this work, and on the diffusivity value assumed. The analysis shows that the density model and diffusivity value is a key component on simulation results. Also, perturbations are added to porosity and permeability in order to see the effect of perturbations on the onset of convection, and results agree with similar findings by others. This work provides a basis for studying other cases, such as the impact of heterogeneity on the diffusion-convective transport. An extension of this work may involve the use of an equation of state to
Directory of Open Access Journals (Sweden)
Masaki Yamamoto
2016-09-01
Full Text Available Naftopidil, an α1-adrenoceptor antagonist, has been shown to inhibit nocturnal polyuria in patients with lower urinary tract symptom. However, it remains unclear how naftopidil decreases nocturnal urine production. Here, we investigated the effects of naftopidil on arginine-vasopressin (AVP plasma level and urine production and osmolality in rats centrally administered with noradrenaline (NA. NA (3 or 30 μg/kg was administered into the left ventricle (i.c.v. of male Wistar rats 3 h after naftopidil pretreatment (10 or 30 mg/kg, i.p.. Blood samples were collected from the inferior vena cava 1 h after NA administration or 4 h after peritoneal administration of naftopidil; plasma levels of AVP were assessed by ELISA. Voiding behaviors of naftopidil (30 mg/kg, i.p.-administered male Wistar rats were observed during separate light- and dark cycles. Administration of NA decreased plasma AVP levels and elevated urine volume, which were suppressed by systemic pretreatment with naftopidil (30 mg/kg, i.p.. Urine osmolality decreased 1 h after NA administration. However, naftopidil by itself had no effect on plasma AVP levels or urodynamic parameters during light- and dark cycles. Our findings suggest that systemic administration of naftopidil could prevent central noradrenergic nervous system-mediated decline in AVP secretion and increase in urine production in rats.
Electron transport properties in InAs four-terminal ballistic junctions under weak magnetic fields
International Nuclear Information System (INIS)
Koyama, M.; Fujiwara, K.; Amano, N.; Maemoto, T.; Sasa, S.; Inoue, M.
2009-01-01
We report on the electron transport properties based on ballistic electrons under magnetic fields in four-terminal ballistic junctions fabricated on an InAs/AlGaSb heterostructure. The four-terminal junction structure is composed of two longitudinal stems with two narrow wires slanted with 30 degree from the perpendicular axis. The electron focusing peak was obtained with the bend resistance measurement. Then it was investigated the nonlinear electron transport property of potential difference between longitudinal stems due to ballistic electrons with applying direct current from narrow wires. Observed nonlinearity showed clear rectification effects which have negative polarity regardless of input voltage polarity. Although this nonlinearity was qualitatively changed due to the Lorentz force under magnetic fields, the degradation of ballistic effects on nonlinear properties were observed when the current increased to higher strength. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Energy Technology Data Exchange (ETDEWEB)
Armour, N.; Dost, S. [Crystal Growth Laboratory, University of Victoria, Victoria, BC, V8W 3P6 (Canada)
2010-04-15
The effect of applied rotating and combined (rotating and static) magnetic fields on silicon transport during the liquid phase diffusion growth of SiGe was experimentally studied. 72-hour growth periods produced some single crystal sections. Single and polycrystalline sections of the processed samples were examined for silicon composition. Results show that the application of a rotating magnetic field enhances silicon transport in the melt. It also has a slight positive effect on flattening the initial growth interface. For comparison, growth experiments were also conducted under combined (rotating and static) magnetic fields. The processed samples revealed that the addition of static field altered the thermal characteristics of the system significantly and led to a complete melt back of the germanium seed. Silicon transport in the melt was also enhanced under combined fields compared with experiments with no magnetic field. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Electronic transport in armchair graphene nanoribbon under double magnetic barrier modulation
Wang, Haiyan; Wu, Chao; Xie, Fang; Zhang, Xiaojiao; Zhou, Guanghui
2018-03-01
We present a theoretical investigation of the transport properties and the magnetoresistance effect in armchair graphene nanoribbons (AGNRs) under modulation by two magnetic barriers. The energy levels are found to be degenerate for a metallic AGNR but are not degenerate for a semiconducting AGNR. However, the conductance characteristics show quantized plateaus in both the metallic and semiconducting cases. When the magnetization directions of the barriers change from parallel to antiparallel, the conductance plateau in the metallic AGNR shows a degenerate feature due to matching between the transport modes in different regions. As the barrier height increases, the conductance shows more oscillatory behavior with sharp peaks and troughs. Specifically, the initial position of nonzero conductance for the metallic AGNR system moves towards a higher energy regime, which indicates that an energy gap has been opened. In addition, the magnetoresistance ratio also shows plateau structures in certain specific energy regions. These results may be useful in the design of electron devices based on AGNR nanostructures.
Overturf, C L; Wormington, A M; Blythe, K N; Gohad, N V; Mount, A S; Roberts, A P
2015-05-01
Noradrenaline (NA) is the active component of novel antifouling agents and acts by preventing attachment of fouling organisms. The goal of this study was to examine the toxicity of NA to the non-target zooplankton D. magna and C. dubia. Neonates were exposed to one of five concentrations of NA and effects on survival, reproduction and molting were determined. Calculated LC50 values were determined to be 46 and 38 μM in C. dubia and D. magna, respectively. A 10-day C. dubia study found that reproduction metrics were significantly impacted at non-lethal concentrations. In D. magna, concentrations greater than 40 μM significantly impacted molting. A toxicity test was conducted with D. magna using oxidized NA, which yielded similar results. These data indicate that both NA and oxidized NA are toxic to non-target zooplankton. Results obtained from this study can be used to guide future ecological risk assessments of catecholamine-based antifouling agents. Copyright © 2015. Published by Elsevier Inc.
International Nuclear Information System (INIS)
Vierke, Lena; Möller, Axel; Klitzke, Sondra
2014-01-01
The aim of this study was to gain an understanding of the transport of C 4–10 perfluoroalkyl carboxylic acids (PFCAs) and C 4,6,8 perfluoroalkyl sulfonic acids (PFSAs) in a water-saturated sediment column representing a riverbank filtration scenario under near-natural conditions. Short-chain PFCAs and PFSAs with up to six C-atoms showed complete tracer-like breakthrough. Longer chain ones were retarded due to sorption to the sediment or due to other processes in the aqueous phase. The study reports the first column derived sediment–water partition coefficients ranging from 0.01 cm 3 g −1 to 0.41 cm 3 g −1 for C 4,6 PFSAs and from 0.0 cm 3 g −1 to 6.5 cm 3 g −1 for C 4,5,6,8,9 PFCAs. The results clearly indicate that short-chain PFCAs and PFSAs may pose a problem if contaminated surface waters are used for drinking water production via riverbank filtration. Highlights: • Transport of per- and polyfluorinated compounds in a riverbank filtration scenario. • Investigations under near-natural conditions with a water-saturated sediment column. • Processes in water and sediment control the transport of analytes. • Short chain PFCAs and PFSAs are not retarded in the water-saturated sediment column. • First column derived sediment–water partition coefficients. -- Quantification of breakthrough of perfluoroalkyl carboxylic acids (PFCAs) and perfluoroalkyl sulfonic acids (PFSAs) under conditions simulating a riverbank filtration scenario
Advective-diffusive transport of D2O in unsaturated media under evaporation condition
International Nuclear Information System (INIS)
Koarashi, Jun; Atarashi-Andoh, Mariko; Amano, Hikaru; Yamazawa, Hiromi; Iida, Takao
2003-01-01
Advective-diffusive transport of HTO in unsaturated media was investigated empirically using deuterated water (D 2 O) and columns filled with glass beads. The tortuosity factor was evaluated by numerical model calculations corresponding to first experiment for diffusion under no-evaporation condition. Temporal variations in depth profiles of D 2 O concentrations in the columns were observed by second experiment, which considers the transferring and spreading of D 2 O by pore-water flow caused by evaporation. Measurements and model calculations indicated that diffusion was about two times more efficient than dispersion for D 2 O spreading process under this evaporation condition. (author)
Transport properties of the topological Kondo insulator SmB6 under the irradiation of light
International Nuclear Information System (INIS)
Zhu Guo-Bao; Yang Hui-Min
2016-01-01
In this paper, we study transport properties of the X point in the Brillouin zone of the topological Kondo insulator SmB 6 under the application of a circularly polarized light. The transport properties at high-frequency regime and low-frequency regime as a function of the ratio ( κ ) of the Dresselhaus-like and Rashba-like spin–orbit parameter are studied based on the Floquet theory and Boltzmann equation respectively. The sign of Hall conductivity at high-frequency regime can be reversed by the ratio κ and the amplitude of the light. The amplitude of the current can be enhanced by the ratio κ . Our findings provide a way to control the transport properties of the Dirac materials at low-frequency regime. (paper)
DEFF Research Database (Denmark)
Ryuzaki, Sou; Meyer, Jakob Abild Stengaard; Petersen, Søren Vermehren
2014-01-01
Charge transport properties of chemically reduced graphene oxide (RGO) sheets prepared by treatment with hydrazine were examined using conductive atomic force microscopy. The current-voltage (I-V) characteristics of monolayer RGO sheets prepared under atmospheric pressure followed an exponentially...
Serotonin and noradrenaline reuptake inhibitors (SNRIs) for fibromyalgia.
Welsch, Patrick; Üçeyler, Nurcan; Klose, Petra; Walitt, Brian; Häuser, Winfried
2018-02-28
Fibromyalgia is a clinically defined chronic condition of unknown etiology characterized by chronic widespread pain that often co-exists with sleep disturbances, cognitive dysfunction and fatigue. People with fibromyalgia often report high disability levels and poor quality of life. Drug therapy, for example, with serotonin and noradrenaline reuptake inhibitors (SNRIs), focuses on reducing key symptoms and improving quality of life. This review updates and extends the 2013 version of this systematic review. To assess the efficacy, tolerability and safety of serotonin and noradrenaline reuptake inhibitors (SNRIs) compared with placebo or other active drug(s) in the treatment of fibromyalgia in adults. For this update we searched CENTRAL, MEDLINE, Embase, the US National Institutes of Health and the World Health Organization (WHO) International Clinical Trials Registry Platform for published and ongoing trials and examined the reference lists of reviewed articles, to 8 August 2017. We selected randomized, controlled trials of any formulation of SNRIs against placebo or any other active treatment of fibromyalgia in adults. Three review authors independently extracted data, examined study quality, and assessed risk of bias. For efficacy, we calculated the number needed to treat for an additional beneficial outcome (NNTB) for pain relief of 50% or greater and of 30% or greater, patient's global impression to be much or very much improved, dropout rates due to lack of efficacy, and the standardized mean differences (SMD) for fatigue, sleep problems, health-related quality of life, mean pain intensity, depression, anxiety, disability, sexual function, cognitive disturbances and tenderness. For tolerability we calculated number needed to treat for an additional harmful outcome (NNTH) for withdrawals due to adverse events and for nausea, insomnia and somnolence as specific adverse events. For safety we calculated NNTH for serious adverse events. We undertook meta
International Nuclear Information System (INIS)
Porat, S.; Gabbay, M.; Tauber, M.; Ratovitski, T.; Blinder, E.; Simantov, R.
1996-01-01
Human neuroblastoma NMB cells take up [ 3 H]dopamine in a selective manner indicating that dopamine transporters are responsible for this uptake. These cells were therefore used as a model to study dopamine neurotoxicity, and to elucidate the role of dopamine transporters in controlling cell death. Treatment with 0.05-0.4 mM dopamine changed cells' morphology within 4 h, accompanied by retraction of processes, shrinkage, apoptosis-like atrophy, accumulation of apoptotic particles, DNA fragmentation and cell death. Cycloheximide inhibited dopamine's effect, suggesting that induction of apoptosis by dopamine was dependent upon protein synthesis. Dopamine cytotoxicity, monitored morphologically by flow cytometric analysis, and by lactate dehydrogenase released, was blocked by cocaine but not by the noradrenaline and serotonin uptake blockers desimipramine and imipramine, respectively. Attempting to inhibit dopamine transport and toxicity in a drug-free and highly selective way, three 18-mer dopamine transporter antisense phosphorothioate oligonucleotides (numbers 1, 2 and 3) and a new plasmid vector expressing the entire rat dopamine transporter complementary DNA in the antisense orientation were prepared and tested. Antisense phosphorothioate oligonucleotide 3 inhibited [ 3 H]dopamine uptake in a time- and dose-dependent manner. Likewise, transient transfection of NMB cells with the plasmid expressing dopamine transporter complementary DNA in the antisense orientation partially blocked [ 3 H]dopamine uptake. Antisense phosphorothioate oligonucleotide 3 also decreased, dose-dependently, the toxic effect of dopamine and 6-hydroxydopamine. Western blot analysis with newly prepared anti-human dopamine transporter antibodies showed that antisense phosphorothioate oligonucleotide 3 decreased the transporter protein level. These studies contribute to better understand the mechanism of dopamine-induced apoptosis and neurotoxicity. (Copyright (c) 1996 Elsevier Science B
15N-urea transport and transformation in two deforsted Amazonian soils under laboratory conditions
International Nuclear Information System (INIS)
Victoria, R.L.; Libardi, P.L.; Reichardt, K.; Matsui, E.
1982-01-01
Brazilian agriculture is now expanding toward the Amazon region, where large new areas of virgin lands are being brought under cultivation. There is therefore an urgent need to better understand the conditions and characteristics of the soils of that region. In this study a Red Yellow Podzol and a Yellow Latosol were used to examine urea transport and transformation in the laboratory under water-saturated conditions. The soils were collected in an area that was deforested in 1976 and planted to tropical fruits since then. Soils were subjected to miscible displacement techniques under both continuous feed and pulse applications of urea to mathematically describe urea transport and transformation as functions of depth and time. Transformation mechanisms were considered to be first order kinetics. Urea was readily leached from both soils. Recovery of urea in the effluent of the 30 cm columns was 91%, for the Podzol and 86% for the Latosol. NH 4+ -N from urea hydrolysis was also readily leached and its recovery in the effluent was 4.2% for the Podzol and 11.2% for the Latosol. Very little nitrogen-including exchangeable NH 4+ -N and biomass nitrogen - was left in the columns of either soil at the end of the experiment. (orig.)
2011-01-25
... to be selected for credit assistance. Because demand for the TIFIA program can exceed budgetary... Applications Because the demand for credit assistance can exceed budgetary resources, the DOT is utilizing... Availability for Applications for Credit Assistance Under the Transportation Infrastructure Finance and...
2011-01-19
... specified criteria to be selected for credit assistance. Because demand for the TIFIA program can exceed... Applications Because the demand for credit assistance can exceed budgetary resources, the DOT is utilizing...] Notice of Funding Availability for Applications for Credit Assistance Under the Transportation...
Quantified distribution of the noradrenaline innervation in the hippocampus of adult rat
International Nuclear Information System (INIS)
Oleskevich, S.; Descarries, L.; Lacaille, J.C.
1989-01-01
A recently developed radioautographic technique, based on the uptake labeling of monoamine terminals in vitro, was used to quantify the noradrenaline (NA) innervation in adult rat hippocampus. After incubation of brain slices with 1 microM 3H-NA, the NA varicosities were visualized as small aggregates of silver grains, in light microscope radioautographs prepared at 3 equidistant horizontal levels across the ventral 2/3 of the hippocampus. Using a computer-assisted image analyzer, counts were obtained from the subiculum (SUB), 3 sectors of Ammon's horn (CA1, CA3-a, CA3-b) and 3 sectors of the dentate gyrus (DG-medial blade, crest, and lateral blade), every lamina being sampled in each region. After a double correction for duration of radioautographic exposure and section thickness, and following measurement of varicosity diameter in electron microscope radioautographs, it was possible to express these results in number of terminals per volumetric unit of tissue. It was thus found that the overall density of hippocampal NA innervation averages 2.1 million varicosities/mm3 of tissue, a value almost twice as high as that in cerebral cortex. This innervation is 20% denser ventrally than dorsally and is heterogeneous both in terms of regional and laminar distribution. SUB and DG are more strongly innervated than Ammon's horn, wherein CA1 has the lowest overall density. In SUB and CA1, there is a clear predilection of NA varicosities for the stratum moleculare. In CA3, there is a narrow band of even stronger innervation in the stratum radiatum, near the apical border of the stratum pyramidale, contrasting with a 3 times lower density in this cell layer and the stratum oriens. In DG, the NA innervation is again the weakest in the cell body layer and exhibits an almost 3-fold greater density in the polymorph layer, the highest of all hippocampus
Suzuki, Miwa; Tomoshige, Mika; Ito, Miki; Koga, Sotaro; Yanagisawa, Makio; Bungo, Takashi; Makiguchi, Yuya
2017-07-01
In cetaceans, diving behavior immediately induces a change in blood circulation to favor flow to the brain and heart; this is achieved by intense vasoconstriction of the blood vessels that serve other organs. This blood circulation response is allied to a decrease in heart rate in order to optimize oxygen usage during diving. Vasoconstrictors are present in all mammals and stimulate the contraction of the smooth muscle in the walls of blood vessels. The most important of these vasoconstrictors are the hormones adrenaline (A), noradrenaline (NA), and angiotensin II (ANG II). At present, the contribution of these hormones to vasoconstriction during diving in cetaceans is unclear. To elucidate their possible roles, changes in serum levels of A, NA and ANG II were monitored together with heart rate in the Indo-Pacific bottlenose dolphin Tursiops aduncus during 90 and 180s dives. Both brief diving periods induced an increase in serum NA concentration and a decrease in heart rate; however, no changes were detected in serum levels of A or ANG II. These data indicate that NA may play a role in diving-induced vasoconstriction. Copyright © 2017 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Tabuchi, Yuichiro; Shiomi, Takeshi; Aoki, Osamu; Kubo, Norio; Shinohara, Kazuhiko
2010-01-01
Key challenges to the acceptance of polymer electrolyte membrane fuel cells (PEMFCs) for automobiles are the cost reduction and improvement in its power density for compactness. In order to get the solution, the further improvement in a fuel cell performance is required. In particular, under higher current density operation, water and heat transport in PEMFCs has considerable effects on the cell performance. In this study, the impact of heat and water transport on the cell performance under high current density was investigated by experimental evaluation of liquid water distribution and numerical validation. Liquid water distribution in MEA between rib and channel area is evaluated by neutron radiography. In order to neglect the effect of liquid water in gas channels and reactant species concentration distribution in the flow direction, the differential cell was used in this study. Experimental results suggested that liquid water under the channel was dramatically changed with rib/channel width. From the numerical study, it is found that the change of liquid water distribution was significantly affected by temperature distribution in MEA between rib and channel area. In addition, not only heat transport but also water transport through the membrane also significantly affected the cell performance under high current density operation.
Raack, J.; Herny, C.; Conway, S. J.; Balme, M. R.; Carpy, S.; Patel, M.
2017-12-01
Recently and presently active mass wasting features such as gullies and recurring slope lineae (RSL) are common on the surface of Mars, but their origin and triggering mechanisms are under intense debate. While several active mass wasting features have been linked to sublimation of CO2ice, dry granular flows (avalanches), or a combination of both effects, others have been more closely linked to liquid water or briny outflows (e.g. for RSL). However, liquid water on the surface of Mars is unstable under present-day low pressures and surface temperatures. Nevertheless, numerical modeling and remote sensing data have shown that maximum surface temperatures can exceed the frost point of water and that liquid water could exist on the surface of actual Mars in a transient state. But to explain the observed spatial extent of RSL and recent modification of gullies, it is estimated that relatively large amounts of liquid water are necessary. It is proving challenging to generate such quantities from the atmosphere. In this contribution we explore the potential effects of boiling water (boiling occurs at martian pressures slightly above the frost point of 273 K) on sediment transport. We will present the outcomes of a series of experiments under low surface and water temperatures (between 278 and 297 K, analogous to surface temperatures observed near RSL) and low pressures (between 8 and 11 mbar). We simulate sediment transport by boiling liquid water over a sloping bed of unconsolidated sediment. Our results reveal a suite of unusual and very reactive sediment transportation processes, which are not produced under terrestrial pressures. We will discuss the impact of these unusual sediment transport processes on estimates of water budgets for active mass wasting processes.
Energy Technology Data Exchange (ETDEWEB)
Javeri, V. [Gesellschaft fuer Anlagen- und Reaktorsicherheit (GRS) mbH, Koeln (Germany)
1995-03-01
After implementation of TOUGH2 at GRS in summer 91, it was first used to analyse the gas transport in a repository for the nuclear waste with negligible heat generation and to verify the results obtained with ECLIPSE/JAV 92/. Since the original version of TOUGH2 does not directly simulate the decay of radionuclide and the time dependent boundary conditions, it is not a appropriate tool to study the nuclide transport in a porous medium/PRU 87, PRU 91/. Hence, in this paper some modifications are proposed to study the nuclide transport under combined influence of natural convection diffusion, dispersion and time dependent boundary condition. Here, a single phase fluid with two liquid components is considered as in equation of state model for water and brine/PRU 91A/.
Transport studies of radon in limestone underlying houses
International Nuclear Information System (INIS)
Gammage, R.B.; Dudney, C.S.; Wilson, D.L.; Saultz, R.J.
1990-01-01
In hilly limestone terrains of the southern Appalachians, subterranean networks of solution cavities and fissures present circulatory systems facilitating convective and advective transport of radon-bearing gas. Evidence suggests that the primary driving forces for transport are aerostatic pressure differentials created by the difference between the underground and the outside air temperatures. Examples are presented of houses experiencing elevated indoor radon levels as a consequence of communicating with such subsurface transportation systems. The location of a house near the upper or lower end of a subterranean-circulatory system seems to produce amplification of indoor radon levels in winter or summer, respectively. The transport mechanism for radon-bearing air in karst and its impact on indoor radon need better understanding, both in regard to evaluating the geographical prevalence of the phenomenon and the induced spatial and temporal effects that are possible. This paper reports field studies made at houses in karst regions at Oak Ridge, Tennessee, and Huntsville, Alabama. A primary radon-transport mechanism is advocated of ascending or descending subsurface columns of air whose flows are largely driven by aerostatic pressure gradients created by the inground-outdoor air temperature differentials. 5 refs., 5 figs., 1 tab
Strategic planning for transportation under the NWPA
International Nuclear Information System (INIS)
Larson, D.; Miernyk, J.
1992-01-01
This paper reports that the western states have found strategic planning to be an effective approach for identifying activities, and the appropriate sequencing of activities, that should be undertaken in the development of a transportation system for shipping high-level waste and spent nuclear fuel to a repository or monitored retrievable storage (MRS) facility. The Western Interstate Energy Board's High-Level Radioactive Waste Committee works with the U.S. Department of Energy pursuant to a cooperative agreement on the development of a safe, publicly-acceptable transportation system. The Committee has developed a Strategic Plan and Schedule which: guides the scheduling and prioritization of the Committee's work; enhances understanding of the complex and interrelated activities that states believe should be undertaken in developing a transportation system for high-level radioactive materials; and provides states with an appropriate structure for evaluating DOE's responsiveness to state needs
Modeling sheet-flow sand transport under progressive surface waves
Kranenburg, Wouter
2013-01-01
In the near-shore zone, energetic sea waves generate sheet-flow sand transport. In present day coastal models, wave-induced sheet-flow sand transport rates are usually predicted with semi-empirical transport formulas, based on extensive research on this phenomenon in oscillatory flow tunnels.
Directory of Open Access Journals (Sweden)
Rui Hu
2016-10-01
Full Text Available The large nitrate transporter 1/peptide transporter family (NPF has been shown to transport diverse substrates, including nitrate, amino acids, peptides, phytohormones, and glucosinolates. However, the rice (Oryza sativa root-specific expressed member OsNPF7.2 has not been characterized. Here, our data show that OsNPF7.2 is a tonoplast localized low-affinity nitrate transporter, and affects rice growth under high nitrate supply. The expression analysis showed that OsNPF7.2 was mainly expressed in the elongation and maturation zones of roots, especially in the root sclerenchyma, cortex and stele. It was also induced by high concentrations of nitrate. Subcellular localization analysis showed that OsNPF7.2 was localized on the tonoplast of large and small vacuoles. Heterogenous expression in Xenopus laevis oocytes suggested that OsNPF7.2 was a low-affinity nitrate transporter. Knock-down of OsNPF7.2 retarded rice growth under high concentrations of nitrate. Therefore, we deduce that OsNPF7.2 plays a role in intracellular allocation of nitrate in roots, and thus influences rice growth under high nitrate supply.
A Transporter of Ibuprofen is Upregulated in MDCK I Cells under Hyperosmotic Culture Conditions
DEFF Research Database (Denmark)
Nielsen, Carsten Uhd; Rasmussen, Rune N; Mo, Junying
2016-01-01
Ibuprofen is a widely used drug. It has been identified as an inhibitor of several transporters, but it is not clear if ibuprofen is a substrate of any transporter itself. In the present work, we have characterized a transporter of ibuprofen, which is upregulated by hyperosmotic culture conditions...... in Madin-Darby canine kidney I (MDCK I) renal cells. [(3)H]-Ibuprofen uptake rate was measured in MDCK I cell cultured under normal (300 mOsm) and hyperosmotic (500 mOsm) conditions. Hyperosmotic conditions were obtained by supplementing urea, NaCl, mannitol, or raffinose to culture medium. The effect...... of increased osmolarity was investigated for different incubation times. [(3)H]-Ibuprofen uptake in MDCK I cells was upregulated by hyperosmotic culture condition, and was saturable with a Km value of 0.37 ± 0.08 μM and a Vmax of 233.1 ± 17.2 pmol· cm(-2)· min(-1). Racemic [(3)H]-ibuprofen uptake could...
An Eulerian two-phase flow model for sediment transport under realistic surface waves
Hsu, T. J.; Kim, Y.; Cheng, Z.; Chauchat, J.
2017-12-01
Wave-driven sediment transport is of major importance in driving beach morphology. However, the complex mechanisms associated with unsteadiness, free-surface effects, and wave-breaking turbulence have not been fully understood. Particularly, most existing models for sediment transport adopt bottom boundary layer approximation that mimics the flow condition in oscillating water tunnel (U-tube). However, it is well-known that there are key differences in sediment transport when comparing to large wave flume datasets, although the number of wave flume experiments are relatively limited regardless of its importance. Thus, a numerical model which can resolve the entire water column from the bottom boundary layer to the free surface can be a powerful tool. This study reports an on-going effort to better understand and quantify sediment transport under shoaling and breaking surface waves through the creation of open-source numerical models in the OpenFOAM framework. An Eulerian two-phase flow model, SedFoam (Cheng et al., 2017, Coastal Eng.) is fully coupled with a volume-of-fluid solver, interFoam/waves2Foam (Jacobsen et al., 2011, Int. J. Num. Fluid). The fully coupled model, named SedWaveFoam, regards the air and water phases as two immiscible fluids with the interfaces evolution resolved, and the sediment particles as dispersed phase. We carried out model-data comparisons with the large wave flume sheet flow data for nonbreaking waves reported by Dohmen-Janssen and Hanes (2002, J. Geophysical Res.) and good agreements were obtained for sediment concentration and net transport rate. By further simulating a case without free-surface (mimic U-tube condition), the effects of free-surface, most notably the boundary layer streaming effect on total transport, can be quantified.
Tupe, Rashmi Santosh; Agte, Vaishali Vilas
2010-02-01
The role of different water soluble vitamins in Zn metabolism beyond intestinal Zn absorption is poorly explored. Using Caco-2 cells, effects of different vitamins on intestinal Zn transport and their implications under oxidative stress (OS) were investigated. Cells were apically treated with Zn (25 muM) and vitamins (Folic acid (FA), Nicotinic acid (NA), Ascorbic acid (AA), riboflavin, thiamine, pyridoxine) for 60 min. The effect of most promising vitamins on zinc transport, antioxidant enzymes (Catalase, Glutathione peroxidase, and superoxide dismutase), and intracellular OS status (ROS generation and mitochondrial transmembrane potential) were investigated. OS was generated by tert-butyl hydro peroxide and results for each vitamin were compared with respective Zn containing controls with and without OS. Without OS, Zn transport was slightly enhanced in presence of NA, while it was significantly reduced by thiamine, riboflavin, and pyridoxine. Under OS, NA significantly (P vitamins. With Zn + FA + OS, enzyme activities decreased maximally, with twofold increase in 2',7'-dichlorofluorescin diacetate (DCF-DA) (P < 0.01) and lowering of rhodamine fluorescence (P < 0.05). In Zn + AA + OS, DCF-DA fluorescence increased (P < 0.05) but with NA, cellular enzymes, and antioxidant profile were improved. Results for the first time demonstrate advantageous effects of NA and deleterious consequences of FA with no effect by AA on Zn transport, especially under OS. These observed changes in the transport of Zn seem to have an impact on OS markers.
Furini, Cristiane R G; Behling, Jonny A K; Zinn, Carolina G; Zanini, Mara Lise; Assis Brasil, Eduardo; Pereira, Luiza Doro; Izquierdo, Ivan; de Carvalho Myskiw, Jociane
2017-05-30
Extinction is defined as the learned inhibition of retrieval and is the mainstay of exposure therapy, which is widely used to treat drug addiction, phobias and fear disorders. The psychostimulant, methylphenidate (MPH) is known to increase extracellular levels of noradrenaline and dopamine by blocking their reuptake and studies have demonstrated that MPH can modulate hippocampal physiology and/or functions including long-term potentiation (LTP), learning and memory. However, the influence of MPH on fear extinction memory has been insufficiently studied. Here we investigate the effect of MPH infused into the CA1 region of the hippocampus on extinction memory in animals normally incapable of showing contextual fear conditioning (CFC) extinction because of weak training, and the possible mechanisms through which it acts during this process. For this, male Wistar rats with infusion cannulae stereotaxically implanted in the CA1 region were submitted to a weak extinction protocol in a CFC apparatus. Animals that received intra-CA1 infusion of MPH (12.5μg/side) 20min before the extinction training (Ext Tr) expressed less freezing behavior than Veh-treated animals during both Ext Tr and extinction retention Test (Ext Test). Additionally, the administration of MPH+Timolol (1μg/side) or MPH+SCH23390 (1.5μg/side) intra-CA1 20min before the Ext Tr blocked the enhancing effect of the MPH on extinction learning. These results suggest that MPH in the CA1 region of the hippocampus is able to induce the consolidation of extinction memory and this process occurs through both β-adrenergic and D1/D5 dopaminergic receptors. Copyright © 2017 Elsevier B.V. All rights reserved.
Spent nuclear fuel system dynamic stability under normal conditions of transportation
Energy Technology Data Exchange (ETDEWEB)
Jiang, Hao; Wang, Jy-An John, E-mail: wangja@ornl.gov
2016-12-15
Highlights: • A conformational potential effect of fuel assembly contact interaction induced transient shock. • Complex vibration modes and vibration load intensity were observed from fuel assembly system. • The project was able to link the periodic transient shock to spent fuel fatigue strength reduction. - Abstract: In a horizontal layout of a spent nuclear fuel (SNF) assembly under normal conditions of transportation (NCT), the fuel assembly’s skeleton formed by guide tubes and spacer grids is the primary load bearing structure for carrying and transferring the vibration loads within an SNF assembly. Therefore, the integrity of guide tubes and spacer grids will dictate the vibration amplitude/intensity of the fuel assembly during transport, and must be considered when designing multipurpose purpose canister (MPC) for safe SNF transport. This paper investigates the SNF assembly deformation dynamics during normal vibration mode, as well as the transient shock mode inside the cask during NCT. Dynamic analyses were performed in the frequency domain to study frequency characteristic of the fuel assembly system and in the time domain to simulate the transient dynamic response of the fuel assembly. To further evaluate the intensity of contact interaction induced by the local contacts’ impact loading at the spacer grid, detailed models of the actual spring and dimples of the spacer grids were created. The impacts between the fuel rod and springs and dimples were simulated with a 20 g transient shock load. The associated contact interaction intensities, in terms of reaction forces, were estimated from the finite element analyses (FEA) results. The bending moment estimated from the resultant stress on the clad under 20 g transient shock can be used to define the loading in cyclic integrated reversible-bending fatigue tester (CIRFT) vibration testing for the equivalent condition. To estimate the damage potential of the transient shock to the SNF vibration
Directory of Open Access Journals (Sweden)
Isam T. Kadim
2010-01-01
Full Text Available The aim of this study was to determine the effects of road transportation during the hot season (36 oC and low voltage electrical stimulation on meat quality characteristics of Omani sheep. Twenty intact male sheep (1-year old were divided into two equal groups: 3 hrs transported or non-transported. The transported group was transferred to the slaughterhouse the day of slaughter in an open truck covering a distance of approximately 300 km. The non-transported group was kept in a lairage of a commercial slaughterhouse with ad libitum feed and water for 3 days prior to slaughter. Blood samples were collected from the animals before loading and prior to slaughter in order to assess their physiological response to stress in terms of hormonal levels. Fifty percent of the carcasses from each group were randomly assigned to low voltage (90 V at 20 min postmortem. Muscle ultimate pH, expressed juice, cooking loss percentage, WB-shear force value, sarcomere length, myofibrillar fragmentation index and colour L*, a*, b* were measured on samples from Longissimus dorsi muscles collected 24 hrs postmortem at 2-4 oC. The transported sheep had significantly (P<0.05 higher cortisol adrenaline, nor-adrenaline, and dopamine levels than the non-transported group. Muscles from electrically-stimulated carcasses had significantly (P<0.05 lower pH values, longer sarcomere length, lower shear force value, higher expressed juice, myofibrillar fragmentation index and L* values than those from non-stimulated ones. Transportation significantly influenced meat quality characteristics of the Longissimus dorsi muscle. Muscle ultimate pH and shear force values were significantly higher, while CIE L*, a*, b*, expressed juice and cooking loss were lower in transported than non-transported sheep. This study indicated that pre-slaughter transportation at high ambient temperatures can cause noticeable changes in muscle physiology in sheep. Nevertheless, meat quality of transported
Calorigenic effect of adrenaline in rats under conditions of restricted motor activity
Tomaszewska, L.; Kaciuba-Uscilko, H.; Kozlowski, S.
1980-01-01
In previous studies, it was demonstrated that long term restricted motor activity in rats induces a decrease in body weight, an increase in release of adrenaline, and a decrease in the release of noradrenaline with the urine, as well as a reduction in activity of the thymus gland and level of thyroxin in the blood. At the same time, a decrease was found in the internal body temperature that was accompanied by an increase in the rate of metabolism in the state of rest. An investigation is presented which attempts to clarify whether the calorigenic effect of adrenaline under conditions of increased metabolism in the period of immobility is exposed to changes.
This project investigated an innovative approach for transport of inorganic species under the influence of electric fields. This process, commonly known as electrokinetics uses low-level direct current (dc) electrical potential difference across a soil mass applied through inert...
Ferry, Barbara; Gifu, Elena-Patricia; Sandu, Ioana; Denoroy, Luc; Parrot, Sandrine
2014-03-01
Electrochemical methods are very often used to detect catecholamine and indolamine neurotransmitters separated by conventional reverse-phase high performance liquid chromatography (HPLC). The present paper presents the development of a chromatographic method to detect monoamines present in low-volume brain dialysis samples using a capillary column filled with sub-2μm particles. Several parameters (repeatability, linearity, accuracy, limit of detection) for this new ultrahigh performance liquid chromatography (UHPLC) method with electrochemical detection were examined after optimization of the analytical conditions. Noradrenaline, adrenaline, serotonin, dopamine and its metabolite 3-methoxytyramine were separated in 1μL of injected sample volume; they were detected above concentrations of 0.5-1nmol/L, with 2.1-9.5% accuracy and intra-assay repeatability equal to or less than 6%. The final method was applied to very low volume dialysates from rat brain containing monoamine traces. The study demonstrates that capillary UHPLC with electrochemical detection is suitable for monitoring dialysate monoamines collected at high sampling rate. Copyright © 2014 Elsevier B.V. All rights reserved.
Cremer, Clemens; Neuweiler, Insa; Bechtold, Michel
2013-04-01
Understanding transport of solutes/contaminants through unsaturated soil in the shallow subsurface is vital to assess groundwater quality, nutrient cycling or to plan remediation projects. Alternating precipitation and evaporation conditions causing upward and downward flux with differing flow paths, changes in saturation and related structural heterogeneity make the description of transport in the unsaturated zone near the soil-surface a complex problem. Preferential flow paths strongly depend, among other things, on the saturation of a medium. Recent studies (e.g. Bechtold et al., 2011) showed lateral flow and solute transport during evaporation conditions (upward flux) in vertically layered sand columns. Results revealed that during evaporation water and solute are redistributed laterally from coarse to fine media deeper in the soil, and towards zones of lowest hydraulic head near to the soil surface. These zones at the surface can be coarse or fine grained depending on saturation status and evaporation flux. However, if boundary conditions are reversed and precipitation is applied, the flow field is not reversed in the same manner, resulting in entirely different transport patterns for downward and upward flow. Therefore, considering net-flow rates alone is misleading when describing transport in the shallow unsaturated zone. In this contribution, we analyze transport of a solute in the shallow subsurface to assess effects resulting from the superposition of heterogeneous soil structures and dynamic flow conditions on various spatial scales. Two-dimensional numerical simulations of unsaturated flow and transport in heterogeneous porous media under changing boundary conditions are carried out using a finite-volume code coupled to a particle tracking algorithm to quantify solute transport and leaching rates. In order to validate numerical simulations, results are qualitatively compared to those of a physical experiment (Bechtold et al., 2011). Numerical
International Nuclear Information System (INIS)
Zoller, P.
1976-07-01
At first survey is given about existing knowledge of the behaviour of caesium and strontium fission product transport in coated particles. In order to describe the complicated fission product transport mechanisms under irradiation conditions a suitable calculating model (SLIPPER) is taken over and modified to the special problems of an irradiation experiment. Fundamentally, the fission product transport is represented by the two contributions of diffusion and recoil, at which the diffusion is described by effective diffusion coefficients. In difference of that the possibility of a two-phase-diffusion is examined for the Cs diffusion in the fuel kernel. The model application on measuring results from irradiation experiments of KFA-Juelich and Mol-Belgien allowed the explanation from the characteristic of fission product transport in coated particles under irradiation conditions and produced effective diffusion coefficients for the fission products Cs and Sr. (orig.) [de
Spent fuel transport cask thermal evaluation under normal and accident conditions
Energy Technology Data Exchange (ETDEWEB)
Pugliese, G. [Department of Mechanical, Nuclear and Production Engineering, University of Pisa, Via Diotisalvi, no 2-56126 Pisa (Italy); Lo Frano, R., E-mail: rosa.lofrano@ing.unipi.i [Department of Mechanical, Nuclear and Production Engineering, University of Pisa, Via Diotisalvi, no 2-56126 Pisa (Italy); Forasassi, G. [Department of Mechanical, Nuclear and Production Engineering, University of Pisa, Via Diotisalvi, no 2-56126 Pisa (Italy)
2010-06-15
The casks used for transport of nuclear materials, especially the spent fuel element (SPE), must be designed according to rigorous acceptance criteria and standards requirements, e.g. the International Atomic Energy Agency ones, in order to provide protection to people and environment against radiation exposure particularly in a severe accident scenario. The aim of this work was the evaluation of the integrity of a spent fuel cask under both normal and accident scenarios transport conditions, such as impact and rigorous fire events, in according to the IAEA accident test requirements. The thermal behaviour and the temperatures distribution of a Light Water Reactor (LWR) spent fuel transport cask are presented in this paper, especially with reference to the Italian cask designed by AGN, which was characterized by a cylindrical body, with water or air inside the internal cavity, and two lateral shock absorbers. Using the finite element code ANSYS a series of thermal analyses (steady-state and transient thermal analyses) were carried out in order to obtain the maximum fuel temperature and the temperatures field in the body of the cask, both in normal and in accidents scenario, considering all the heat transfer modes between the cask and the external environment (fire in the test or air in the normal conditions) as well as inside the cask itself. In order to follow the standards requirements, the thermal analyses in accidents scenarios were also performed adopting a deformed shape of the shock absorbers to simulate the mechanical effects of a previous IAEA 9 m drop test event. Impact tests on scale models of the shock absorbers have already been conducted in the past at the Department of Mechanical, Nuclear and Production Engineering, University of Pisa, in the '80s. The obtained results, used for possible new licensing approval purposes by the Italian competent Authority of the cask for PWR spent fuel cask transport by the Italian competent Authority, are
Nagy, Bernadett; Szabó, István; Csetényi, Bettina; Hormay, Edina; Papp, Szilárd; Keresztes, Dóra; Karádi, Zoltán
2014-01-16
The mediodorsal prefrontal cortex (mdPFC), as part of the forebrain glucose-monitoring (GM) system, plays important role in several regulatory processes to control the internal state of the organism and to initiate behavioral outputs accordingly. Little is known, however, about the neurochemical sensitivity of neurons located in this area. Substantial evidence indicates that the locus ceruleus - noradrenaline (NA) projection system and the nucleus basalis magnocellularis - cholinergic projection system regulate behavioral state and state dependent processing of sensory information, various cognitive functions already associated with the mdPFC. The main goal of the present study was to examine noradrenergic and cholinergic responsiveness of glucose-monitoring and glucose-insensitive (GIS) neurons in the mediodorsal prefrontal cortex. One fifth of the neurons tested changed in firing rate to microelectrophoretically applied NA. Responsiveness of the GM cells to this catecholamine proved to be significantly higher than that of the GIS units. Microiontophoretic application of acetylcholine (Ach) resulted in activity changes (predominantly facilitation) of more than 40% of the mdPFC neurons. Proportion of Ach sensitive units among the GM and the GIS neurons was found to be similar. The glucose-monitoring neurons of the mdPFC and their distinct NA and remarkable Ach sensitivity are suggested to be of particular significance in prefrontal control of adaptive behaviors. © 2013 Published by Elsevier B.V.
Assessment of applications of transport models on regional scale solute transport
Guo, Z.; Fogg, G. E.; Henri, C.; Pauloo, R.
2017-12-01
Regional scale transport models are needed to support the long-term evaluation of groundwater quality and to develop management strategies aiming to prevent serious groundwater degradation. The purpose of this study is to evaluate the capacity of previously-developed upscaling approaches to accurately describe main solute transport processes including the capture of late-time tails under changing boundary conditions. Advective-dispersive contaminant transport in a 3D heterogeneous domain was simulated and used as a reference solution. Equivalent transport under homogeneous flow conditions were then evaluated applying the Multi-Rate Mass Transfer (MRMT) model. The random walk particle tracking method was used for both heterogeneous and homogeneous-MRMT scenarios under steady state and transient conditions. The results indicate that the MRMT model can capture the tails satisfactorily for plume transported with ambient steady-state flow field. However, when boundary conditions change, the mass transfer model calibrated for transport under steady-state conditions cannot accurately reproduce the tailing effect observed for the heterogeneous scenario. The deteriorating impact of transient boundary conditions on the upscaled model is more significant for regions where flow fields are dramatically affected, highlighting the poor applicability of the MRMT approach for complex field settings. Accurately simulating mass in both mobile and immobile zones is critical to represent the transport process under transient flow conditions and will be the future focus of our study.
Bacteria transport and retention in intact calcareous soil columns under saturated flow conditions
Directory of Open Access Journals (Sweden)
Farrokhian Firouzi Ahmad
2015-06-01
Full Text Available Study of bacterial transport and retention in soil is important for various environmental applications such as groundwater contamination and bioremediation of soil and water. The main objective of this research was to quantitatively assess bacterial transport and deposition under saturated conditions in calcareous soil. A series of leaching experiments was conducted on two undisturbed soil columns. Breakthrough curves of Pseudomonas fluorescens and Cl were measured. After the leaching experiment, spatial distribution of bacteria retention in the soil columns was determined. The HYDRUS-1D one- and two-site kinetic models were used to predict the transport and deposition of bacteria in soil. The results indicated that the two-site model fits the observed data better than one-site kinetic model. Bacteria interaction with the soil of kinetic site 1 revealed relatively fast attachment and slow detachment, whereas attachment to and detachment of bacteria from kinetic site 2 was fast. Fast attachment and slow detachment of site 1 can be attributed to soil calcium carbonate that has favorable attachment sites for bacteria. The detachment rate was less than 0.02 of the attachment rate, indicating irreversible attachment of bacteria. High reduction rate of bacteria was also attributed to soil calcium carbonate.
[Selenium uptake and transport of rice under different Se-enriched natural soils].
Jiang, Chao-qiang; Shen, Jia; Zu, Chao-long
2015-03-01
In this study, a pot experiment was conducted with "Wandao 205" as test materials to investigate Se uptake and translocation in rice under different Se concentrations (0.5, 1.0, and 1.5 mg . kg-1). Results showed that there was no significant change in rice yield when Se concentration in soil was lower than 1.5 mg . kg-1. Significant linear correlations existed between Se concentration in soil and different rice plant tissues. Se concentration in rice plant followed the order of root > straw > grain. Se concentration in different rice grain fractions followed the order of bran > polished rice > hull. The root absorption index of Se was more than 1.86, suggest that the rice could absorpt Se from soil effectively. However, the transport and accumulation of Se in seeds from Se-enriched soil was relatively constant. The Se transport index in seeds was between 0.53 and 0.59. Soil Se concentration within the range of 0.5 to 1.0 mg . kg-1 could produce Se-enriched rice, which might be enough for human requirement of 60-80 µg . d-1 Se. However, polished rice at high-Se treatment (1.5 mg . kg-1) exceeded the maximum standard limit of Se (0.3 mg . kg-1) for cereals in China. These results suggested that we could produce Se-enriched rice under soil Se concentration in the range of 0.5 to 1.0 mg . kg-1 without spraying Se fertilizer, thus reducing the cost and avoiding soil and water pollution caused by exogenous Se.
International Nuclear Information System (INIS)
Alter, U.; Mielke, H.G.; Wehner, G.
1983-01-01
According to the Atomic Act, article 9a, paragraph 1, the licensees of nuclear power plants in the Federal Republic of Germany are obliged to provide for the management of radioactive wastes resulting from the operation of these plants. Concerning the provisions to be made for the management of such wastes, two concepts are discussed: nuclear reprocessing and final waste disposal center (Nukleares Entsorgungszentrum, NEZ); and the integrated spent fuel and waste management concept (Integriertes Entsorgungskonzept, IEK). Unlike the NEZ, the IEK-concept may have different sites for the following fuel cycle facilities: intermediate spent fuel storage, reprocessing, waste conditioning and final disposal, and uranium and plutonium fuel element fabrication facilities. The fundamental differences of the pertinent transports are presented. Transport scenarios expected under the two alternatives NEZ and IEK have been elaborated for the purpose of a data collection covering the following aspects: materials to be shipped, number of packages shipped, number of packages shipped per transport, transport by rail or by road, transport routes and distances, and duration of transports
Bijlsma, Elisabeth Y; Chan, Johnny S W; Olivier, Berend; Veening, Jan G; Millan, Mark J; Waldinger, Marcel D; Oosting, Ronald S
2014-06-01
Antidepressant-induced sexual dysfunction adversely affects the quality of life of antidepressant users and reduces compliance with treatment. Animal models provide an instructive approach for examining potential sexual side effects of novel drugs. This review discusses the stability and reproducibility of our standardized test procedure that assesses the acute, subchronic and chronic effects of psychoactive compounds in a 30 minute mating test. In addition, we present an overview of the effects of several different (putative) antidepressants on male rat sexual behavior, as tested in our standardized test procedure. By comparing the effects of these mechanistically distinct antidepressants (paroxetine, venlafaxine, bupropion, buspirone, DOV 216,303 and S32006), this review discusses the putative mechanism underlying sexual side effects of antidepressants and their normalization. This review shows that sexual behavior is mainly inhibited by antidepressants that increase serotonin neurotransmission via blockade of serotonin transporters, while those that mainly increase the levels of dopamine and noradrenaline are devoid of sexual side effects. Those sexual disturbances cannot be normalized by simultaneously increasing noradrenaline neurotransmission, but are normalized by increasing both noradrenaline and dopamine neurotransmission. Therefore, it is hypothesized that the sexual side effects of selective serotonin reuptake inhibitors may be mediated by their inhibitory effects on dopamine signaling in sex brain circuits. Clinical development of novel antidepressants should therefore focus on compounds that simultaneously increase both serotonin and dopamine signaling. © 2013 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Alikaev, V.V.; Borshegovskij, A.A.; Chistyakov, V.V.
2001-01-01
'Studies of the Disruption Prevention by ECRH at Plasma Current Rise Stage in Limiter Discharges' - Studies of disruption prevention by means of ECRH in T-10 at the plasma current rise phase in limiter discharges with circular plasma cross-section were performed. Reliable disruption prevention by ECRH at HF power (P HF ) min level equal to 20% of ohmic heating power P OH was demonstrated. m/n=2/1 mode MHD-activity developed before disruption (with characteristic time ∼ 120 ms) can be considered as disruption precursor and can be used in a feedback system. 'Possibility of an Internal Transport Barrier Producing under Dominating Electron Transport in the T-10 Tokamak' - The reversed shear experiments were carried out on T-10 at the HF power up to 1MW. The reversed shear in the core was produced by on-axis ECCD in direction opposite to the plasma current. There are no obvious signs of Internal Transport Barriers formation under condition when high-k turbulence determines the electron transport. (author)
Hilpert, Markus; Johnson, William P.
2018-01-01
We used a recently developed simple mathematical network model to upscale pore-scale colloid transport information determined under unfavorable attachment conditions. Classical log-linear and nonmonotonic retention profiles, both well-reported under favorable and unfavorable attachment conditions, respectively, emerged from our upscaling. The primary attribute of the network is colloid transfer between bulk pore fluid, the near-surface fluid domain (NSFD), and attachment (treated as irreversible). The network model accounts for colloid transfer to the NSFD of downgradient grains and for reentrainment to bulk pore fluid via diffusion or via expulsion at rear flow stagnation zones (RFSZs). The model describes colloid transport by a sequence of random trials in a one-dimensional (1-D) network of Happel cells, which contain a grain and a pore. Using combinatorial analysis that capitalizes on the binomial coefficient, we derived from the pore-scale information the theoretical residence time distribution of colloids in the network. The transition from log-linear to nonmonotonic retention profiles occurs when the conditions underlying classical filtration theory are not fulfilled, i.e., when an NSFD colloid population is maintained. Then, nonmonotonic retention profiles result potentially both for attached and NSFD colloids. The concentration maxima shift downgradient depending on specific parameter choice. The concentration maxima were also shown to shift downgradient temporally (with continued elution) under conditions where attachment is negligible, explaining experimentally observed downgradient transport of retained concentration maxima of adhesion-deficient bacteria. For the case of zero reentrainment, we develop closed-form, analytical expressions for the shape, and the maximum of the colloid retention profile.
Energy Technology Data Exchange (ETDEWEB)
Dupouy, M.D.; Camel, D.; Mazille, J.E. [CEA Centre d' Etudes et de Recherches sur les Materiaux, 38 - Grenoble (France); Hugon, I. [Lab. de Metallographie, DCC/DTE/SIM, CEA Valrho (France)
2000-07-01
The columnar-equiaxed transition under diffusive transport conditions was studied in microgravity (EUROMIR95 and spacelab-LMS96) by solidifying four Al-4wt%Cu alloys refined at different levels, with a constant cooling rate (1 K/min), both under nearly isothermal conditions and under a decreasing temperature gradient. Isothermal samples showed a homogeneous equiaxed structure with no fading of the refiner efficiency. Gradient samples revealed a continuous transition consisting of an orientation of the microsegregation parallel to the solidification direction, without any grain selection effect. For comparison, ground samples evidence the influence of the motion of both refiner particles and growing equiaxed grains. (orig.)
From conservative to reactive transport under diffusion-controlled conditions
Babey, Tristan; de Dreuzy, Jean-Raynald; Ginn, Timothy R.
2016-05-01
We assess the possibility to use conservative transport information, such as that contained in transit time distributions, breakthrough curves and tracer tests, to predict nonlinear fluid-rock interactions in fracture/matrix or mobile/immobile conditions. Reference simulated data are given by conservative and reactive transport simulations in several diffusive porosity structures differing by their topological organization. Reactions includes nonlinear kinetically controlled dissolution and desorption. Effective Multi-Rate Mass Transfer models (MRMT) are calibrated solely on conservative transport information without pore topology information and provide concentration distributions on which effective reaction rates are estimated. Reference simulated reaction rates and effective reaction rates evaluated by MRMT are compared, as well as characteristic desorption and dissolution times. Although not exactly equal, these indicators remain very close whatever the porous structure, differing at most by 0.6% and 10% for desorption and dissolution. At early times, this close agreement arises from the fine characterization of the diffusive porosity close to the mobile zone that controls fast mobile-diffusive exchanges. At intermediate to late times, concentration gradients are strongly reduced by diffusion, and reactivity can be captured by a very limited number of rates. We conclude that effective models calibrated solely on conservative transport information like MRMT can accurately estimate monocomponent kinetically controlled nonlinear fluid-rock interactions. Their relevance might extend to more advanced biogeochemical reactions because of the good characterization of conservative concentration distributions, even by parsimonious models (e.g., MRMT with 3-5 rates). We propose a methodology to estimate reactive transport from conservative transport in mobile-immobile conditions.
Energy Technology Data Exchange (ETDEWEB)
Schalte, Gereon; Waning, Christian; Rossaint, Rolf; Mahnken, Andreas H. [University Hospital, RWTH Aachen, Aachen, (Germany); Henzler, Dietrich [Dalhousie University, Queen Elisabeth II Health Sciences Center, Halifax (Canada); Tacke, Josef [Interventional Radiology, Klinikum Passau, Passau (Germany)
2010-12-15
To investigate the effects of hepatic radiofrequency ablation (RFA) in patients with malignant liver disease with respect to inflammation activation and stress response. In an observational trial, we investigated the physiologic parameters of 17 patients (20 interventions) who underwent percutaneous RFA under general anesthesia after applying total intravenous anesthesia. TNF{alpha}, IL-6, IL-8, IL-10, adrenaline and noradrenaline, liver enzymes, lactate and creatine kinase were determined pre-interventionally after induction of anesthesia (T1), 90 minutes after initiation of RFA (T2), immediately after the conclusion of the procedure (T3), and 24 hours after the procedure (T4). A significant increase in body temperature (p < 0.001), and mean arterial pressure (p = 0.001) were measured intraoperatively (T2) and the day after the procedure (T4). Increased levels of IL-6 were measured at T3 and T4 (p = 0.001). IL-10 increased immediately after the procedure (T3; p = 0.007). IL-6 levels correlated well with the total energy applied ({gamma} = 0.837). Significant increases in the levels of adrenaline and noradrenaline were present at T3 and T4 (p < 0.001). The RFA-induced destruction of hepatic tissue was associated with increased levels of AST, ALT, GLDH and LDH. Percutaneous RFA of hepatic malignancies causes an inflammatory and endocrine activation, similar to the systemic inflammatory response syndrome. These effects have to be taken in account when dealing with patients susceptible to sepsis or multi-organ failure
International Nuclear Information System (INIS)
Schalte, Gereon; Waning, Christian; Rossaint, Rolf; Mahnken, Andreas H.; Henzler, Dietrich; Tacke, Josef
2010-01-01
To investigate the effects of hepatic radiofrequency ablation (RFA) in patients with malignant liver disease with respect to inflammation activation and stress response. In an observational trial, we investigated the physiologic parameters of 17 patients (20 interventions) who underwent percutaneous RFA under general anesthesia after applying total intravenous anesthesia. TNFα, IL-6, IL-8, IL-10, adrenaline and noradrenaline, liver enzymes, lactate and creatine kinase were determined pre-interventionally after induction of anesthesia (T1), 90 minutes after initiation of RFA (T2), immediately after the conclusion of the procedure (T3), and 24 hours after the procedure (T4). A significant increase in body temperature (p < 0.001), and mean arterial pressure (p = 0.001) were measured intraoperatively (T2) and the day after the procedure (T4). Increased levels of IL-6 were measured at T3 and T4 (p = 0.001). IL-10 increased immediately after the procedure (T3; p = 0.007). IL-6 levels correlated well with the total energy applied (γ = 0.837). Significant increases in the levels of adrenaline and noradrenaline were present at T3 and T4 (p < 0.001). The RFA-induced destruction of hepatic tissue was associated with increased levels of AST, ALT, GLDH and LDH. Percutaneous RFA of hepatic malignancies causes an inflammatory and endocrine activation, similar to the systemic inflammatory response syndrome. These effects have to be taken in account when dealing with patients susceptible to sepsis or multi-organ failure
Safety analysis of spent fuel transport and storage casks under extreme impact conditions
International Nuclear Information System (INIS)
Wolff, D.; Wieser, G.; Ballheimer, V.; Voelzke, H.; Droste, B.
2005-01-01
Full text: Worldwide the security of transport and storage of spent fuel with respect to terrorism threats is a matter of concern. In Germany a spent nuclear fuel management program was developed by the government including a new concept of dry on-site interim storage instead of centralized interim storage. In order to minimize transports of spent fuel casks between nuclear power plants, reprocessing plants and central storage facilities, the operators of NPPs have to erect and to use interim storage facilities for spent nuclear fuel on the site or in the vicinity of nuclear power plants. Up to now, 11 on-site interim storage buildings, one storage tunnel and 4 on-site interim storage areas (preliminary cask storage till the on-site interim storage building is completed) have been licensed at 12 nuclear power plant sites. Inside the interim storage buildings the casks are kept in upright position, whereas at the preliminary interim storage areas horizontal storage of the casks on concrete slabs is used and each cask is covered by concrete elements. Storage buildings and concrete elements are designed only for gamma and neutron radiation shielding reasons and as weather protection. Therefore the security of spent fuel inside a dual purpose transport and storage cask depends on the inherent safety of the cask itself. For nearly three decades BAM has been investigating cask safety under severe accident conditions like drop tests from more than 9 m onto different targets and without impact limiters as well as artificially damaged prototype casks. Since the terror attacks of 11 September 2001 the determination of casks' inherent safety also under extreme impact conditions due to terrorist attacks has been of our increasing interest. With respect to spent fuel storage one of the most critical scenarios of a terrorist attack for a cask is the centric impact of a dynamic load onto the lid-seal-system caused e.g. by direct aircraft crash or its engine as well as by a
James, Antoni W; Nachiappan, Vasanthi
2014-01-01
In the current study, when phosphate transporters pho88 and pho86 were knocked out they resulted in significant accumulation (84% and 43%) of triacylglycerol (TAG) during phosphate starvation. However in the presence of phosphate, TAG accumulation was only around 45% in both pho88 and pho86 mutant cells. These observations were confirmed by radio-labeling, fluorescent microscope and RT-PCR studies. The TAG synthesizing genes encoding for acyltransferases namely LRO1 and DGA1 were up regulated. This is the first report for accumulation of TAG in pho88Δ and pho86Δ cells under phosphate starvation conditions. Copyright © 2013. Published by Elsevier Ltd.
Molecular Imaging of Transporters with Positron Emission Tomography
Antoni, Gunnar; Sörensen, Jens; Hall, Håkan
Positron emission tomography (PET) visualization of brain components in vivo is a rapidly growing field. Molecular imaging with PET is also increasingly used in drug development, especially for the determination of drug receptor interaction for CNS-active drugs. This gives the opportunity to relate clinical efficacy to per cent receptor occupancy of a drug on a certain targeted receptor and to relate drug pharmacokinetics in plasma to interaction with target protein. In the present review we will focus on the study of transporters, such as the monoamine transporters, the P-glycoprotein (Pgp) transporter, the vesicular monoamine transporter type 2, and the glucose transporter using PET radioligands. Neurotransmitter transporters are presynaptically located and in vivo imaging using PET can therefore be used for the determination of the density of afferent neurons. Several promising PET ligands for the noradrenaline transporter (NET) have been labeled and evaluated in vivo including in man, but a really useful PET ligand for NET still remains to be identified. The most promising tracer to date is (S,S)-[18F]FMeNER-D2. The in vivo visualization of the dopamine transporter (DAT) may give clues in the evaluation of conditions related to dopamine, such as Parkinson's disease and drug abuse. The first PET radioligands based on cocaine were not selective, but more recently several selective tracers such as [11C]PE2I have been characterized and shown to be suitable as PET radioligands. Although there are a large number of serotonin transporter inhibitors used today as SSRIs, it was not until very recently, when [11C]McN5652 was synthesized, that this transporter was studied using PET. New candidates as PET radioligands for the SERT have subsequently been developed and [11C]DASB and [11C]MADAM and their analogues are today the most promising ligands. The existing radioligands for Pgp transporters seem to be suitable tools for the study of both peripheral and central drug
Insulin facilitates transport of macromolecules and nutrients to muscles
DEFF Research Database (Denmark)
Christensen, N J; Hilsted, J
1993-01-01
We previously showed that intravenous insulin increased plasma noradrenaline during euglycemia and without concomitant changes in plasma adrenaline. Insulin decreased plasma volume and increased the fractional escape rate of albumin from plasma. In normal subjects, oral glucose increased heart ra...... the blood to the extracellular space after food intake. This process may be greatly disturbed in insulin-dependent diabetic patients....
Electrokinetic transport of aerobic microorganisms under low-strength electric fields.
Maillacheruvu, Krishnanand Y; Chinchoud, Preethi R
2011-01-01
To investigate the feasibility of utilizing low strength electric fields to transport commonly available mixed cultures such as those from an activated sludge process, bench scale batch reactor studies were conducted in sand and sandy loam soils. A readily biodegradable substrate, dextrose, was used to test the activity of the transported microorganisms. Electric field strengths of 7V, 10.5V, and 14V were used. Results from this investigation showed that an electric field strength of 0.46 Volts per cm was sufficient to transport activated sludge microorganisms across a sandy loam soil across a distance of about 8 cm in 72 h. More importantly, the electrokinetically transported microbial culture remained active and viable after the transport process and was biodegrade 44% of the dextrose in the soil medium. Electrokinetic treatment without microorganisms resulted in removal of 37% and the absence of any treatment yielded a removal of about 15%.
DEFF Research Database (Denmark)
Merrywest, Simon D; McDearmid, Jonathan R; Kjaerulff, Ole
2003-01-01
Noradrenaline (NA) is a potent modulator of locomotion in many vertebrate nervous systems. When Xenopus tadpoles swim, waves of motor neuron activity alternate across the body and propagate along it with a brief rostro-caudal delay (RC-delay) between segments. We have now investigated the mechani......Noradrenaline (NA) is a potent modulator of locomotion in many vertebrate nervous systems. When Xenopus tadpoles swim, waves of motor neuron activity alternate across the body and propagate along it with a brief rostro-caudal delay (RC-delay) between segments. We have now investigated...... might promote postinhibitory rebound firing. The synaptic inputs during swimming were simulated using a sustained positive current, superimposed upon which were brief negative currents. When these conditions were held constant NA enhanced the probability of rebound firing--indicating a direct effect...
International Nuclear Information System (INIS)
Park, Jong Woon
2010-01-01
This paper provides a computational fluid dynamic (CFD) analysis method on the evaluation of debris transport under emergency recirculation mode after loss of coolant accident of a nuclear power plant. Three dimensional reactor building floor geometrical model is constructed including flow obstacles larger than 6 inches such as mechanical components and equipments and considering various inlet flow paths from the upper reactor building such as break and spray flow. In the modeling of the inlet flows from the upper floors, effect of gravitational force was also reflected. For the precision of the analysis, 3 millions of tetrahedral-shaped meshes were generated. Reference calculation showed physically reasonable results. Sensitivity studies for mesh type and turbulence model showed very similar results to the reference case. This study provides useful information on the application of CFD to the evaluation of debris transport fraction for the design of new emergency sump filters. (orig.)
Ultra High Intensity laser produced fast electron transport in under-dense and over-dense matter
International Nuclear Information System (INIS)
Manclossi, Mauro
2006-01-01
This thesis is related to inertial fusion research, and particularly concerns the approach to fast ignition, which is based on the use of ultra-intense laser pulses to ignite the thermonuclear fuel. Until now, the feasibility of this scheme has not been proven and depends on many fundamental aspects of the underlying physics, which are not yet fully understood and which are also very far from controls. The main purpose of this thesis is the experimental study of transport processes in the material over-dense (solid) and under-dense (gas jet) of a beam of fast electrons produced by pulse laser at a intensity of some 10 19 Wcm -2 . (author)
Xie, Xiujun; Gu, Wenhui; Gao, Shan; Lu, Shan; Li, Jian; Pan, Guanghua; Wang, Guangce; Shen, Songdong
2013-01-01
The xanthophyll cycle (Xc), which involves violaxanthin de-epoxidase (VDE) and the zeaxanthin epoxidase (ZEP), is one of the most rapid and efficient responses of plant and algae to high irradiance. High light intensity can activate VDE to convert violaxanthin (Vx) to zeaxanthin (Zx) via antheraxanthin (Ax). However, it remains unclear whether VDE remains active under low light or dark conditions when there is no significant accumulation of Ax and Zx, and if so, how the ΔpH required for activation of VDE is built. In this study, we used salicylaldoxime (SA) to inhibit ZEP activity in the intertidal macro-algae Ulva sp. (Ulvales, Chlorophyta) and then characterized VDE under low light and dark conditions with various metabolic inhibitors. With inhibition of ZEP by SA, VDE remained active under low light and dark conditions, as indicated by large accumulations of Ax and Zx at the expense of Vx. When PSII-mediated linear electron transport systems were completely inhibited by SA and DCMU, alternative electron transport systems (i.e., cyclic electron transport and chlororespiration) could maintain VDE activity. Furthermore, accumulations of Ax and Zx decreased significantly when SA, DCMU, or DBMIB together with an inhibitor of chlororespiration (i.e., propyl gallate (PG)) were applied to Ulva sp. This result suggests that chlororespiration not only participates in the build-up of the necessary ΔpH, but that it also possibly influences VDE activity indirectly by diminishing the oxygen level in the chloroplast.
Directory of Open Access Journals (Sweden)
Xiujun Xie
Full Text Available The xanthophyll cycle (Xc, which involves violaxanthin de-epoxidase (VDE and the zeaxanthin epoxidase (ZEP, is one of the most rapid and efficient responses of plant and algae to high irradiance. High light intensity can activate VDE to convert violaxanthin (Vx to zeaxanthin (Zx via antheraxanthin (Ax. However, it remains unclear whether VDE remains active under low light or dark conditions when there is no significant accumulation of Ax and Zx, and if so, how the ΔpH required for activation of VDE is built. In this study, we used salicylaldoxime (SA to inhibit ZEP activity in the intertidal macro-algae Ulva sp. (Ulvales, Chlorophyta and then characterized VDE under low light and dark conditions with various metabolic inhibitors. With inhibition of ZEP by SA, VDE remained active under low light and dark conditions, as indicated by large accumulations of Ax and Zx at the expense of Vx. When PSII-mediated linear electron transport systems were completely inhibited by SA and DCMU, alternative electron transport systems (i.e., cyclic electron transport and chlororespiration could maintain VDE activity. Furthermore, accumulations of Ax and Zx decreased significantly when SA, DCMU, or DBMIB together with an inhibitor of chlororespiration (i.e., propyl gallate (PG were applied to Ulva sp. This result suggests that chlororespiration not only participates in the build-up of the necessary ΔpH, but that it also possibly influences VDE activity indirectly by diminishing the oxygen level in the chloroplast.
Mechanistic logic underlying the axonal transport of cytosolic proteins
Scott, David A.; Das, Utpal; Tang, Yong; Roy, Subhojit
2011-01-01
Proteins vital to presynaptic function are synthesized in the neuronal perikarya and delivered into synapses via two modes of axonal transport. While membrane-anchoring proteins are conveyed in fast axonal transport via motor-driven vesicles, cytosolic proteins travel in slow axonal transport; via mechanisms that are poorly understood. We found that in cultured axons, populations of cytosolic proteins tagged to photoactivable-GFP (PA-GFP) move with a slow motor-dependent anterograde bias; distinct from vesicular-trafficking or diffusion of untagged PA-GFP. The overall bias is likely generated by an intricate particle-kinetics involving transient assembly and short-range vectorial spurts. In-vivo biochemical studies reveal that cytosolic proteins are organized into higher-order structures within axon-enriched fractions that are largely segregated from vesicles. Data-driven biophysical modeling best predicts a scenario where soluble molecules dynamically assemble into mobile supra-molecular structures. We propose a model where cytosolic proteins are transported by dynamically assembling into multi-protein complexes that are directly/indirectly conveyed by motors. PMID:21555071
DEFF Research Database (Denmark)
Haas, Henning de; Søndergaard, Mads
2009-01-01
I denne artikel sættes fokus på bæredygtighed og transport. Baggrunden for artiklen er en undersøgelse af status for bæredygtig transport i et antal danske virksomheder i samarbejde med DHL. Indledningen giver en baggrund for fokus på bæredygtighed, efterfølgende sættes der fokus på "Green SCM......" for at afklare hvad det indeholder, definitioner mv. Dette er udgangspunktet for en præsentation af resultaterne fra undersøgelsen af bæredygtig transport. Undersøgelsen opsummeres og leder frem til en række implikationer for henholdsvis kunder (transportkøberne) og transportleverandørerne....
Electronic transport in Thue-Morse gapped graphene superlattice under applied bias
Wang, Mingjing; Zhang, Hongmei; Liu, De
2018-04-01
We investigate theoretically the electronic transport properties of Thue-Morse gapped graphene superlattice under an applied electric field. The results indicate that the combined effect of the band gap and the applied bias breaks the angular symmetry of the transmission coefficient. The zero-averaged wave-number gap can be greatly modulated by the band gap and the applied bias, but its position is robust against change of the band gap. Moreover, the conductance and the Fano factor are strongly dependent not only on the Fermi energy but also on the band gap and the applied bias. In the vicinity of the new Dirac point, the minimum value of the conductance obviously decreases and the Fano factor gradually forms a Poissonian value plateau with increasing of the band gap.
Price Analysis of Railway Freight Transport under Marketing Mechanism
Shi, Ying; Fang, Xiaoping; Chen, Zhiya
Regarding the problems in the reform of the railway tariff system and the pricing of the transport, by means of assaying the influence of the price elasticity on the artifice used for price, this article proposed multiple regressive model which analyzed price elasticity quantitatively. This model conclude multi-factors which influences on the price elasticity, such as the averagely railway freight charge, the averagely freight haulage of proximate supersede transportation mode, the GDP per capita in the point of origin, and a series of dummy variable which can reflect the features of some productive and consume demesne. It can calculate the price elasticity of different classes in different domains, and predict the freight traffic volume on different rate levels. It can calculate confidence-level, and evaluate the relevance of each parameter to get rid of irrelevant or little relevant variables. It supplied a good theoretical basis for directing the pricing of transport enterprises in market economic conditions, which is suitable for railway freight, passenger traffic and other transportation manner as well. SPSS (Statistical Package for the Social Science) software was used to calculate and analysis the example. This article realized the calculation by HYFX system(Ministry of Railways fund).
Villanueva-Cab, J; Anta, J A; Oskam, G
2016-05-28
Correction for 'The effect of recombination under short-circuit conditions on the determination of charge transport properties in nanostructured photoelectrodes' by J. Villanueva-Cab et al., Phys. Chem. Chem. Phys., 2016, 18, 2303-2308.
Directory of Open Access Journals (Sweden)
M. M. Potsane
2014-01-01
Full Text Available The transport of chemicals through soils to the groundwater or precipitation at the soils surfaces leads to degradation of these resources. Serious consequences may be suffered in the long run. In this paper, we consider macroscopic deterministic models describing contaminant transport in saturated soils under uniform radial water flow backgrounds. The arising convection-dispersion equation given in terms of the stream functions is analyzed using classical Lie point symmetries. A number of exotic Lie point symmetries are admitted. Group invariant solutions are classified according to the elements of the one-dimensional optimal systems. We analyzed the group invariant solutions which satisfy the physical boundary conditions.
International Nuclear Information System (INIS)
Brodnick, D.A.
1988-01-01
The electric utility industry has a vital interest in the transport program to be developed by the Department of Energy's Office of Civilian Radioactive Waste Management under the Nuclear Waste Policy Act. The industry's interest stems in part from the fact that the DOE's transportation program is financed by the Nuclear Waste Fund which is made up of ratepayer funds. However, the industry is also vitally interested in the DOE's transportation program because it could impact the ongoing transportation operations of all nuclear utilities, and, perhaps most importantly, without the utility industry's input, DOE is not able to develop an optimal transportation program. The NWPA contemplates that the DOE conducts its transportation program in accordance with the existing federal and state regulatory structure. DOE has significant discretion, however, in creating and implementing the business, operational and institutional aspects of its NWPA transportation program. The utility industry intends to ensure that the DOE meets the challenge to develop a safe, efficient and economically sound program to transport spent fuel and high-level waste to the appropriate federal facilities
Analysis of corrosion product transport in PWR primary system under non-convective condition
International Nuclear Information System (INIS)
Han, Byoung Sub
1992-02-01
The increase of occupational radiation exposure (ORE) due to the increase of the operational period at existing nuclear power plant and also the publication of the new version of ICRP recommendation (ICRP publication No. 60) for radiological protection require much more strict reduction of radiation buildup in the nuclear power plant. The major sources of the radiation, i.e. the radioactive corrosion-products, are generated by the neutron activation of the corrosion products at the reactor core, and then the radioactive corrosion products are transported to the outside of the core, and accumulated near the steam generator side at PWR. Major radioactive corrosion-products of interest in PWR are Cr 51 ,: Mn 54 ,: Co 58 ,: Fe 59 and Co 60 . Among them Co 58 and Co 60 are known to contribute approximately more than 70% of the total ORE. Thus our main concerns are focused on predicting the transport and deposition of the Co radionuclides and suggesting the optimizing method which can minimize and control the ORE of the nuclear power plant. It is well known that Co-source is most effectively controlled by pH-solubility radiation control, and also some complex computer codes such as CORA and PACTOLE have been developed and revised to predict the corrosion product behavior. However these codes still imply some intrisic problems in simulating the real behavior of corrosion products in the reactor because of 1) the lack of important experimental data, coefficients and parameters of the transport and reactions under actual high temperature and pressure conditions, 2) no general theoretical modelling which can describe such many different mechanisms involved in the corrosion product movements, 3) the newly developed and measured behavior of the corrosion product transport mechanism. Since no sufficient and detailed information is available from the above-mentioned codes (also due to propriority problems), we concentrate on developing a new computer code, CP-TRAN (Corrosion
Liu, Yia-Ping; Huang, Teng-Shun; Tung, Che-Se; Lin, Chen-Cheng
2015-01-02
Atomoxetine, a noradrenaline reuptake inhibitor (NRI), which is a non-stimulating medicine that is used for the treatment of patients with attention deficit hyperactivity disorder (ADHD), has been found to be effective in reducing behavioral impulsivity in rodents, but its efficacy in a dorsal noradrenergic ascending bundle (DNAB)-lesioned condition has not been examined. The present study aimed to investigate the effects of DNAB lesions on attention and impulsive control in the five-choice serial reaction time task (5-CSRTT) in rats treated with atomoxetine. The drug-induced changes in noradrenaline efflux in the medial prefrontal cortex were also measured. 5-CSRTT-trained rats were included in one of the following groups: N-(2-chloroethyl)-N-ethyl-2-bromobenzylamine (DSP-4)/Atomoxetine, Sham/Atomoxetine, DSP-4/Saline, or Sham/Saline. Acute atomoxetine (0.3 mg/kg) was administered 14 days after the DSP-4 regime. The behavioral testing included manipulations of the inter-trial interval (ITI), stimulation duration and food satiety. In vivo microdialysis of the noradrenaline efflux in the medial prefrontal cortex and the expression of the noradrenaline transporter (NAT) in the DNAB areas were examined. Atomoxetine reduced impulsivity and perseveration in the long-ITI condition with no effects on any other variables. This phenomenon was not influenced by DSP-4 pre-treatment. The DNAB-lesioned rats had lower noradrenaline efflux in the medial prefrontal cortex. DSP-4 caused no change in NAT expression in the DNAB areas. These findings suggested that noradrenaline reuptake may not be exclusively responsible for the atomoxetine effects in adjusting impulsivity. The role of DNAB should also be considered, particularly in conditions requiring greater behavioral inhibition. Copyright © 2014 Elsevier Inc. All rights reserved.
Ito, Mikiko; Tokura, Tatsuya; Yoshida, Keizo; Nagashima, Wataru; Kimura, Hiroyuki; Umemura, Eri; Tachibana, Masako; Miyauchi, Tomoya; Kobayashi, Yuka; Arao, Munetaka; Ozaki, Norio; Kurita, Kenichi
2015-01-01
Burning mouth syndrome (BMS) causes idiopathic pain or a burning sensation in clinically normal oral mucosa. Burning mouth syndrome is a chronic disease with an unknown etiology. Burning mouth syndrome is also idiopathic, and a consensus regarding diagnosis/treatment has not been reached yet. Recent studies have supported the suggestion that BMS is a neuropathic pain disorder in which both the peripheral and central nervous systems are involved. Tricyclic antidepressants (nortriptyline and amitriptyline), serotonin-noradrenaline reuptake inhibitors (SNRIs) (duloxetine and milnacipran), and antiepileptic drugs, potential-dependent calcium channel α2δ subunit ligands (gabapentine and pregabalin), are currently recommended as the first-choice drugs for neuropathic pain. In this study, we report 5 patients with BMS in whom there was no response to SNRI (milnacipran or duloxetine), or administration was discontinued because of adverse reactions, but in whom pregabalin therapy markedly reduced or led to the disappearance of pain in a short period. Pregabalin, whose mechanism of action differs from that of SNRIs, may become a treatment option for BMS patients who are not responsive to or are resistant to SNRIs.
Directory of Open Access Journals (Sweden)
Saba Pierluigi
2005-05-01
Full Text Available Abstract Background Previous studies by our group suggest that extracellular dopamine (DA and noradrenaline (NA may be co-released from noradrenergic nerve terminals in the cerebral cortex. We recently demonstrated that the concomitant release of DA and NA could be elicited in the cerebral cortex by electrical stimulation of the locus coeruleus (LC. This study analyses the effect of both single train and repeated electrical stimulation of LC on NA and DA release in the medial prefrontal cortex (mPFC, occipital cortex (Occ, and caudate nucleus. To rule out possible stressful effects of electrical stimulation, experiments were performed on chloral hydrate anaesthetised rats. Results Twenty min electrical stimulation of the LC, with burst type pattern of pulses, increased NA and DA both in the mPFC and in the Occ. NA in both cortices and DA in the mPFC returned to baseline within 20 min after the end of the stimulation period, while DA in the Occ reached a maximum increase during 20 min post-stimulation and remained higher than baseline values at 220 min post-stimulation. Local perfusion with tetrodotoxin (TTX, 10 μM markedly reduced baseline NA and DA in the mPFC and Occ and totally suppressed the effect of electrical stimulation in both areas. A sequence of five 20 min stimulations at 20 min intervals were delivered to the LC. Each stimulus increased NA to the same extent and duration as the first stimulus, whereas DA remained elevated at the time next stimulus was delivered, so that baseline DA progressively increased in the mPFC and Occ to reach about 130 and 200% the initial level, respectively. In the presence of the NA transport (NAT blocker desipramine (DMI, 100 μM, multiple LC stimulation still increased extracellular NA and DA levels. Electrical stimulation of the LC increased NA levels in the homolateral caudate nucleus, but failed to modify DA level. Conclusion The results confirm and extend that LC stimulation induces a concomitant
Effect of External Electric Field on Substrate Transport of a Secondary Active Transporter.
Zhang, Ji-Long; Zheng, Qing-Chuan; Yu, Li-Ying; Li, Zheng-Qiang; Zhang, Hong-Xing
2016-08-22
Substrate transport across a membrane accomplished by a secondary active transporter (SAT) is essential to the normal physiological function of living cells. In the present research, a series of all-atom molecular dynamics (MD) simulations under different electric field (EF) strengths was performed to investigate the effect of an external EF on the substrate transport of an SAT. The results show that EF both affects the interaction between substrate and related protein's residues by changing their conformations and tunes the timeline of the transport event, which collectively reduces the height of energy barrier for substrate transport and results in the appearance of two intermediate conformations under the existence of an external EF. Our work spotlights the crucial influence of external EFs on the substrate transport of SATs and could provide a more penetrating understanding of the substrate transport mechanism of SATs.
International Nuclear Information System (INIS)
Connor, J W; Garbet, X; Giannone, L; Greenwald, M; Hidalgo, C; Loarte, A; Mantica, P
2003-01-01
This conference report summarizes the contributions to, and discussions at, the 9th EU-US transport task force workshop on 'transport in fusion plasmas: transport near operational limits', held in Cordoba, Spain, during 9-12 September 2002. The workshop was organized under three main headings: edge localized mode physics and confinement, profile dynamics and confinement and confinement near operational limits: density and beta limits; this report follows the same structure
Wako, Hiromichi; Ishiuchi, Shun-Ichi; Kato, Daichi; Féraud, Géraldine; Dedonder-Lardeux, Claude; Jouvet, Christophe; Fujii, Masaaki
2017-05-03
The conformer-selected ultraviolet (UV) and infrared (IR) spectra of protonated noradrenaline were measured using an electrospray/cryogenic ion trap technique combined with photo-dissociation spectroscopy. By comparing the UV photo dissociation (UVPD) spectra with the UV-UV hole burning (HB) spectra, it was found that five conformers coexist under ultra-cold conditions. Based on the spectral features of the IR dip spectra of each conformer, two different conformations on the amine side chain were identified. Three conformers (group I) were assigned to folded and others (group II) to extended structures by comparing the observed IR spectra with the calculated ones. Observation of the significantly less-stable extended conformers strongly suggests that the extended structures are dominant in solution and are detected in the gas phase by kinetic trapping. The conformers in each group are assignable to rotamers of OH orientations in the catechol ring. By comparing the UV-UV HB spectra and the calculated Franck-Condon spectra obtained by harmonic vibrational analysis of the S 1 state, with the aid of relative stabilization energies of each conformer in the S 0 state, the absolute orientations of catechol OHs of the observed five conformers were successfully determined. It was found that the 0-0 transition of one folded conformer is red-shifted by about 1000 cm -1 from the others. The significant red-shift was explained by a large contribution of the πσ* state to S 1 in the conformer in which an oxygen atom of the meta-OH group is close to the ammonium group.
Song, Shang; Faleo, Gaetano; Yeung, Raymond; Kant, Rishi; Posselt, Andrew M.; Desai, Tejal A.; Tang, Qizhi; Roy, Shuvo
2016-03-01
Problems associated with islet transplantation for Type 1 Diabetes (T1D) such as shortage of donor cells, use of immunosuppressive drugs remain as major challenges. Immune isolation using encapsulation may circumvent the use of immunosuppressants and prolong the longevity of transplanted islets. The encapsulating membrane must block the passage of host’s immune components while providing sufficient exchange of glucose, insulin and other small molecules. We report the development and characterization of a new generation of semipermeable ultrafiltration membrane, the silicon nanopore membrane (SNM), designed with approximately 7 nm-wide slit-pores to provide middle molecule selectivity by limiting passage of pro-inflammatory cytokines. Moreover, the use of convective transport with a pressure differential across the SNM overcomes the mass transfer limitations associated with diffusion through nanometer-scale pores. The SNM exhibited a hydraulic permeability of 130 ml/hr/m2/mmHg, which is more than 3 fold greater than existing polymer membranes. Analysis of sieving coefficients revealed 80% reduction in cytokines passage through SNM under convective transport. SNM protected encapsulated islets from infiltrating cytokines and retained islet viability over 6 hours and remained responsive to changes in glucose levels unlike non-encapsulated controls. Together, these data demonstrate the novel membrane exhibiting unprecedented hydraulic permeability and immune-protection for islet transplantation therapy.
Wagner, Heiko; Jakob, Torsten; Lavaud, Johann; Wilhelm, Christian
2016-05-01
Alternative electron sinks are an important regulatory mechanism to dissipate excessively absorbed light energy particularly under fast changing dynamic light conditions. In diatoms, the cyclic electron transport (CET) around Photosystem II (PS II) is an alternative electron transport pathway (AET) that contributes to avoidance of overexcitation under high light illumination. The combination of nitrogen limitation and high-intensity irradiance regularly occurs under natural conditions and is expected to force the imbalance between light absorption and the metabolic use of light energy. The present study demonstrates that under N limitation, the amount of AET and the activity of CETPSII in the diatom Phaeodactylum tricornutum were increased. Thereby, the activity of CETPSII was linearly correlated with the amount of AET rates. It is concluded that CETPSII significantly contributes to AET in P. tricornutum. Surprisingly, CETPSII was found to be activated already at the end of the dark period under N-limited conditions. This coincided with a significantly increased degree of reduction of the plastoquinone (PQ) pool. The analysis of the macromolecular composition of cells of P. tricornutum under N-limited conditions revealed a carbon allocation in favor of carbohydrates during the light period and their degradation during the dark phase. A possible linkage between the activity of CETPSII and degree of reduction of the PQ pool on the one side and the macromolecular changes on the other is discussed.
Water transport by the Na+/glucose cotransporter under isotonic conditions
DEFF Research Database (Denmark)
Zeuthen, T; Meinild, A K; Klaerke, D A
1997-01-01
Solute cotransport in the Na+/glucose cotransporter is directly coupled to significant water fluxes. The water fluxes are energized by the downhill fluxes of the other substrates by a mechanism within the protein itself. In the present paper we investigate the Na+/glucose cotransporter expressed ...... of water molecules and the number of Na+ ions transported, equivalent to 390 water molecules per glucose molecule. Unstirred layer effects are ruled out on the basis of experiments on native oocytes incubated with the ionophores gramicidin D or nystatin.......Solute cotransport in the Na+/glucose cotransporter is directly coupled to significant water fluxes. The water fluxes are energized by the downhill fluxes of the other substrates by a mechanism within the protein itself. In the present paper we investigate the Na+/glucose cotransporter expressed...... in Xenopus oocytes. We present a method which allows short-term exposures to sugar under voltage clamp conditions. We demonstrate that water is cotransported with the solutes despite no osmotic differences between the external and intracellular solutions. There is a fixed ratio of 195:1 between the number...
Verkerk, Arie O.; Geuzebroek, Guillaume S. C.; Veldkamp, Marieke W.; Wilders, Ronald
2012-01-01
The autonomic nervous system controls heart rate and contractility through sympathetic and parasympathetic inputs to the cardiac tissue, with acetylcholine (ACh) and noradrenalin (NA) as the chemical transmitters. In recent years, it has become clear that specific Regulators of G protein Signaling proteins (RGS proteins) suppress muscarinic sensitivity and parasympathetic tone, identifying RGS proteins as intriguing potential therapeutic targets. In the present study, we have identified the effects of 1 μM ACh and 1 μM NA on the intrinsic action potentials of sinoatrial (SA) nodal and atrial myocytes. Single cells were enzymatically isolated from the SA node or from the left atrium of rabbit hearts. Action potentials were recorded using the amphotericin-perforated patch-clamp technique in the absence and presence of ACh, NA, or a combination of both. In SA nodal myocytes, ACh increased cycle length and decreased diastolic depolarization rate, whereas NA decreased cycle length and increased diastolic depolarization rate. Both ACh and NA increased maximum upstroke velocity. Furthermore, ACh hyperpolarized the maximum diastolic potential. In atrial myocytes stimulated at 2 Hz, both ACh and NA hyperpolarized the maximum diastolic potential, increased the action potential amplitude, and increased the maximum upstroke velocity. Action potential duration at 50 and 90% repolarization was decreased by ACh, but increased by NA. The effects of both ACh and NA on action potential duration showed a dose dependence in the range of 1–1000 nM, while a clear-cut frequency dependence in the range of 1–4 Hz was absent. Intermediate results were obtained in the combined presence of ACh and NA in both SA nodal and atrial myocytes. Our data uncover the extent to which SA nodal and atrial action potentials are intrinsically dependent on ACh, NA, or a combination of both and may thus guide further experiments with RGS proteins. PMID:22754533
Energy Technology Data Exchange (ETDEWEB)
Adkins, Harold E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2013-04-01
Under current U.S. Nuclear Regulatory Commission regulation, it is not sufficient for used nuclear fuel (UNF) to simply maintain its integrity during the storage period, it must maintain its integrity in such a way that it can withstand the physical forces of handling and transportation associated with restaging the fuel and moving it to treatment or recycling facilities, or a geologic repository. Hence it is necessary to understand the performance characteristics of aged UNF cladding and ancillary components under loadings stemming from transport initiatives. Researchers would like to demonstrate that enough information, including experimental support and modeling and simulation capabilities, exists to establish a preliminary determination of UNF structural performance under normal conditions of transport (NCT). This research, development and demonstration (RD&D) plan describes a methodology, including development and use of analytical models, to evaluate loading and associated mechanical responses of UNF rods and key structural components. This methodology will be used to provide a preliminary assessment of the performance characteristics of UNF cladding and ancillary components under rail-related NCT loading. The methodology couples modeling and simulation and experimental efforts currently under way within the Used Fuel Disposition Campaign (UFDC). The methodology will involve limited uncertainty quantification in the form of sensitivity evaluations focused around available fuel and ancillary fuel structure properties exclusively. The work includes collecting information via literature review, soliciting input/guidance from subject matter experts, performing computational analyses, planning experimental measurement and possible execution (depending on timing), and preparing a variety of supporting documents that will feed into and provide the basis for future initiatives. The methodology demonstration will focus on structural performance evaluation of
Transport Calculations for the reference configuration under neutral bean injection in TJ-II
International Nuclear Information System (INIS)
Guasp, J.; Castejon, F.; Liniers, M.
1999-01-01
Transport calculations for the Reference Configuration under Neutral Beam Injection in TJ-II are discussed. For all these analysis the Transport Code PROCTR has been used but, in reason of the complex geometry of TJ-II, some modifications to the code have been needed, not only for the absorption, losses and deposition radial profile evaluations, but also for the treatment of the transition between ECRH and NBI or the fit of Transport Coefficients to the different Scaling Laws. The attained centralβ values for high density ( central value around 11 x 10''13 cm''3), in steady, range between a minimum of 1.9% for the GRB law up to 3.6% or 4.2% for those laws that show an explicit dependence with the rotational transform (ISS and LGS), with an intermediate value of 2.8% for the LHD case. Global energy confinement times range between 3.9 and 8.8 ms for the two extreme cases and 5.6 ms for LHD. As well ions as electrons are clearly in the plateau regime, in contrast to the ECRH phase where the electrons are well inside the 1/ν regime, dominated by helical ripple effects. The effect of impurities is to decrease slightly the absorption and the attainable β levels, but only for Zeff values higher than 4 this degradation becomes important. For the stationary state the density remains always below the semiempirical limit, independently of the Zeff value. Even along the first stages of injection, where absorption can be rather low, the limit is not reached, at least for Zeff < 4, so that radioactive collapse along this critical phase should not to be expected. (Author) 14 refs
Eckert, Dominik; Kürzinger, Petra; Bauer, Robert; Griebler, Christian; Cirpka, Olaf A.
2015-01-01
Biodegradation in contaminated aquifers has been shown to be most pronounced at the fringe of contaminant plumes, where mixing of contaminated water and ambient groundwater, containing dissolved electron acceptors, stimulates microbial activity. While physical mixing of contaminant and electron acceptor by transverse dispersion has been shown to be the major bottleneck for biodegradation in steady-state plumes, so far little is known on the effect of flow and transport dynamics (caused, e.g., by a seasonally fluctuating groundwater table) on biodegradation in these systems. Towards this end we performed experiments in quasi-two-dimensional flow-through microcosms on aerobic toluene degradation by Pseudomonas putida F1. Plume dynamics were simulated by vertical alteration of the toluene plume position and experimental results were analyzed by reactive-transport modeling. We found that, even after disappearance of the toluene plume for two weeks, the majority of microorganisms stayed attached to the sediment and regained their full biodegradation potential within two days after reappearance of the toluene plume. Our results underline that besides microbial growth, also maintenance and dormancy are important processes that affect biodegradation performance under transient environmental conditions and therefore deserve increased consideration in future reactive-transport modeling.
Song, Min-ning; Song, Yu-na; Chen, Fu; Luo, Mei-lan
2007-01-01
To investigate the changes in serotonin (5-HT) and noradrenaline (NA) in hepatic encephalopathy as a result of acute and chronic liver failure in rat. One hundred and ten Sprague-Dawley (SD) rats were randomly divided into groups of normal control (n=20), experimental group of acute liver failure (ALF) encephalopathy (n=45), and experimental group of chronic liver failure (CLF) encephalopathy (n=45). Two dosages of thioacetamide (TAA) of 500 mg/kg were gavaged with an interval of 24 hours to reproduce ALF model. To reproduce CLF model rats were fed with 0.03% TAA in drinking water for 10 weeks, and 50% of TAA dosage was added or withheld according to the change in weekly body weight measurement. Animals were sacrificed and venous blood specimens were obtained after successful replication of model, and 5-HT, NA, ammonia, parameters of liver function were determined, and liver and brain were studied pathologically. The experiment showed that the liver functions of rats in groups ALF encephalopathy and CLF encephalopathy deteriorated seriously, changes in alanine aminotransferase (ALT), aspartate aminotransferase (AST), total bilirubin (TBIL), albumen (ALB), ALB/globulin (A/G), and blood ammonia were observed(Pliver and brain pathologies were identical to those of ALF and CLF encephalopathy. The values of 5-HT were increased in groups ALF encephalopathy and CLF encephalopathy [(16.06+/-1.08) micromol/L and (15.32+/-1.48) micromol/L] compared with the normal group [(2.75+/-0.26) micromol/L, both Pencephalopathy [(94.0+/-2.13) pmol/L vs.(121.2+/-14.8) pmol/L,Pencephalopathy and CLF encephalopathy. The content of NA decreases remarkably in CLF encephalopathy.
International Nuclear Information System (INIS)
1986-01-01
The Transportation Business Plan is a step in the process of procuring the transportation system. It sets the context for business strategy decisions by providing pertinent background information, describing the legislation and policies governing transportation under the NWPA, and describing requirements of the transportation system. Included in the document are strategies for procuring shipping casks and transportation support services. In the spirit of the NWPA directive to utilize the private sector to the maximum extent possible, opportunities for business ventures are obvious throughout the system development cycle
Serotonin noradrenaline reuptake inhibitors: New hope for the treatment of chronic pain.
Delgado, Pedro L
2006-01-01
Depression and painful symptoms occur frequently together. Over 75% of depressed patients report painful symptoms such as headache, stomach pain, neck and back pain as well as non-specific generalized pain. In addition, World Health Organization data have shown that primary care patients with chronic pain have a four fold greater risk of becoming depressed than pain-free patients. Increasingly, pain is considered as an integral symptom of depression and there evidence to suggest that pain and depression may arise from a common neurobiological dysfunction. Serotonergic cell bodies, in the raphe nucleus, and noradrenergic cell bodies in the locus coeruleus send projections to various parts of the brain, where they are involved in the control of mood, movement, cognitive functioning and emotions. In addition both serotonergic and noradrenergic neurons project to the spinal cord. These descending pathways serve to inhibit input from the intestines, skeletal muscles and other sensory inputs. Usually, these inhibitory effects are modest, but in times of stress, in the interest of the survival of the individual, they can completely inhibit the input from painful stimuli. A dysfunction of the serotonergic and noradrenergic neurons can thus affect both the ascending and descending pathways resulting in the psychological symptoms of depression and somatic pain symptoms such as chronic pain, fibromyalgia, non-cardiac chest pain, or irritable bowel syndrome. In view of this, it is not surprising that tricyclic antidepressants have been a standard treatment of chronic pain for many years. In contrast and in spite of their improved tolerance, selective serotonin reuptake inhibitors do not appear to be particularly effective in the treatment of pain. Recently, a number of open and controlled trials with selective serotonin and noradrenaline reuptake inhibitors such as venlafaxine, milnacipran and duloxetine, suggest that these compounds may be more effective in relieving pain
International Nuclear Information System (INIS)
Tsang, C.F.
1984-10-01
The present paper gives a general overview of mass transport in low permeability rocks under the coupled thermomechanical and hydrochemical effects associated with a nuclear waste repository. A classification of coupled processes is given. Then an ess is presented. example of a coupled process is presented. Discussions of coupled processes based on a recent LBL Panel meeting are summarized. 5 references, 3 figures, 4 tables
Directory of Open Access Journals (Sweden)
Massomeh Rafiei-Demneh
2016-09-01
Full Text Available In plants, there are complex network of transport, chelation, and sequestration processes that functions in maintaining concentrations of essential metal ions in different cellular compartments, thus minimizing the damage caused by entry of non-essential metal ions into the cytosol. In the presence of toxic ones, arbuscular mycorrhizal (AM fungi are able to alleviate metal toxicity in the plant. In this study the effect of an arbuscular mycorrhizal fungi Funneliformis intraradices on growth, Nickel tolerance, and ABC transporter and metallothionein expression in leaves and roots of tall fescue (Festuca arundinacea plants cultivated in Ni polluted soil were evaluated. The fungi infected (M+ and uninfected (M- fescue plants were cultivated in soil under different Ni concentrations (0, 30, 90 and 180 ppm for 3 months. Results demonstrated the positive effect of fungi colonization on the increase in growth and reduction in Ni uptake (90 and 180 ppm and Ni translocation from roots to shoot of tall fescue under Ni stress. The results also demonstrated that the level of ABC transporterand metallothionein transcripts accumulation in roots was considerably higher for both M- and M+ plants compared to the control. Also, M+ plants showed less ABC and MET expression compared to the M- plants. These results demonstrated the importance of mycorrhizal colonization of F. intraradices in reduction of Ni transport from root to shoot of tall fescue which alleviates Ni-induced stress.
Naramoto, Satoshi
2017-12-01
Directional cell-to-cell transport of functional molecules, called polar transport, enables plants to sense and respond to developmental and environmental signals. Transporters that localize to plasma membranes (PMs) in a polar manner are key components of these systems. PIN-FORMED (PIN) auxin efflux carriers, which are the most studied polar-localized PM proteins, are implicated in the polar transport of auxin that in turn regulates plant development and tropic growth. In this review, the regulatory mechanisms underlying polar localization of PINs, control of auxin efflux activity, and PIN abundance at PMs are considered. Up to date information on polar-localized nutrient transporters that regulate directional nutrient movement from soil into the root vasculature is also discussed. Copyright © 2017 Elsevier Ltd. All rights reserved.
Eckert, Dominik; Kürzinger, Petra; Bauer, Robert; Griebler, Christian; Cirpka, Olaf A
2015-01-01
Biodegradation in contaminated aquifers has been shown to be most pronounced at the fringe of contaminant plumes, where mixing of contaminated water and ambient groundwater, containing dissolved electron acceptors, stimulates microbial activity. While physical mixing of contaminant and electron acceptor by transverse dispersion has been shown to be the major bottleneck for biodegradation in steady-state plumes, so far little is known on the effect of flow and transport dynamics (caused, e.g., by a seasonally fluctuating groundwater table) on biodegradation in these systems. Towards this end we performed experiments in quasi-two-dimensional flow-through microcosms on aerobic toluene degradation by Pseudomonas putida F1. Plume dynamics were simulated by vertical alteration of the toluene plume position and experimental results were analyzed by reactive-transport modeling. We found that, even after disappearance of the toluene plume for two weeks, the majority of microorganisms stayed attached to the sediment and regained their full biodegradation potential within two days after reappearance of the toluene plume. Our results underline that besides microbial growth, also maintenance and dormancy are important processes that affect biodegradation performance under transient environmental conditions and therefore deserve increased consideration in future reactive-transport modeling. Copyright © 2014 Elsevier B.V. All rights reserved.
Pedretti, D.; Fernàndez-Garcia, D.; Sanchez-Vila, X.; Bolster, D.; Benson, D. A.
2014-02-01
Aquifer hydraulic properties such as hydraulic conductivity (K) are ubiquitously heterogeneous and typically only a statistical characterization can be sought. Additionally, statistical anisotropy at typical characterization scales is the rule. Thus, regardless of the processes governing solute transport at the local (pore) scale, transport becomes non-Fickian. Mass-transfer models provide an efficient tool that reproduces observed anomalous transport; in some cases though, these models lack predictability as model parameters cannot readily be connected to the physical properties of aquifers. In this study, we focus on a multirate mass-transfer model (MRMT), and in particular the apparent capacity coefficient (β), which is a strong indicator of the potential of immobile zones to capture moving solute. We aim to find if the choice of an apparent β can be phenomenologically related to measures of statistical anisotropy. We analyzed an ensemble of random simulations of three-dimensional log-transformed multi-Gaussian permeability fields with stationary anisotropic correlation under convergent flow conditions. It was found that apparent β also displays an anisotropic behavior, physically controlled by the aquifer directional connectivity, which in turn is controlled by the anisotropic correlation model. A high hydraulic connectivity results in large β values. These results provide new insights into the practical use of mass-transfer models for predictive purposes.
Goal system for comparative assessments of nuclear fuel transport under security aspects
International Nuclear Information System (INIS)
Behrendt, V.; Schwieren, G.
1983-01-01
Due to the great hazard potential of nuclear fuel transports the possibility always exists during transportation that either a single perpetrator or a group of perpetrators will try to get possession of the nuclear fuel. One can assume that at the end of such illegal actions there will be a politically (or otherwise) motivated extortion. Thinking about security one has to face things like sabotage, attacks from inside or outside the system, robbery and/or dispersion of the transported goods. In respect to the security of nuclear transports we carried out an investigation for the German Ministry of the Interior in order to review the different levels of security of different transport systems. This paper deals with the methodological approach, especially with the goal system and the way we executed the investigation
DEFF Research Database (Denmark)
Islin, Julie; Munkboel, Cecilie Hurup; Styrishave, Bjarne
2018-01-01
The aim of this study was to determine the steroidogenic endocrine disrupting effect of the three most widely used serotonin-noradrenaline reuptake inhibitors duloxetine, venlafaxine and tramadol, using two in vitro models, the H295R assay and a recombinant CYP17 enzyme assay. Steroid hormones were...... quantified using LC-MS/MS. Duloxetine showed endocrine disrupting effects at 5-20μM with CYP17 being the main target. Venlafaxine also affected the steroidogenesis, mainly by affecting the CYP17 lyase reaction, although at much higher concentrations i.e. 100μM. Tramadol only exerted minor effects...... on the steroidogenesis with the lowest observed effect at 314μM. Based on the H295R results, the inhibition of CYP17 by duloxetine and venlafaxine was investigated in a recombinant CYP17 assay with the use of the 4 major CYP17 substrates pregnenolone, progesterone, 17α-hydroxypregnenolone and 17α...
Transport sector CO2 emissions growth in Asia: Underlying factors and policy options
International Nuclear Information System (INIS)
Timilsina, Govinda R.; Shrestha, Ashish
2009-01-01
This study analyze the potential factors influencing the growth of transport sector carbon dioxide (CO 2 ) emissions in selected Asian countries during the 1980-2005 period by decomposing annual emissions growth into components representing changes in fuel mix, modal shift, per capita gross domestic product (GDP) and population, as well as changes in emission coefficients and transportation energy intensity. We find that changes in per capita GDP, population growth and transportation energy intensity are the main factors driving transport sector CO 2 emission growth in the countries considered. While growth in per capita income and population are responsible for the increasing trend of transport sector CO 2 emissions in China, India, Indonesia, Republic of Korea, Malaysia, Pakistan, Sri Lanka and Thailand; the decline of transportation energy intensity is driving CO 2 emissions down in Mongolia. Per capita GDP, population and transportation energy intensity effects are all found responsible for transport sector CO 2 emissions growth in Bangladesh, the Philippines and Vietnam. The study also reviews existing government policies to limit CO 2 emissions growth, such as fiscal instruments, fuel economy standards and policies to encourage switching to less emission intensive fuels and transportation modes.
Energy Technology Data Exchange (ETDEWEB)
Luckow, Patrick; Wise, Marshall A.; Dooley, James J.; Kim, Son H.
2010-01-25
This paper examines the potential role of large scale, dedicated commercial biomass energy systems under global climate policies designed to stabilize atmospheric concentrations of CO2 at 400ppm and 450ppm. We use an integrated assessment model of energy and agriculture systems to show that, given a climate policy in which terrestrial carbon is appropriately valued equally with carbon emitted from the energy system, biomass energy has the potential to be a major component of achieving these low concentration targets. The costs of processing and transporting biomass energy at much larger scales than current experience are also incorporated into the modeling. From the scenario results, 120-160 EJ/year of biomass energy is produced by midcentury and 200-250 EJ/year by the end of this century. In the first half of the century, much of this biomass is from agricultural and forest residues, but after 2050 dedicated cellulosic biomass crops become the dominant source. A key finding of this paper is the role that carbon dioxide capture and storage (CCS) technologies coupled with commercial biomass energy can play in meeting stringent emissions targets. Despite the higher technology costs of CCS, the resulting negative emissions used in combination with biomass are a very important tool in controlling the cost of meeting a target, offsetting the venting of CO2 from sectors of the energy system that may be more expensive to mitigate, such as oil use in transportation. The paper also discusses the role of cellulosic ethanol and Fischer-Tropsch biomass derived transportation fuels and shows that both technologies are important contributors to liquid fuels production, with unique costs and emissions characteristics. Through application of the GCAM integrated assessment model, it becomes clear that, given CCS availability, bioenergy will be used both in electricity and transportation.
The transportation institutional plan: Cooperative planning for NWPA transportation
International Nuclear Information System (INIS)
Denny, S.H.; Livingston-Behan, E.A.
1987-01-01
The Transportation Institutional Plan, published in 1986 by the U.S. Department of Energy's Office of Civilian Radioactive Waste Management (OCRWM), defines a process for effective interaction among those who may be affected by transportation activities conducted under provisions of the Nuclear Waste Policy Act of 1982 (NWPA). The Plan describes formal mechanisms for identifying, addressing, and resolving specific transportation issues. An appendix to the Plan includes detailed discussion of the following transportation issues: (1) the transportation of defense waste; (2) prenotification; (3) physical and rail shipments; (4) highway routing; (5) rail routing; (6) inspection and enforcement for highway and rail shipments; (7) emergency response; (8) liability coverage for transportation to NWPA facilities; (9) cask design and testing; (10) overweight truck shipments; (11) rail service analysis; (12) mixture of transportation modes; (13) transportation infrastructure improvements; (14) OCRWM training standards; (15) transportation operational procedures; and (16) State, Tribal, and local regulation of transportation. The OCRWM's intent is to provide an open accounting of planning, to identify opportunities for public involvement in program activities, and to foster communication and negotiation in the cooperative development of a safe, efficient, and cost-effective NWPA transportation program
Safety Evaluation of Radioactive Material Transport Package under Stacking Test Condition
International Nuclear Information System (INIS)
Lee, Ju Chan; Seo, Ki Seog; Yoo, Seong Yeon
2012-01-01
Radioactive waste transport package was developed to transport eight drums of low and intermediate level waste(LILW) in accordance with the IAEA and domestic related regulations. The package is classified with industrial package IP-2. IP-2 package is required to undergo a free drop test and a stacking test. After free drop and stacking tests, it should prevent the loss or dispersal of radioactive contents, and loss of shielding integrity which would result in more than 20 % increase in the radiation level at any external surface of the package. The objective of this study is to establish the safety test method and procedure for stacking test and to prove the structural integrities of the IP-2 package. Stacking test and analysis were performed with a compressive load equal to five times the weight of the package for a period of 24 hours using a full scale model. Strains and displacements were measured at the corner fitting of the package during the stacking test. The measured strains and displacements were compared with the analysis results, and there were good agreements. It is very difficult to measure the deflection at the container base, so the maximum deflection of the container base was calculated by the analysis method. The maximum displacement at the corner fitting and deflection at the container base were less than their allowable values. Dimensions of the test model, thickness of shielding material and bolt torque were measured before and after the stacking test. Throughout the stacking test, it was found that there were no loss or dispersal of radioactive contents and no loss of shielding integrity. Thus, the package was shown to comply with the requirements to maintain structural integrity under the stacking condition.
Quadrupole beam-transport experiment for heavy ions under extreme space charge conditions
International Nuclear Information System (INIS)
Chupp, W.; Faltens, A.; Hartwig, E.C.
1983-03-01
A Cs ion-beam-transport experiment is in progress to study beam behavior under extreme space-charge conditions. A five-lens section matches the beam into a periodic electrostatic quadrupole FODO channel and its behavior is found to agree with predictions. With the available parameters (less than or equal to 200 keV, less than or equal to 20 mA, πepsilon/sub n/ greater than or equal to 10 - 7 π rad-m, up to 41 periods) the transverse (betatron) occillation frequency (nu) can be depressed down to one-tenth of its zero current value (nu/sub 0/), where nu/sup 2/ = nu/sub 0//sup 2/ -#betta#/sub p/ 2 /2, and #betta#/sub p/ is the beam plasma frequency. The current can be controlled by adjustment of the gun and the emittance can be controlled independently by means of a set of charged grids
Nonlocal transport in the presence of transport barriers
Del-Castillo-Negrete, D.
2013-10-01
There is experimental, numerical, and theoretical evidence that transport in plasmas can, under certain circumstances, depart from the standard local, diffusive description. Examples include fast pulse propagation phenomena in perturbative experiments, non-diffusive scaling in L-mode plasmas, and non-Gaussian statistics of fluctuations. From the theoretical perspective, non-diffusive transport descriptions follow from the relaxation of the restrictive assumptions (locality, scale separation, and Gaussian/Markovian statistics) at the foundation of diffusive models. We discuss an alternative class of models able to capture some of the observed non-diffusive transport phenomenology. The models are based on a class of nonlocal, integro-differential operators that provide a unifying framework to describe non- Fickian scale-free transport, and non-Markovian (memory) effects. We study the interplay between nonlocality and internal transport barriers (ITBs) in perturbative transport including cold edge pulses and power modulation. Of particular interest in the nonlocal ``tunnelling'' of perturbations through ITBs. Also, flux-gradient diagrams are discussed as diagnostics to detect nonlocal transport processes in numerical simulations and experiments. Work supported by the US Department of Energy.
Directory of Open Access Journals (Sweden)
Kostić Danijela D.
2017-01-01
Full Text Available The aim of this work was to assess phenomena occurring during AgNP transport from nanocomposite Ag/alginate hydrogels under conditions relevant for potential biomedical applications as antimicrobial soft tissue implants. First, we have studied AgNP migration from the nanocomposite to the adjacent alginate hydrogel mimicking soft tissue next to the implant. AgNP deposition was carried out by the initial burst release lasting for ∼24 h yielding large aggregates on hydrogel surfaces and smaller clusters (∼400 nm in size inside. However, the overall released content was low (0.67% indicating high nanocomposite stability. In the next experimental series, release of AgNPs, 10–30 nm in size, from Ag/alginate microbeads in water was investigated under static conditions as well as under continuous perfusion mimicking vascularized tissues. Mathematical modeling has revealed AgNP release by diffusion under static conditions with the diffusion coefficient within the Ag/alginate hydrogel of 6.9x10–19 m2 s–1. Conversely, continuous perfusion induced increased AgNP release by convection with the interstitial fluid velocity estimated as 4.6 nm s–1. Overall, the obtained results indicated the influence of hydrodynamic conditions at the implantation site on silver release and potential implant functionality, which should be investigated at the experimentation beginning using appropriate in vitro systems. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. III 45019
Dozier, R.; Montgomery, D.; Wylie, E. M.; Dogan, M.; Moysey, S. M.; Powell, B. A.; Martinez, N. E.
2015-12-01
Experiments were performed under various reducing conditions to evaluate the transport behavior of technetium-99 (99Tc) in the presence of sandy clay loam soil from the Savannah River Site (SRS) and goethite, magnetite, and iron sulfide, which were selected for their increasing reducing potential. The experiments were conducted to investigate how redox reaction equilibria and rates affect the overall mobility of 99Tc as it transitions between the mobile Tc(VII) and immobile Tc(IV). Under oxygen-rich conditions, batch sorption isotherms measured for TcO4- across the concentration range 0.5 to 50 μg/L were linear with distribution coefficients (Kd) of 0.78 mL/g or lower, with decreasing sorption for goethite, magnetite, and iron sulfide, respectively. Addition of Na2S resulted in a marked increase in apparent 99Tc sorption to the solid phase, with Kd of 43 mL/g, 35 mL/g, and 29 mL/g, following the same mineral trend as previously. The increased Kd values are possibly due to reduction of Tc(VII) to Tc(IV), resulting in the formation of TcO2(s). SRS soil batch sorption isotherms measured for TcO4- across the same concentration range were also linear, with Kd of 0.7 mL/g for unadjusted pH, 5.1 mL/g for pH of around 6, and 6.7 mL/g for pH of around 4. Kinetic batch sorption tests showed less than 10% 99Tc sorption in an oxidizing environment and greater than 95% sorption in a reducing environment, with both reactions occurring on the order of minutes. In contrast, desorption experiments initiated by transferring the samples from a reducing environment (0.1% H2(g)/99.9% N2(g)) to atmospheric conditions resulted in a slow desorption step on the order of days. Column experiments conducted with the SRS sands indicate a retardation factor of 1.17 for 99Tc under oxygen rich conditions. Additional column experiments are being conducted to evaluate 99Tc transport dependencies on transitions between oxygen rich and poor conditions.
ADVANCED CUTTINGS TRANSPORT STUDY
Energy Technology Data Exchange (ETDEWEB)
Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira; Lei Zhou
2000-01-30
This is the second quarterly progress report for Year 2 of the ACTS project. It includes a review of progress made in Flow Loop development and research during the period of time between Oct 1, 2000 and December 31, 2000. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 2: Addition of a foam generation and breaker system), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (c) Research project (Task 7): ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (d) Research project (Task 8): ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (e) Research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (g) Research on instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), and Foam properties while transporting cuttings. (Task 12), (h) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (i) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members. The tasks Completed During This Quarter are Task 7 and Task 8.
de Boer, S.F.; Slangen, J L; van der Gugten, J
The effects of the classical benzodiazepine (BDZ) anxiolytic drug chlordiazepoxide (CDP) and the non-BDZ anxiolytic agent buspirone (BUSP) on basal and stress-induced plasma noradrenaline (NA), adrenaline (A) and corticosterone (CS) release were investigated. Male Wistar rats provided with a
Natural ventilation of a generic cask under a transport hood - CFD and analytical modelling
Energy Technology Data Exchange (ETDEWEB)
Powell, D.; Davies, G.; Tso, C.F. [Arup, London (United Kingdom)
2004-07-01
In comparison with finite element simulation for structural and thermal behaviour, the use of computational fluid dynamics technique (hereafter CFD) to analyse, predict and design air and heat flow in package design is relatively novel. Arup has been using CFD techniques to investigate fluid and heat flow, and to use it as a tool to design fluid and heat flow across a broad spectrum of industries for over fifteen years. In order demonstrate the power of the technique and its benefits, the airflow and heat flow characteristics around a transport package during transit under a transport hood has been evaluated using the CFD technique. This paper presents the scenario, the model, the analysis technique and the results of this analysis. Comparison with test results is probably the best way to validate a CFD analysis. In the absence of test results, the analysis was verified by comparison with hand calculation solutions. The scenario as it stands is too complex and hand calculation solution cannot describe the scenario sufficiently. However, hand calculation solutions could be derived for simplified version of the scenario against which CFD analysis of the simplified scenario can be compared. The second half of this paper describes the verification out.
Natural ventilation of a generic cask under a transport hood - CFD and analytical modelling
International Nuclear Information System (INIS)
Powell, D.; Davies, G.; Tso, C.F.
2004-01-01
In comparison with finite element simulation for structural and thermal behaviour, the use of computational fluid dynamics technique (hereafter CFD) to analyse, predict and design air and heat flow in package design is relatively novel. Arup has been using CFD techniques to investigate fluid and heat flow, and to use it as a tool to design fluid and heat flow across a broad spectrum of industries for over fifteen years. In order demonstrate the power of the technique and its benefits, the airflow and heat flow characteristics around a transport package during transit under a transport hood has been evaluated using the CFD technique. This paper presents the scenario, the model, the analysis technique and the results of this analysis. Comparison with test results is probably the best way to validate a CFD analysis. In the absence of test results, the analysis was verified by comparison with hand calculation solutions. The scenario as it stands is too complex and hand calculation solution cannot describe the scenario sufficiently. However, hand calculation solutions could be derived for simplified version of the scenario against which CFD analysis of the simplified scenario can be compared. The second half of this paper describes the verification out
International Nuclear Information System (INIS)
Leber, A.; Graf, W.; Hueggenberg, R.
2004-01-01
With respect to the transport of casks for radioactive material, the proof of the safe heat removal can be accomplished by validated calculation methods. The boundary conditions for thermal tests for type B packages are specified in the ADR based on the regulations defined by the International Atomic Energy Agency. The varying boundary conditions under transport or storage conditions are based on the varying thermal conditions true for different cask types. In most cases the cask will be transported in lying position under a cover (e.g. canopy or tarpaulin) and stored in standing position in an array with other casks. The main heat transport mechanisms are natural convection and thermal radiation. The cover or the storage building are furnished with vents that create an air flow, which will improve the natural convection. Depending on the thermal boundary conditions, the cask design and the heat power, about 50 - 95% of the heat power will be removed from the finned cask surface by natural convection. Consequently the convection by air flow is the main heat transport mechanism. The air flow can be approximated with analytical methods by solving the integral heat and flow balances for the domain. In a stationary state the overpressure due the buoyancy and the pressure loss in the flow resistances are equal. Based on the air flow, the relevant temperatures of the cask can be calculated in an iterative process. Due to the fast development of numerical calculation methods and computer hardware, the use of Computational- Fluid-Dynamics(CFD) calculations plays an important role. CFD-calculations are based on solving the equations of conservation (Navier-Stokes equations) using a finite element mesh or a finite volume mesh of the model. For a finned cask lying under a cover, where the main contributing element for heat removal is natural convection in combination with the thermal radiation, a CFD-calculation can be the most appropriate method. Common CFD-Codes are FLUENT
Energy Technology Data Exchange (ETDEWEB)
Szenknect, St
2003-10-15
This work is devoted to the quantification and the identification of the predominant processes involved in strontium and caesium transport in unsaturated soil from Chernobyl Pilot Site under steady flow conditions. The transport and fate of radionuclides in the subsurface is affected by various physical and chemical processes including advective and diffusive transport as well as chemical and biological transformations. Laboratory experiments and the use of a multiple tracer approach allow to isolate the contributions of each elementary process and to control the physico-chemical conditions in the system. To be more representative of the field conditions, we decided to perform column miscible displacement experiments. We perform batch and flow-through reactor experiments to characterize the radionuclides sorption mechanisms. Miscible displacement experiments within homogeneous columns and modeling allow to characterize the hydrodynamic properties of the soil and to describe the radionuclides behaviour under dynamic conditions at different water contents. We show that the water content of porous media affect the transport behaviour of inert and strongly sorbing radionuclides. Our results demonstrate that a parametrized transport model that was calibrated under completely saturated conditions was not able to describe the advective-dispersive transport of reactive solutes under unsaturated steady state conditions. Under our experimental conditions, there is no effect of a decrease of the mean water content on the sorption model parameters, but the transport parameters are modified. We established for the studied soil the relation between hydrodynamic dispersion and water content and the relation between pore water velocity and water content. (author)
Puccinelli, P; Natoli, V; Dell'albani, I; Scurati, S; Incorvaia, C; Barbieri, S; Masieri, S; Frati, F
2013-10-01
Many pharmaceutical and biotechnological products are temperature-sensitive and should normally be kept at a controlled temperature, particularly during transport, in order to prevent the loss of their stability and activity. Therefore, stability studies should be performed for temperature-sensitive products, considering product characteristics, typical environmental conditions, and anticipating environmental extremes that may occur during product transport in a specific country. Staloral products for sublingual immunotherapy are temperature sensitive and are labelled for maintenance under refrigerated conditions (2-8°C). Given the peculiar climatic context of Italy and the great temperature fluctuations that may occur during transport, this study was aimed at evaluating the impact of a new engineered thermal insulating packaging for Staloral. In particular, the purpose was to assess whether the new packaging could create a container condition able to preserve the stability and immunological activity of the product during the transport phase throughout Italy. The results showed that the range of temperatures that can affect the product, in the area surrounding the product packaging, may reach a peak of 63°C during transport under the most unfavourable climatic conditions, i.e. in a non-refrigerated van during the summer season, from the site of production in France to the patient's house in Catania, the city with the highest temperatures in Italy. However, the highest temperature reached inside the vaccine did not exceed 45°C over a period of about 2 h. The ELISA inhibition test on samples subjected to the extreme temperature conditions previously defined (45°C) showed an immunological activity higher than 75% of that initially measured and was comparable to those obtained with samples stored at controlled temperature (5°C). This means that, even in the worst case scenario, the structure of the allergen extracts is not influenced and the vaccine potency is
International Nuclear Information System (INIS)
Kwong, S.; Jivkov, A.P.
2013-01-01
transport model) to examine the long term behaviour of deep geological repositories with media property change under complex geochemical conditions. (authors)
20 CFR 638.408 - Transportation.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Transportation. 638.408 Section 638.408 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR JOB CORPS PROGRAM UNDER... the Job Corps § 638.408 Transportation. The transportation of students to and from centers shall occur...
Directory of Open Access Journals (Sweden)
Rong Ren
2017-04-01
Full Text Available Temperature is an integral part of soil quality in terms of moisture content; coupling between water and heat can render a soil fertile, and plays a role in water conservation. Although it is widely recognized that both water and heat transport are fundamental factors in the quantification of soil mass and energy balance, their computation is still limited in most models or practical applications in the root zone under non-isothermal conditions. This research was conducted to: (a implement a fully coupled mathematical model that contains the full coupled process of soil water and heat transport with plants focused on the influence of temperature gradient on soil water redistribution and on the influence of change in soil water movement on soil heat flux transport; (b verify the mathematical model with detailed field monitoring data; and (c analyze the accuracy of the model. Results show the high accuracy of the model in predicting the actual changes in soil water content and temperature as a function of time and soil depth. Moreover, the model can accurately reflect changes in soil moisture and heat transfer in different periods. With only a few empirical parameters, the proposed model will serve as guide in the field of surface irrigation.
ADVANCED CUTTINGS TRANSPORT STUDY
Energy Technology Data Exchange (ETDEWEB)
Ergun Kuru; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Len Volk; Mark Pickell; Evren Ozbayoglu; Barkim Demirdal; Paco Vieira; Affonso Lourenco
1999-10-15
This report includes a review of the progress made in ACTF Flow Loop development and research during 90 days pre-award period (May 15-July 14, 1999) and the following three months after the project approval date (July15-October 15, 1999) The report presents information on the following specific subjects; (a) Progress in Advanced Cuttings Transport Facility design and development, (b) Progress report on the research project ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (c) Progress report on the research project ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (d) Progress report on the research project ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (e) Progress report on the research project ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Progress report on the instrumentation tasks (Tasks 11 and 12) (g) Activities towards technology transfer and developing contacts with oil and service company members.
2011-11-03
...The DOT's TIFIA Joint Program Office (JPO) announces the availability of a limited amount of funding in Fiscal Year (FY) 2012 to provide credit assistance. Under TIFIA, the DOT provides secured (direct) loans, lines of credit, and loan guarantees to public and private applicants for eligible surface transportation projects of regional or national significance. Projects must meet statutorily specified criteria to be selected for credit assistance. Because demand for the TIFIA program exceeds budgetary resources, the DOT is utilizing periodic fixed-date solicitations. This notice outlines the process that project sponsors must follow to compete to secure an invitation for Federal credit assistance for Federal FY 2012.
National Research Council Canada - National Science Library
Frankel, Ernst G; Marcus, Henry S
1973-01-01
.... This analysis starts with a review of ocean transportation demand and supply including projections of ship capacity demand and world shipbuilding capacity under various economic and political assumptions...
International Nuclear Information System (INIS)
Freyss, M.
2015-01-01
As presented in the first chapter of this book, atomic transport properties govern a large panel of nuclear fuel properties, from its microstructure after fabrication to its behaviour under irradiation: grain growth, oxidation, fission product release, gas bubble nucleation. The modelling of the atomic transport properties is therefore the key to understanding and predicting the material behaviour under irradiation or in storage conditions. In particular, it is noteworthy that many modelling techniques within the so-called multi-scale modelling scheme of materials make use of atomic transport data as input parameters: activation energies of diffusion, diffusion coefficients, diffusion mechanisms, all of which are then required to be known accurately. Modelling approaches that are readily used or which could be used to determine atomic transport properties of nuclear materials are reviewed here. They comprise, on the one hand, static atomistic calculations, in which the migration mechanism is fixed and the corresponding migration energy barrier is calculated, and, on the other hand, molecular dynamics calculations and kinetic Monte-Carlo simulations, for which the time evolution of the system is explicitly calculated. (author)
Perai, A. H.; Kermanshahi, H.; Moghaddam, H. Nassiri; Zarban, A.
2015-04-01
A total of 240 female broilers (42 days old) were randomly assigned to four groups with six replicates and fed either a basal diet (two control groups) or a basal diet supplemented with either 1,200 μg Cr+3 from chromium (Cr) methionine/kg (Cr group) or 1,200 μg Cr+3 from Cr methionine plus 800 mg vitamin C (Vit C)/kg of diet (Cr + Vit C group). After 7 days on the dietary treatment, all groups except one of the controls were transported for 3 h under the summer conditions. Performance parameters were not influenced by dietary treatments. The plasma concentrations of insulin, triiodothyronine, triglyceride, and the ratio of triiodothyronine/thyroxin were decreased and the ratio of glucose/insulin was increased due to transport process. Road transportation also increased the plasma concentrations of protein, cholesterol, aspartate aminotransferase, and creatine kinase and decreased the concentration of low-density lipoprotein cholesterol in the Cr + Vit C group. The pretransport concentrations of insulin and triiodothyronine were highest in the Cr + Vit C group. The concentration of phosphorous was lower in the Cr group than that in the other groups after transport. No significant effects of dietary treatments were observed on the other biochemical parameters. Transport increased malondialdehyde concentration in the control group and did not change plasma total antioxidant capacity and erythrocyte glutathione peroxidase activity. Either in combination or alone, Cr increased plasma total antioxidant capacity (before transport P ≤ 0.05, after transport P = 0.07) but did not affect the concentration of malondialdehyde and activity of glutathione peroxidase. The duration of tonic immobility (TI) was similar between nontransported control chicks and transported chicks without any supplements. Pretreatment with Cr + Vit C significantly reduced the duration of TI.
The transport of radioactive waste
International Nuclear Information System (INIS)
Appleton, P.R.; Poulter, D.R.
1989-01-01
Regulations have been developed to ensure the safe transport of all radioactive materials by all modes (road, rail, sea and air). There are no features of radioactive waste which set it aside from other radioactive materials for transport, and the same regulations control all radioactive material transport. These regulations and their underlying basis are described in this paper, and their application to waste transport is outlined. (author)
Mann, T; Zilles, K; Dikow, H; Hellfritsch, A; Cremer, M; Piel, M; Rösch, F; Hawlitschka, A; Schmitt, O; Wree, A
2018-03-15
Parkinson's disease (PD) is characterized by a degeneration of dopaminergic neurons in the substantia nigra pars compacta (SNpc) that causes a dopamine (DA) deficit in the caudate-putamen (CPu) accompanied by compensatory changes in other neurotransmitter systems. These changes result in severe motor and non-motor symptoms. To disclose the role of various receptor binding sites for DA, noradrenaline, and serotonin in the hemiparkinsonian (hemi-PD) rat model induced by unilateral 6-hydroxydopamine (6-OHDA) injection, the densities of D 1 , D 2 /D 3 , α 1 , α 2 , and 5HT 2A receptors were longitudinally visualized and measured in the CPu of hemi-PD rats by quantitative in vitro receptor autoradiography. We found a moderate increase in D 1 receptor density 3 weeks post lesion that decreased during longer survival times, a significant increase of D 2 /D 3 receptor density, and 50% reduction in 5HT 2A receptor density. α 1 receptor density remained unaltered in hemi-PD and α 2 receptors demonstrated a slight right-left difference increasing with post lesion survival. In a second step, the possible role of receptors on the known reduction of apomorphine-induced rotations in hemi-PD rats by intrastriatally injected Botulinum neurotoxin-A (BoNT-A) was analyzed by measuring the receptor densities after BoNT-A injection. The application of this neurotoxin reduced D 2 /D 3 receptor density, whereas the other receptors mainly remained unaltered. Our results provide novel data for an understanding of the postlesional plasticity of dopaminergic, noradrenergic and serotonergic receptors in the hemi-PD rat model. The results further suggest a therapeutic effect of BoNT-A on the impaired motor behavior of hemi-PD rats by reducing the interhemispheric imbalance in D 2 /D 3 receptor density. Copyright © 2018 IBRO. Published by Elsevier Ltd. All rights reserved.
Porters and neurotransmitter transporters
Nelson, Nathan; Lill, H
1994-01-01
Uptake of neurotransmitters involves multiple transporters acting in different brain locations under different physiological conditions. The vesicular transporters are driven by a proton-motive force generated by a V-ATPase and their substrates are taken up via proton/substrate exchange. The plasma
Montpetit, C J; McKendry, J; Perry, S F
2001-08-01
. Furthermore, the dfCNP-mediated increase of plasma noradrenaline appears to be unrelated to changes in P(CA) and is insensitive to blockade of the RAS or nicotinic receptors. However, stimulation of adrenergic receptors, in particular the alpha-adrenoreceptors, appears to be a key mechanism underlying the dfCNP-elicited secretion of noradrenaline. Copyright 2001 Academic Press.
International Nuclear Information System (INIS)
Haas, K.F.
1975-01-01
Assuming that very often a long transport route from the factory of the manufacturer to the provided site has to be reckoned with, in general only transport with a ship is possible. As each site is only called by a certain steamship line, at a very early stage of planning the nuclear power plant the possibilities and capacities of the lines and means of transportation under discussion should be investigated. In planning the unloading equipment at the site, due consideration should be given to the fact that at a later time this equipment should also be suitable for the transport of heavy components and spent fuel assemblies. (orig.) [de
Disorder effects on helical edge transport in graphene under a strong tilted magnetic field
Huang, Chunli; Cazalilla, Miguel A.
2015-10-01
In a recent experiment, Young et al. [Nature (London) 505, 528 (2014), 10.1038/nature12800] observed a metal to insulator transition as well as transport through helical edge states in monolayer graphene under a strong, tilted magnetic field. Under such conditions, the bulk is a magnetic insulator which can exhibit metallic conduction through helical edges. It was found that the two-terminal conductance of the helical channels deviates from the expected quantized value (=e2/h per edge, at zero temperature). Motivated by this observation, we study the effect of disorder on the conduction through the edge channels. We show that, unlike for helical edges of topological insulators in semiconducting quantum wells, a disorder Rashba spin-orbit coupling does not lead to backscattering, at least to leading order. Instead, we find that the lack of perfect antialignment of the electron spins in the helical channels to be the most likely cause for backscattering arising from scalar (i.e., spin-independent) impurities. The intrinsic spin-orbit coupling and other time-reversal symmetry-breaking and/or sublattice parity-breaking potentials also lead to (subleading) corrections to the channel conductance.
Transport sector CO{sub 2} emissions growth in Asia: Underlying factors and policy options
Energy Technology Data Exchange (ETDEWEB)
Timilsina, Govinda R., E-mail: gtimilsina@worldbank.or [Development Research Group, World Bank, 1818H Street, NW, Washington, DC 20433 (United States); Shrestha, Ashish [Development Research Group, World Bank, 1818H Street, NW, Washington, DC 20433 (United States)
2009-11-15
This study analyze the potential factors influencing the growth of transport sector carbon dioxide (CO{sub 2}) emissions in selected Asian countries during the 1980-2005 period by decomposing annual emissions growth into components representing changes in fuel mix, modal shift, per capita gross domestic product (GDP) and population, as well as changes in emission coefficients and transportation energy intensity. We find that changes in per capita GDP, population growth and transportation energy intensity are the main factors driving transport sector CO{sub 2} emission growth in the countries considered. While growth in per capita income and population are responsible for the increasing trend of transport sector CO{sub 2} emissions in China, India, Indonesia, Republic of Korea, Malaysia, Pakistan, Sri Lanka and Thailand; the decline of transportation energy intensity is driving CO{sub 2} emissions down in Mongolia. Per capita GDP, population and transportation energy intensity effects are all found responsible for transport sector CO{sub 2} emissions growth in Bangladesh, the Philippines and Vietnam. The study also reviews existing government policies to limit CO{sub 2} emissions growth, such as fiscal instruments, fuel economy standards and policies to encourage switching to less emission intensive fuels and transportation modes.
Transport sector CO{sub 2} emissions growth in Asia. Underlying factors and policy options
Energy Technology Data Exchange (ETDEWEB)
Timilsina, Govinda R.; Shrestha, Ashish [Development Research Group, The World Bank, 1818H Street, NW, Washington, DC 20433 (United States)
2009-11-15
This study analyze the potential factors influencing the growth of transport sector carbon dioxide (CO{sub 2}) emissions in selected Asian countries during the 1980-2005 period by decomposing annual emissions growth into components representing changes in fuel mix, modal shift, per capita gross domestic product (GDP) and population, as well as changes in emission coefficients and transportation energy intensity. We find that changes in per capita GDP, population growth and transportation energy intensity are the main factors driving transport sector CO{sub 2} emission growth in the countries considered. While growth in per capita income and population are responsible for the increasing trend of transport sector CO{sub 2} emissions in China, India, Indonesia, Republic of Korea, Malaysia, Pakistan, Sri Lanka and Thailand; the decline of transportation energy intensity is driving CO{sub 2} emissions down in Mongolia. Per capita GDP, population and transportation energy intensity effects are all found responsible for transport sector CO{sub 2} emissions growth in Bangladesh, the Philippines and Vietnam. The study also reviews existing government policies to limit CO{sub 2} emissions growth, such as fiscal instruments, fuel economy standards and policies to encourage switching to less emission intensive fuels and transportation modes. (author)
Baas, A. C.; Jackson, D.; Cooper, J. A.; Lynch, K.; Delgado-Fernandez, I.; Beyers, M.; Lee, Z. S.
2010-12-01
The past decade has seen a growing body of research on the relation between turbulence in the wind and the resultant transport of sediment over active sand surfaces. Widespread use of sonic anemometry and high-frequency sand transport sensors and traps have facilitated recent field studies over dunes and beach surfaces, to move beyond monitoring of mean wind speed and bulk transport to more detailed measurements at much higher spatio-temporal resolutions. In this paper we present results of a field study conducted in the recirculation flow and re-attachment zone on a beach behind a foredune at Magilligan Strand, Northern Ireland. The offshore winds over the foredune at this site are associated with flow separation and reversal located over the beach surface in the lee of the dune row, often strong enough to induce sand transport toward the toe of the foredune (‘against’ the overall offshore flow). The re-attachment and recirculation zone are associated with strongly turbulent fluid flow and complex streamlines that do not follow the underlying topography. High frequency (25 Hz) wind and sand transport data were collected at a grid of point locations distributed over the beach surface between 35 m to 55 m distance from the 10 m high dune crest, using ultrasonic anemometers at 0.5 m height and co-located load cell traps and Safires at the bed surface. The wind data are used to investigate the role of Reynolds shear stresses and quadrant analysis techniques for identifying burst-sweep events in relation to sand transport events. This includes an assessment of the issues involved with data rotations for yaw, pitch, and roll corrections relative to complex flow streamlines, and the subsequently derived turbulence parameters based on fluctuating vector components (u’, v’, w’). Results illustrate how transport may exist under threshold mean velocities because of the role played by coherent flow structures, and the findings corroborate previous findings that
Cremer, Clemens; Neuweiler, Insa
2016-04-01
Flow and solute transport in the shallow subsurface is strongly governed by atmospheric boundary conditions. Erratically varying infiltration and evaporation cycles lead to alternating upward and downward flow, as well as spatially and temporally varying water contents and associated hydraulic conductivity of the prevailing materials. Thus presenting a highly complicated, dynamic system. Knowledge of subsurface solute transport processes is vital to assess e.g. the entry of, potentially hazardous, solutes to the groundwater and nutrient uptake by plant roots and can be gained in many ways. Besides field measurements and numerical simulations, physical laboratory experiments represent a way to establish process understanding and furthermore validate numerical schemes. With the aim to gain a better understanding and to quantify solute transport in the unsaturated shallow subsurface under natural precipitation conditions in heterogeneous media, we conduct physical laboratory experiments in a 22 cm x 8 cm x 1 cm flow cell that is filled with two types of sand and apply cyclic infiltration-evaporation phases at the soil surface. Pressure at the bottom of the domain is kept constant. Following recent studies (Lehmann and Or, 2009; Bechtold et al., 2011a), heterogeneity is introduced by a sharp vertical interface between coarse and fine sand. Fluorescent tracers are used to i) qualitatively visualize transport paths within the domain and ii) quantify solute leaching at the bottom of the domain. Temporal and spatial variations in water content during the experiment are derived from x-ray radiographic images. Monitored water contents between infiltration and evaporation considerably changed in the coarse sand while the fine sand remained saturated throughout the experiments. Lateral solute transport through the interface in both directions at different depths of the investigated soil columns were observed. This depended on the flow rate applied at the soil surface and
Franz, Guilherme; Delpey, Matthias T.; Brito, David; Pinto, Lígia; Leitão, Paulo; Neves, Ramiro
2017-09-01
Coastal defence structures are often constructed to prevent beach erosion. However, poorly designed structures may cause serious erosion problems in the downdrift direction. Morphological models are useful tools to predict such impacts and assess the efficiency of defence structures for different scenarios. Nevertheless, morphological modelling is still a topic under intense research effort. The processes simulated by a morphological model depend on model complexity. For instance, undertow currents are neglected in coastal area models (2DH), which is a limitation for simulating the evolution of beach profiles for long periods. Model limitations are generally overcome by predefining invariant equilibrium profiles that are allowed to shift offshore or onshore. A more flexible approach is described in this paper, which can be generalised to 3-D models. The present work is based on the coupling of the MOHID modelling system and the SWAN wave model. The impacts of different designs of detached breakwaters and groynes were simulated in a schematic beach configuration following a 2DH approach. The results of bathymetry evolution are in agreement with the patterns found in the literature for several existing structures. The model was also tested in a 3-D test case to simulate the formation of sandbars by undertow currents. The findings of this work confirmed the applicability of the MOHID modelling system to study sediment transport and morphological changes in coastal zones under the combined action of waves and currents. The same modelling methodology was applied to a coastal zone (Costa da Caparica) located at the mouth of a mesotidal estuary (Tagus Estuary, Portugal) to evaluate the hydrodynamics and sediment transport both in calm water conditions and during events of highly energetic waves. The MOHID code is available in the GitHub repository.
Institute of Scientific and Technical Information of China (English)
2010-01-01
With "integration" as the direction,Shenzhen Comprehensive Transport Planning integrates the plan,construction and management of all kinds of transport mode in the transport system,and integrates the transport with the social,economic and environment development.The planning specifies the strategic targets,key indicators,development strategies as well as major policies of the comprehensive transport system,which explores an alternative way for the sustainable urban transport development under the condition of limited resources in Shenzhen.
Simonin, Marie; Martins, Jean M F; Uzu, Gaëlle; Vince, Erwann; Richaume, Agnès
2016-10-04
Soils are exposed to nanoparticles (NPs) as a result of their increasing use in many commercial products. Adverse effects of NPs on soil microorganisms have been reported in several ecotoxicological studies using microcosms. Although repeated exposures are more likely to occur in soils, most of these previous studies were performed as a single exposure to NPs. Contrary to single contamination, the study of multiple NP contaminations in soils requires the use of specialized setups. Using a soil column experiment, we compared the influence of single and repeated exposures (one, two, or three exposures that resulted in the same final concentration applied) on the transport of titanium dioxide (TiO 2 ) NPs through soil and the effect of these different exposure scenarios on the abundance and activity of soil nitrifying microbial communities after a 2 month incubation. The transport of TiO 2 NPs was very limited under both single and repeated exposures and was highest for the lowest concentration injected during the first application. Significant decreases in nitrification activity and ammonia-oxidizing archaea and bacteria populations were observed only for the repeated exposure scenario (three TiO 2 NP contaminations). These results suggest that, under repeated exposures, the transport of TiO 2 NPs to deep soil layers and groundwater is limited and that a chronic contamination is more harmful for the soil microbiological functioning than a single exposure.
NWMO transportation technical work program
International Nuclear Information System (INIS)
Hatton, C.
2015-01-01
This paper describes technical work program for the transportation nuclear waste by the Nuclear Waste Management Organization (NWMO). Transportation work program involves risk assessment which under normal conditions involves dose assessment to the worker and the public as well as consideration of transportation system routing and operations. It also involves possible accident scenarios using forensic modelling and probability analysis.
NWMO transportation technical work program
Energy Technology Data Exchange (ETDEWEB)
Hatton, C. [Nuclear Waste Management Organization, Toronto, ON (Canada)
2015-07-01
This paper describes technical work program for the transportation nuclear waste by the Nuclear Waste Management Organization (NWMO). Transportation work program involves risk assessment which under normal conditions involves dose assessment to the worker and the public as well as consideration of transportation system routing and operations. It also involves possible accident scenarios using forensic modelling and probability analysis.
Fox, A.; Packman, A. I.; Preziosi-Ribero, A.; Li, A.; Arnon, S.
2017-12-01
Sediment transport and deposition in streams can affect streambed hydraulic characteristics due to clogging, reduce water fluxes through the hyporheic zone, and thus expected to affect biogeochemical processes. Processes affecting deposition of suspended particles were systematically studied under various overlying velocities but without taking into account the interactions with groundwater. This is despite the fact that the interaction with groundwater were shown to play an important role in deposition patterns of fine sediments in field studies. The objective of this study was to evaluate the effect of losing and gaining fluxes on suspended sediment depositional patterns and on hyporheic exchange fluxes. Experiments were conducted in a laboratory flume system (640 cm long and 30 cm wide) that has a capacity to enforce losing or gaining flow conditions. The flume was packed with homogenous sand, while suspended sediment deposition was evaluated by adding kaolinite particles to the water and following the deposition rate by particle disappearance from the bulk water. Consecutive additions of kaolinite were done, while hyporheic exchange fluxes were evaluated by conducting NaCl tracer experiments between each kaolinite additions. Furthermore, dye injections were used to visualize the flow patterns in the streambed using time-lapse photography through the transparent sidewalls of the flume. Hyporheic exchange and particle tracking simulations were done to assess the results of particle deposition and feedbacks between hyporheic flow, particle transport, and streambed clogging. Experimental results showed that the deposition of clay decreases with increasing amount of clay concentration in the sediment. Hyporheic exchange flux decreases linearly with increasing amount of clay added to the system and the region of active hyporheic exchange was confined to the upper part of the sediment. Understanding the particle deposition mechanisms under losing and gaining flow
Energy Technology Data Exchange (ETDEWEB)
Lakshmana, M.K. (Department of Neurophysiology, National Institute of Mental Health and Neuro Sciences, Bangalore (India)); Desiraju, T. (Department of Neurophysiology, National Institute of Mental Health and Neuro Sciences, Bangalore (India)); Raju, T.R. (Department of Neurophysiology, National Institute of Mental Health and Neuro Sciences, Bangalore (India))
1993-07-01
Wistar rats were fed mercuric chloride, 4 mg/kg body weight per day chronically from postnatal day 2 to 60 by gastric intubation. Mercury consumption was then discontinued until 170 days to allow time for recovery. Since mercury caused reduction in body weight, an underweight group was also included besides the normal saline group. Levels of noradrenaline (NA), dopamine (DA), 5-hydroxytryptamine (5-HT) and the activity of acetylcholine esterase (AChE) were assayed in various brain regions in different age groups. By 60 days of age, the mercury group showed elevations of NA levels in olfactory bulb (OB), visual cortex (VC) and brain stem (BS) but not in striatumaccumbens (SA) and hippocampus (HI). DA levels were also increased in OB, HI, VC and BS but not in SA. AChE activity was decreased in the mercury group only in HI and VC at 20 days of age. The Mercury group showed no behavioural abnormality outwardly; however, operant conditioning relevated a dificiency in performance. Nevertheless, all these changes disappeared after discontinuation of mercury intake. Thus the changes occurring in the brain at this level of oral mercuric chloride intake seem to reflect adaptive neural mechanisms rather than pathological damage. (orig.)
Effects of South African traditional medicine in animal models for depression
DEFF Research Database (Denmark)
Pedersen, Mikael Egebjerg; Szewczyk, Bernadeta; Stachowicz, Katarzyna
2008-01-01
in models for depression. MATERIALS AND METHODS: The extracts were screened for affinity for the serotonin transporter (SERT) in the [(3)H]-citalopram-binding assay. The inhibitory potency of the extracts towards the SERT, the noradrenalin transporter (NAT) and the dopamine transporter (DAT) were determined...... in a functional uptake inhibition assay. Antidepressant-like effects of the extracts were investigated using the tail suspension test (TST) and the forced swim test in both rats (rFST) and mice (mFST). RESULTS: All four plants showed affinity for SERT in the binding assay. AC and BD showed functional inhibition...
Resseguier, V.; Memin, E.; Chapron, B.; Fox-Kemper, B.
2017-12-01
In order to better observe and predict geophysical flows, ensemble-based data assimilation methods are of high importance. In such methods, an ensemble of random realizations represents the variety of the simulated flow's likely behaviors. For this purpose, randomness needs to be introduced in a suitable way and physically-based stochastic subgrid parametrizations are promising paths. This talk will propose a new kind of such a parametrization referred to as modeling under location uncertainty. The fluid velocity is decomposed into a resolved large-scale component and an aliased small-scale one. The first component is possibly random but time-correlated whereas the second is white-in-time but spatially-correlated and possibly inhomogeneous and anisotropic. With such a velocity, the material derivative of any - possibly active - tracer is modified. Three new terms appear: a correction of the large-scale advection, a multiplicative noise and a possibly heterogeneous and anisotropic diffusion. This parameterization naturally ensures attractive properties such as energy conservation for each realization. Additionally, this stochastic material derivative and the associated Reynolds' transport theorem offer a systematic method to derive stochastic models. In particular, we will discuss the consequences of the Quasi-Geostrophic assumptions in our framework. Depending on the turbulence amount, different models with different physical behaviors are obtained. Under strong turbulence assumptions, a simplified diagnosis of frontolysis and frontogenesis at the surface of the ocean is possible in this framework. A Surface Quasi-Geostrophic (SQG) model with a weaker noise influence has also been simulated. A single realization better represents small scales than a deterministic SQG model at the same resolution. Moreover, an ensemble accurately predicts extreme events, bifurcations as well as the amplitudes and the positions of the simulation errors. Figure 1 highlights this last
Energy Technology Data Exchange (ETDEWEB)
Fred J. Molz, III
2010-05-28
to Pu uptake by corn roots and xylem transport. Plants were started in wet paper wrapped around each corn seed. When the tap roots were sufficiently long, the seedlings were transplanted to a soil container with the tap root extending out the container bottom. The soil container was then placed over a nutrient solution container, and the solution served as an additional medium for root growth. To conduct an uptake study, a radioactive substance, such as Pu complexed with the bacterial siderophore DFOB, was added to the nutrient solution. After a suitable elapsed time, the corn plant was sacrificed, cut into 10 cm lengths, and the activity distribution measured. Experimental results clarified the basic nature of Pu uptake and transport in corn plants, and resulting simulations suggested that each growing season Pu in the SRS lysimeters would move into the plant shoots and be deposited on the soil surface during the Fall dieback. Subsequent isotope ratio analyses showed that this did happen. OVERALL RESULTS AND CONCLUSIONS - (1) Pu transport downward from the source is controlled by advection, dispersion and adsorption, along with surface-mediated REDOX reactions. (2) Hysteresis, extreme root distribution functions, air-content dependent oxidation rate constants, and large evaporation rates from the soil surface were not able to explain the observed upward migration of Pu. (3) Small amounts of Pu uptake by plant roots and translocation in the transpiration stream creates a realistic mechanism for upward Pu migration (4) Realistic xylem cross-sectional areas imply high flow velocities under hot, wet conditions. Such flow velocities produce the correct shape for the observed activity distributions in the top 20 cm of the lysimeter soil. (5) Simulations imply that Pu should have moved into the above-ground grass tissue each year during the duration of the experiments, resulting in an activity residual accumulating on the soil surface. An isotope ratio analysis showed that
International Nuclear Information System (INIS)
Molz, Fred J. III
2010-01-01
to Pu uptake by corn roots and xylem transport. Plants were started in wet paper wrapped around each corn seed. When the tap roots were sufficiently long, the seedlings were transplanted to a soil container with the tap root extending out the container bottom. The soil container was then placed over a nutrient solution container, and the solution served as an additional medium for root growth. To conduct an uptake study, a radioactive substance, such as Pu complexed with the bacterial siderophore DFOB, was added to the nutrient solution. After a suitable elapsed time, the corn plant was sacrificed, cut into 10 cm lengths, and the activity distribution measured. Experimental results clarified the basic nature of Pu uptake and transport in corn plants, and resulting simulations suggested that each growing season Pu in the SRS lysimeters would move into the plant shoots and be deposited on the soil surface during the Fall dieback. Subsequent isotope ratio analyses showed that this did happen. OVERALL RESULTS AND CONCLUSIONS - (1) Pu transport downward from the source is controlled by advection, dispersion and adsorption, along with surface-mediated REDOX reactions. (2) Hysteresis, extreme root distribution functions, air-content dependent oxidation rate constants, and large evaporation rates from the soil surface were not able to explain the observed upward migration of Pu. (3) Small amounts of Pu uptake by plant roots and translocation in the transpiration stream creates a realistic mechanism for upward Pu migration (4) Realistic xylem cross-sectional areas imply high flow velocities under hot, wet conditions. Such flow velocities produce the correct shape for the observed activity distributions in the top 20 cm of the lysimeter soil. (5) Simulations imply that Pu should have moved into the above-ground grass tissue each year during the duration of the experiments, resulting in an activity residual accumulating on the soil surface. An isotope ratio analysis showed that
Rural Public Transportation: An Instructional Module.
Hayden, Linda
A concept-based introduction to rural public transportation is provided in this instructional module for undergraduate and graduate transportation-related courses for disciplines such as engineering, business, sociology, and technology. Rural public transportation involves systems in rural and small urban areas with populations under 50,000…
38 CFR 17.1003 - Emergency transportation.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Emergency transportation... Facilities § 17.1003 Emergency transportation. Notwithstanding the provisions of § 17.1002, payment or... the emergency transportation; (c) The veteran has no coverage under a health-plan contract for...
Cremer, Clemens; Neuweiler, Insa
2017-04-01
Knowledge of subsurface solute transport processes is vital to investigate e.g. groundwater contamination, nutrient uptake by plant roots and to implement remediation strategies. Beside field measurements and numerical simulations, physical laboratory experiments represent a way to establish process understanding and furthermore validate numerical schemes. Atmospheric forcings, such as erratically varying infiltration and evaporation cycles, subject the shallow subsurface to local and temporal variations in water content and associated hydraulic conductivity of the prevailing porous media. Those variations in material properties can cause flow paths to differ between upward and downward flow periods. Thereby, the unsaturated subsurface presents a highly complicated, dynamic system. Following an extensive systematical numerical investigation of flow and transport through bimodal, unsaturated porous media under dynamic boundary conditions (Cremer et al., 2016), we conduct physical laboratory experiments in a 22 cm x 8 cm x 1 cm flow cell where we introduce structural heterogeneity in the form sharp material interfaces between different porous media. In all experiments, a constant pressure head is implemented at the lower boundary, while cyclic infiltration-evaporation phases are applied at the soil surface. As a reference case a stationary infiltration with a rate corresponding to the cycle-averaged infiltration rate is applied. By initial application of dye tracers, solute transport within the domain is visualized such that transport paths and redistribution processes can be observed in a qualitative manner. Solute leaching is quantified at the bottom outlet, where breakthrough curves are obtained via spectroscopy. Liquid and vapor flow in and out of the domain is obtained from multiple balances. Thereby, the interplay of material structural heterogeneity and alternating flow (transport) directions and flow (transport) paths is investigated. Results show lateral
Reliability Evaluation Of The City Transport Buses Under Actual Conditions
Directory of Open Access Journals (Sweden)
Rymarz Joanna
2015-12-01
Full Text Available The purpose of this paper was to present a reliability comparison of two types of city transport buses. Case study on the example of the well-known brands of city buses: Solaris Urbino 12 and Mercedes-Benz 628 Conecto L used at Municipal Transport Company in Lublin was presented in details. A reliability index for the most failure parts and complex systems for the period of time failures was determined. The analysis covered damages of the following systems: engine, electrical system, pneumatic system, brake system, driving system, central heating and air-conditioning and doors. Reliability was analyzed based on Weibull model. It has been demonstrated, that during the operation significant reliability differences occur between the buses produced nowadays.
The buckling of fuel rods in transportation casks under hypothetical accident conditions
International Nuclear Information System (INIS)
Bjorkman, G.S.
2004-01-01
The buckling analysis of fuel rods during an end drop impact of a spent fuel transportation cask has traditionally been performed to demonstrate the structural integrity of the fuel rod cladding or the integrity of the fuel geometry in criticality evaluations following a cask drop event. The actual calculation of the fuel rod buckling load, however, has been the subject of some controversy, with estimates of the critical buckling load differing by as much as a factor of 5. Typically, in the buckling analysis of a fuel rod, assumptions are made regarding the percentage of fuel mass that is bonded to or participates with the cladding during the buckling process, with estimates ranging from 0 to 100%. The greater the percentage of fuel mass that is assumed to be bonded to the cladding the higher the inertia loads on the cladding, and, therefore, the lower the ''g'' value at which buckling occurs. Current published solutions do not consider displacement compatibility between the fuel and the cladding. By invoking displacement compatibility between the fuel column and the cladding column, this paper presents an exact solution for the buckling of fuel rods under inertia loading. The results show that the critical inertia load magnitude for the buckling of a fuel rod depends on the weight of the cladding and the total weight of the fuel, regardless of the percentage of fuel mass that is assumed to be attached to or participate with the cladding in the buckling process. Therefore, 100% of the fuel always participates in the buckling of a fuel rod under inertia loading
Transportation and Production Lot-size for Sugarcane under Uncertainty of Machine Capacity
Directory of Open Access Journals (Sweden)
Sudtachat Kanchala
2018-01-01
Full Text Available The integrated transportation and production lot size problems is important effect to total cost of operation system for sugar factories. In this research, we formulate a mathematic model that combines these two problems as two stage stochastic programming model. In the first stage, we determine the lot size of transportation problem and allocate a fixed number of vehicles to transport sugarcane to the mill factory. Moreover, we consider an uncertainty of machine (mill capacities. After machine (mill capacities realized, in the second stage we determine the production lot size and make decision to hold units of sugarcane in front of mills based on discrete random variables of machine (mill capacities. We investigate the model using a small size problem. The results show that the optimal solutions try to choose closest fields and lower holding cost per unit (at fields to transport sugarcane to mill factory. We show the results of comparison of our model and the worst case model (full capacity. The results show that our model provides better efficiency than the results of the worst case model.
Holec, M.; Nikl, J.; Vranic, M.; Weber, S.
2018-04-01
Interaction of high-power lasers with solid targets is in general strongly affected by the limited contrast available. The laser pre-pulse ionizes the target and produces a pre-plasma which can strongly modify the interaction of the main part of the laser pulse with the target. This is of particular importance for future experiments which will use laser intensities above 1021 W cm-2 and which are subject to the limited contrast. As a consequence the main part of the laser pulse will be modified while traversing the pre-plasma, interacting with it partially. A further complication arises from the fact that the interaction of a high-power pre-pulse with solid targets very often takes place under nonlocal transport conditions, i.e. the characteristic mean-free-path of the particles and photons is larger than the characteristic scale-lengths of density and temperature. The classical diffusion treatment of radiation and heat transport in the hydrodynamic model is then insufficient for the description of the pre-pulse physics. These phenomena also strongly modify the formation of the pre-plasma which in turn affects the propagation of the main laser pulse. In this paper nonlocal radiation-hydrodynamic simulations are carried out and serve as input for subsequent kinetic simulations of ultra-high intensity laser pulses interacting with the plasma in the ultra-relativistic regime. It is shown that the results of the kinetic simulations differ considerably whether a diffusive or nonlocal transport is used for the radiation-hydrodynamic simulations.
Crew Transportation Technical Management Processes
Mckinnie, John M. (Compiler); Lueders, Kathryn L. (Compiler)
2013-01-01
Under the guidance of processes provided by Crew Transportation Plan (CCT-PLN-1100), this document, with its sister documents, International Space Station (ISS) Crew Transportation and Services Requirements Document (CCT-REQ-1130), Crew Transportation Technical Standards and Design Evaluation Criteria (CCT-STD-1140), Crew Transportation Operations Standards (CCT STD-1150), and ISS to Commercial Orbital Transportation Services Interface Requirements Document (SSP 50808), provides the basis for a National Aeronautics and Space Administration (NASA) certification for services to the ISS for the Commercial Provider. When NASA Crew Transportation System (CTS) certification is achieved for ISS transportation, the Commercial Provider will be eligible to provide services to and from the ISS during the services phase.
40 CFR 279.43 - Used oil transportation.
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Used oil transportation. 279.43... Facilities § 279.43 Used oil transportation. (a) Deliveries. A used oil transporter must deliver all used oil... comply with all applicable requirements under the U.S. Department of Transportation regulations in 49 CFR...
Effect of temperature on the transport of solvents through PTMSP under ultra-high pressures
International Nuclear Information System (INIS)
Grekhov, A M; Belogorlov, A A; Eremin, Yu S; Pastukhova, E V; Yushkin, A A; Volkov, A V
2016-01-01
Despite a large number of studies, by now there is no any definitive explanation of the solvent transport mechanism in nanostructured polymer materials. Both convective and diffusive transport of solvents can be observed in these materials. The study of the solvents permeability at different temperatures and pressures allow the variation of the physical parameters and structure of the solvent-membrane interaction thus becoming the key factor in the understanding of the fundamental aspects of the selective transport process in nanostructured polymer membranes. The paper presents the study of ethanol, propanol and water transport through poly [1- (trimethylsilyl)-l-propine] (PTMSP) at pressures 50-150 atm and temperature up to 90°C. The study was done by the method of pressure dynamic decay. As the temperature rises, the permeability of ethanol and propanol through PTMSP is shown to increase in proportion to decreasing viscosity that denotes a convective type of transport. As for water, the permeability change is thermo-activated that is typical for a diffusive type of transport. This difference in the transport characteristics can be related to a change in the membrane structure and energetic characteristics of the solvent-polymer interaction. (paper)
Physical protection of radioactive material in transport
International Nuclear Information System (INIS)
1975-01-01
Safety in the transport of radioactive material is ensured by enclosing the material, when necessary, in packaging which prevents its dispersal and which absorbs to any adequate extent any radiation emitted by the material. Transport workers, the general public and the environment are thus protected against the harmful effects of the radioactive material. The packaging also serves the purpose of protecting its contents against the effects of rough handling and mishaps under normal transport conditions, and against the severe stresses and high temperatures that could be encountered in accidents accompanied by fires. If the radioactive material is also fissile, special design features are incorporated to prevent any possibility of criticality under normal transport conditions and in accidents. The safe transport requirements are designed to afford protection against unintentional opening of packages in normal handling and transport conditions and against damage in severe accident conditions; whereas the physical protection requirements are designed to prevent intentional opening of packages and deliberate damage. This clearly illustrates the difference in philosophical approach underlying the requirements for safe transport and for physical protection during transport. This difference in approach is, perhaps, most easily seen in the differing requirements for marking of consignments. While safety considerations dictate that packages be clearly labelled, physical protection considerations urge restraint in the use of special labels. Careful consideration must be given to such differences in approach in any attempt to harmonize the safety and physical protection aspects of transport. (author)
Smirnov, N. A.
2018-03-01
The paper investigates the role of spin-orbit interaction in the prediction of structural stability, lattice dynamics, elasticity, thermodynamic and transport properties (electrical resistivity and thermal conductivity) of lead under pressure with the FP-LMTO (full-potential linear-muffin-tin orbital) method for the first-principles band structure calculations. Our calculations were carried out for three polymorphous lead modifications (fcc, hcp, and bcc) in generalized gradient approximation with the exchange-correlation functional PBEsol. They suggest that compared to the scalar-relativistic calculation, the account for the SO effects insignificantly influences the compressibility of Pb. At the same time, in the calculation of phonon spectra and transport properties, the role of SO interaction is important, at least, for P ≲150 GPa. At higher pressures, the contribution from SO interaction reduces but not vanishes. As for the relative structural stability, our studies show that SO effects influence weakly the pressure of the fcc →hcp transition and much higher the pressure of the hcp →bcc transition.
Energy Technology Data Exchange (ETDEWEB)
Liu, Xinke, E-mail: xkliu@szu.edu.cn, E-mail: wujing026@gmail.com; He, Jiazhu; Tang, Dan; Lu, Youming; Zhu, Deliang; Liu, Wenjun; Cao, Peijiang; Han, Sun [College of Materials Science and Engineering, Shenzhen Engineering Laboratory for Advanced Technology of Ceramics, Nanshan District Key Lab for Biopolymer and Safety Evaluation, Shenzhen University, 3688 Nanhai Ave, Shenzhen 518060 (China); Liu, Qiang; Wen, Jiao; Yu, Wenjie [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, CAS, 865 Chang Ning Road, Shanghai 200050 (China); Liu, Wenjun [State Key Laboratory of ASIC and System, Department of Microelectronics, Fudan University, 220 Handan Road, Shanghai 200433 (China); Wu, Jing, E-mail: xkliu@szu.edu.cn, E-mail: wujing026@gmail.com [Department of Physics, National University of Singapore, 21 Lower Kent Ridge Road, 117576 Singapore (Singapore); He, Zhubing [Department of Materials Science and Engineering, South University of Science and Technology of China, 1088 Xueyuan Road, Shenzhen 518055 (China); Ang, Kah-Wee [Department of Electrical and Computer Engineering, National University of Singapore, 4 Engineering Drive 3, 117583 Singapore (Singapore)
2015-09-28
Large size monolayer Molybdenum disulphide (MoS{sub 2}) was successfully grown by chemical vapor deposition method under an atmospheric pressure. The electrical transport properties of the fabricated back-gate monolayer MoS{sub 2} field effect transistors (FETs) were investigated under low temperatures; a peak field effect mobility of 59 cm{sup 2}V{sup −1}s{sup −1} was achieved. With the assist of Raman measurement under low temperature, this work identified the mobility limiting factor for the monolayer MoS{sub 2} FETs: homopolar phonon scattering under low temperature and electron-polar optical phonon scattering at room temperature.
20 CFR 617.28 - Transportation payments.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Transportation payments. 617.28 Section 617... ASSISTANCE FOR WORKERS UNDER THE TRADE ACT OF 1974 Reemployment Services § 617.28 Transportation payments. (a... transportation expenses if the training is outside the commuting area, but may not receive such assistance if...
Directory of Open Access Journals (Sweden)
Faisal Nadeem
2018-02-01
Full Text Available Foxtail millet (FM [Setaria italica (L. Beauv.] is a grain and forage crop well adapted to nutrient-poor soils. To date little is known how FM adapts to low nitrogen (LN at the morphological, physiological, and molecular levels. Using the FM variety Yugu1, we found that LN led to lower chlorophyll contents and N concentrations, and higher root/shoot and C/N ratios and N utilization efficiencies under hydroponic culture. Importantly, enhanced biomass accumulation in the root under LN was in contrast to a smaller root system, as indicated by significant decreases in total root length; crown root number and length; and lateral root number, length, and density. Enhanced carbon allocation toward the root was rather for significant increases in average diameter of the LN root, potentially favorable for wider xylem vessels or other anatomical alterations facilitating nutrient transport. Lower levels of IAA and CKs were consistent with a smaller root system and higher levels of GA may promote root thickening under LN. Further, up-regulation of SiNRT1.1, SiNRT2.1, and SiNAR2.1 expression and nitrate influx in the root and that of SiNRT1.11 and SiNRT1.12 expression in the shoot probably favored nitrate uptake and remobilization as a whole. Lastly, more soluble proteins accumulated in the N-deficient root likely as a result of increases of N utilization efficiencies. Such “excessive” protein-N was possibly available for shoot delivery. Thus, FM may preferentially transport carbon toward the root facilitating root thickening/nutrient transport and allocate N toward the shoot maximizing photosynthesis/carbon fixation as a primary adaptive strategy to N limitation.
Nadeem, Faisal; Ahmad, Zeeshan; Wang, Ruifeng; Han, Jienan; Shen, Qi; Chang, Feiran; Diao, Xianmin; Zhang, Fusuo; Li, Xuexian
2018-01-01
Foxtail millet (FM) [ Setaria italica (L.) Beauv.] is a grain and forage crop well adapted to nutrient-poor soils. To date little is known how FM adapts to low nitrogen (LN) at the morphological, physiological, and molecular levels. Using the FM variety Yugu1, we found that LN led to lower chlorophyll contents and N concentrations, and higher root/shoot and C/N ratios and N utilization efficiencies under hydroponic culture. Importantly, enhanced biomass accumulation in the root under LN was in contrast to a smaller root system, as indicated by significant decreases in total root length; crown root number and length; and lateral root number, length, and density. Enhanced carbon allocation toward the root was rather for significant increases in average diameter of the LN root, potentially favorable for wider xylem vessels or other anatomical alterations facilitating nutrient transport. Lower levels of IAA and CKs were consistent with a smaller root system and higher levels of GA may promote root thickening under LN. Further, up-regulation of SiNRT1.1, SiNRT2.1, and SiNAR2.1 expression and nitrate influx in the root and that of SiNRT1.11 and SiNRT1.12 expression in the shoot probably favored nitrate uptake and remobilization as a whole. Lastly, more soluble proteins accumulated in the N-deficient root likely as a result of increases of N utilization efficiencies. Such "excessive" protein-N was possibly available for shoot delivery. Thus, FM may preferentially transport carbon toward the root facilitating root thickening/nutrient transport and allocate N toward the shoot maximizing photosynthesis/carbon fixation as a primary adaptive strategy to N limitation.
Electronic transport in VO2—Experimentally calibrated Boltzmann transport modeling
International Nuclear Information System (INIS)
Kinaci, Alper; Rosenmann, Daniel; Chan, Maria K. Y.; Kado, Motohisa; Ling, Chen; Zhu, Gaohua; Banerjee, Debasish
2015-01-01
Materials that undergo metal-insulator transitions (MITs) are under intense study, because the transition is scientifically fascinating and technologically promising for various applications. Among these materials, VO 2 has served as a prototype due to its favorable transition temperature. While the physical underpinnings of the transition have been heavily investigated experimentally and computationally, quantitative modeling of electronic transport in the two phases has yet to be undertaken. In this work, we establish a density-functional-theory (DFT)-based approach with Hubbard U correction (DFT + U) to model electronic transport properties in VO 2 in the semiconducting and metallic regimes, focusing on band transport using the Boltzmann transport equations. We synthesized high quality VO 2 films and measured the transport quantities across the transition, in order to calibrate the free parameters in the model. We find that the experimental calibration of the Hubbard correction term can efficiently and adequately model the metallic and semiconducting phases, allowing for further computational design of MIT materials for desirable transport properties
41 CFR 50-204.75 - Transportation safety.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety. 50... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to...
THEORETICAL AND EXPERIMENTAL MODELING OF MULTI-SPECIES TRANSPORT IN SOILS UNDER ELECTRIC FIELDS
Electrokinetics employs the use of electrodes implanted in soils-contaminated media. Electrodes are supplied with direct current (dc) facilitating ionic transport and subsequent removal. This project investigates the feasibility and efficiency of electrokinetic transport of lea...
Bagniewska-Zadworna, Agnieszka; Byczyk, Julia; Eissenstat, David M; Oleksyn, Jacek; Zadworny, Marcin
2012-09-01
Root systems develop to effectively absorb water and nutrients and to rapidly transport these materials to the transpiring shoot. In woody plants, roots can be born with different functions: fibrous roots are primarily used for water and nutrient absorption, whereas pioneer roots have a greater role in transport. Because pioneer roots extend rapidly in the soil and typically quickly produce fibrous roots, they need to develop transport capacity rapidly so as to avoid becoming a bottleneck to the absorbed water of the developing fibrous roots and, as we hypothesized, immediately activate a specific type of autophagy at a precise time of their development. Using microscopy techniques, we monitored xylem development in Populus trichocarpa roots in the first 7 d after emergence under field conditions. Newly formed pioneer roots contained more primary xylem poles and had larger diameter tracheary elements than fibrous roots. While xylogenesis started later in pioneer roots than in fibrous, it was completed at the same time, resulting in functional vessels on the third to fourth day following root emergence. Programmed cell death was responsible for creating the water conducting capacity of xylem. Although the early xylogenesis processes were similar in fibrous and pioneer roots, secondary vascular development proceeded much more rapidly in pioneer roots. Compared to fibrous roots, rapid development of transport capacity in pioneer roots is not primarily caused by accelerated xylogenesis but by larger and more numerous tracheary elements and by rapid initiation of secondary growth.
Tomorrow's Transportation Market : Developing an Innovative, Seamless Transportation System
2013-04-17
With the cost of congestion in the United States estimated to be in the order of $121 billion, transportation planners are under increasing pressure to improve conditions and meet projected demand increases. Harnessing emerging technologies to develo...
29 CFR 780.909 - “Transportation.”
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false âTransportation.â 780.909 Section 780.909 Labor Regulations... Vegetable Harvest Transportation; Exemption From Overtime Pay Requirements Under Section 13(b)(16) Exempt Operations on Fruits Or Vegetables § 780.909 “Transportation.” “Transportation,” as used in section 13(b)(16...
Koohbor, Behshad; Fahs, Marwan; Ataie-Ashtiani, Behzad; Simmons, Craig T.; Younes, Anis
2018-05-01
Existing closed-form solutions of contaminant transport problems are limited by the mathematically convenient assumption of uniform flow. These solutions cannot be used to investigate contaminant transport in coastal aquifers where seawater intrusion induces a variable velocity field. An adaptation of the Fourier-Galerkin method is introduced to obtain semi-analytical solutions for contaminant transport in a confined coastal aquifer in which the saltwater wedge is in equilibrium with a freshwater discharge flow. Two scenarios dealing with contaminant leakage from the aquifer top surface and contaminant migration from a source at the landward boundary are considered. Robust implementation of the Fourier-Galerkin method is developed to efficiently solve the coupled flow, salt and contaminant transport equations. Various illustrative examples are generated and the semi-analytical solutions are compared against an in-house numerical code. The Fourier series are used to evaluate relevant metrics characterizing contaminant transport such as the discharge flux to the sea, amount of contaminant persisting in the groundwater and solute flux from the source. These metrics represent quantitative data for numerical code validation and are relevant to understand the effect of seawater intrusion on contaminant transport. It is observed that, for the surface contamination scenario, seawater intrusion limits the spread of the contaminant but intensifies the contaminant discharge to the sea. For the landward contamination scenario, moderate seawater intrusion affects only the spatial distribution of the contaminant plume while extreme seawater intrusion can increase the contaminant discharge to the sea. The developed semi-analytical solution presents an efficient tool for the verification of numerical models. It provides a clear interpretation of the contaminant transport processes in coastal aquifers subject to seawater intrusion. For practical usage in further studies, the full
International Nuclear Information System (INIS)
Martin, R.C.
1990-01-01
The passage of energetic ions through semiconductor devices generates excess charge which can produce logic upset, memory change, and device damage. This single event upset (SEU) phenomenon is increasingly important for satellite communications. Experimental and numerical simulation of SEUs is difficult because of the subnanosecond times and large charge densities within the ion track. The objective of this work is twofold: (1) the determination of the track structure and electron-hole pair generation profiles following the passage of an energetic ion; (2) the development and application of a new numerical method for transient charge transport in semiconductor devices. A secondary electron generation and transport model, based on the Monte Carlo method, is developed and coupled to an ion transport code to simulate ion track formation in silicon. A new numerical method is developed for the study of transient charge transport. The numerical method combines an axisymmetric quadratic finite-element formulation for the solution of the potential with particle simulation methods for electron and hole transport. Carrier transport, recombination, and thermal generation of both majority and minority carriers are included. To assess the method, transient one-dimensional solutions for silicon diodes are compared to a fully iterative finite-element method. Simulations of charge collection from ion tracks in three-dimensional axisymmetric devices are presented and compared to previous work. The results of this work for transient current pulses following charged ion passage are in agreement with recent experimental data
Transport of plutonium nitrate
International Nuclear Information System (INIS)
1982-02-01
This leaflet discusses the subject under the headings: why do we need plutonium; why must we transport it; what action is carried out; how is it moved; what are the risks. The transport of the material in specially designed containers, from Dounreay in Caithness by road and sea to Sellafield in Cumbria, is described. (U.K.)
Regarding the unitary theory of agonist and antagonist action at presynaptic adrenoceptors.
Kalsner, S; Abdali, S A
2001-06-01
1. The linkage between potentiation of field stimulation-induced noradrenaline release and blockade of the presynaptic inhibitory effect of exogenous noradrenaline by a presynaptic antagonist was examined in superfused rabbit aorta preparations. 2. Rauwolscine clearly potentiated the release of noradrenaline in response to 100 pulses at 2 Hz but reduced the capacity of noradrenaline to inhibit transmitter release to a questionable extent, and then only when comparisons were made with untreated, rather then to rauwolscine-treated, controls. 3. Aortic preparations exposed for 60 min to rauwolscine followed by superfusion with antagonist-free Krebs for 60 min retained the potentiation of stimulation-induced transmitter release but no antagonism of the noradrenaline-induced inhibition could be detected at either of two noradrenaline concentrations when comparisons were made with rauwolscine treated controls. 4. Comparisons of the inhibitory effect of exogenous noradrenaline (1.8 x 10-6 M) on transmitter efflux in the presence and absence of rauwolscine pretreatment revealed that the antagonist enhanced rather than antagonized the presynaptic inhibition by noradrenaline. 5 It is concluded that the unitary hypothesis that asserts that antagonist enhancement of transmitter release and its blockade of noradrenaline induced inhibition are manifestations of a unitary event are not supportable.
Time-dependent 2-stream particle transport
International Nuclear Information System (INIS)
Corngold, Noel
2015-01-01
Highlights: • We consider time-dependent transport in the 2-stream or “rod” model via an attractive matrix formalism. • After reviewing some classical problems in homogeneous media we discuss transport in materials with whose density may vary. • There we achieve a significant contraction of the underlying Telegrapher’s equation. • We conclude with a discussion of stochastics, treated by the “first-order smoothing approximation.” - Abstract: We consider time-dependent transport in the 2-stream or “rod” model via an attractive matrix formalism. After reviewing some classical problems in homogeneous media we discuss transport in materials whose density may vary. There we achieve a significant contraction of the underlying Telegrapher’s equation. We conclude with a discussion of stochastics, treated by the “first-order smoothing approximation.”
Ogino, Hirokazu; Nishimura, Naoki; Yamano, Yasuhiko; Ishikawa, Genta; Tomishima, Yutaka; Jinta, Torahiko; Takahashi, Osamu; Chohnabayashi, Naohiko
2016-01-01
High-flow oxygen is often administered to patients during emergency transport and can sometimes cause respiratory acidosis with disturbed consciousness, thereby necessitating mechanical ventilation. Although oxygen titration in chronic obstructive pulmonary disease patients during emergency transport reduces mortality rates, the clinical risk factors for respiratory acidosis in emergency settings are not fully understood. Therefore, we analyzed the clinical backgrounds of patients who developed respiratory acidosis during pre-hospital transport. This was a retrospective study of patients who arrived at our hospital by emergency transport in 2010 who received high-flow oxygen while in transit. Respiratory acidosis was defined by the following arterial blood gas readings: pH, ≤7.35; PaCO 2 , ≥45 mmHg; and HCO 3 - , ≥24 mmol/L. The risk factors were identified using multivariable logistic regression analysis. In 765 study patients, 66 patients showed respiratory acidosis. The following risk factors for respiratory acidosis were identified: age, ≥65 years (odds ratio [OR] 1.4; 95% confidence interval [CI], 0.7-2.8); transportation time, ≥10 min (OR 2.0; 95% CI, 1.1-3.7); three digits on the Japan Coma Scale (OR 3.1; 95% CI, 1.7-5.8); percutaneous oxygen saturation, ≤90% (OR 1.6; 95% CI, 0.8-3.0); tuberculosis (OR 4.5; 95% CI, 1.4-15.1); asthma (OR 1.8; 95% CI, 0.6-5.3); pneumonia (OR 1.5; 95% CI, 0.7-3.1); and lung cancer (OR 3.9; 95% CI, 1.5-10.1). These underlying diseases as risk factors included both comorbid diseases and past medical conditions. The factors identified may contribute to the development of respiratory acidosis. Further studies on preventing respiratory acidosis will improve the quality of emergency medical care.
Optimization of cask for transport of radioactive material under impact loading
Energy Technology Data Exchange (ETDEWEB)
Sharma, Kuldeep, E-mail: kuldeep.brit@gmail.com [Indian Institute of Technology Bombay (India); Pawaskar, D.N.; Guha, Anirban [Indian Institute of Technology Bombay (India); Singh, R.K. [Bhabha Atomic Research Center (India)
2014-07-01
Highlights: • Cost and weight are important criteria for fabrication and transportation of cask used for transportation of radioactive material. • Reduction of cask cost by modifying few cask geometry parameters using complex search method. • Maximum von Mises stress generated and deformation after impact as design constraints. • Up to 6.9% reduction in cost and 4.6% reduction in weight observed in the examples used. - Abstract: Casks used for transporting radioactive material need to be certified fit by subjecting them to a specific set of tests (IAEA, 2012). The high cost of these casks gives rise to the need for optimizing them. Conducting actual experiments for the process of design iterations is very costly. This work outlines a procedure for optimizing Type B(U) casks through simulations of the 9 m drop test conducted in ABAQUS{sup ®}. Standard designs and material properties were chosen, thus making the process as realistic as reasonable even at the cost of reducing the options (design variables) available for optimization. The results, repeated for different source cavity sizes, show a scope for 6.9% reduction in cost and 4.6% reduction in weight over currently used casks.
Shielding requirements for the transport of nuclear warhead components under decommissioning
International Nuclear Information System (INIS)
Hansen, L.F.
1994-09-01
The requirements to carry out accurate shielding calculations involved with the safe off-site transportation of packages containing nuclear warhead components, special assemblies and radioactive materials are discussed. The need for (a) detailed information on the geometry and material composition of the packaging and radioactive load, (b) accurate representation of the differential energy spectra (dN/dE) for the neutron and gamma spectra emitted by the radioactive materials enclosed in the packaging, (c) well-tested neutron and photon cross section libraries, (d) and accurate three-dimensional Monte Carlo transport codes are illustrated. A brief discussion of the need for reliable dose measurements is presented
[Hereditary factors in attention deficit hyperactivity disorder
Fliers, E.A.; Franke, B.
2005-01-01
Attention deficit hyperactivity disorder (ADHD) is a neurodevelopmental disorder characterized by concentration problems, hyperactivity and impulsivity. Disturbances in dopamine and/or noradrenalin neurotransmission are probably the underlying pathophysiological mechanisms of ADHD. Around 80% of
2010-07-01
... fees do not include title transfer fees. (9) Payments for a volumetric deduction to cover shrinkage.... (8) Gauging fees. (d) If your arm's-length transportation contract includes more than one liquid...
Carbohydrate production and transport in cotton cultivars grown under boron deficiency
Directory of Open Access Journals (Sweden)
Julio Cesar Bogiani
2013-12-01
Full Text Available An adequate supply of boron (B is required for the optimal growth and development of cotton (Gossypium hirsutum L. plants, but the low phloem mobility of B limits the possibilities of correcting B deficiency. There are indications that different cotton cultivars could have different responses to B deficiency. The differences in responses of cotton cultivars to B regarding photoassimilate production and transport were studied in a greenhouse experiment with nutrient solution. Treatments consisted of three cotton cultivars (FMT 701, DP 604BG and FMX 993 and five concentrations of B (0.0, 2.5, 5.0, 10.0 and 20.0 µmol L−1. Sampling began at the phenological stage B1 (first square and continued for four weeks. The leaf area and the number of reproductive branches and structures decreased due to B deficiency. A higher level of abortion of reproductive structures was observed under B deficiency. Boron deficiency increased the internal CO2 concentration but decreased the transpiration rate, stomatal conductance and photosynthesis. Despite the decrease in photosynthesis, nonstructural carbohydrates accumulated in the leaves due to decreased export to bolls in B-deficient plants. The response to B deficiency is similar among cotton cultivars, which shows that the variability for this trait is low even for cultivars with different genetic backgrounds.
18 CFR 284.9 - Interruptible transportation service.
2010-04-01
... transportation service. 284.9 Section 284.9 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... AUTHORITIES CERTAIN SALES AND TRANSPORTATION OF NATURAL GAS UNDER THE NATURAL GAS POLICY ACT OF 1978 AND RELATED AUTHORITIES General Provisions and Conditions § 284.9 Interruptible transportation service. (a...
Directory of Open Access Journals (Sweden)
Bin Xu
2016-05-01
Full Text Available A lot of physical properties of Th2S3-type Ti2O3 have investigated experimentally, hence, we calculated electronic structure and thermoelectric transport properties by the first-principles calculation under pressure. The increase of the band gaps is very fast from 30GP to 35GP, which is mainly because of the rapid change of the lattice constants. The total density of states becomes smaller with increasing pressure, which shows that Seebeck coefficient gradually decreases. Two main peaks of Seebeck coefficients always decrease and shift to the high doping area with increasing temperature under pressure. The electrical conductivities always decrease with increasing temperature under pressure. The electrical conductivity can be improved by increasing pressure. Electronic thermal conductivity increases with increasing pressure. It is noted that the thermoelectric properties is reduced with increasing temperature.
Duan, Yanzhi
2017-01-01
The gas pipeline networks in Sichuan and Chongqing (Sichuan-Chongqing) region have formed a fully-fledged gas pipeline transportation system in China, which supports and promotes the rapid development of gas market in Sichuan-Chongqing region. In the circumstances of further developed market-oriented economy, it is necessary to carry out further the pipeline system reform in the areas of investment/financing system, operation system and pricing system to lay a solid foundation for improving future gas production and marketing capability and adapting itself to the national gas system reform, and to achieve the objectives of multiparty participated pipeline construction, improved pipeline transportation efficiency and fair and rational pipeline transportation prices. In this article, main thinking on reform in the three areas and major deployment are addressed, and corresponding measures on developing shared pipeline economy, providing financial support to pipeline construction, setting up independent regulatory agency to enhance the industrial supervision for gas pipeline transportation, and promoting the construction of regional gas trade market are recommended.
Vidgren, Virve; Londesborough, John
2018-05-31
Plain and fluorescently tagged versions of Agt1, Mtt1 and Malx1 maltose transporters were over-expressed in two laboratory yeasts and one lager yeast. The plain and tagged versions of each transporter supported similar transport activities, indicating that they are similarly trafficked and have similar catalytic activities. When they were expressed under the control of the strong constitutive PGK1 promoter only minor proportions of the fluorescent transporters were associated with the plasma membrane, the rest being found in intracellular structures. Transport activity of each tagged transporter in each host was roughly proportional to the plasma membrane-associated fluorescence. All three transporters were subject to glucose-triggered inactivation when the medium glucose concentration was abruptly raised. Results also suggest competition between endogenous and over-expressed transporters for access to the plasma membrane. This article is protected by copyright. All rights reserved.
Vinogradova, A. A.; Ivanova, Yu. A.; Veremeychik, A. O.
2012-04-01
Nature reserves are created to keep in their original states natural environment, flora and fauna of various ecological systems, territories, climatic zones, etc. Now natural objects everywhere exist under anthropogenic loading from man-made activities. It is impossible to avoid atmospheric or river transport of pollution to the environment of reserved territories. The main idea of the work is to analyze atmospheric transport of anthropogenic metals (Ni, Cu, Pb, Fe, Al), as well as of soot (black carbon - BC) from Russian large industrial areas (source-regions) to the territories of nature reserves at the North of European Russia - the Kostomukshsky reserve (KR) in Karelia (64.57°N, 30.67°E) and the Nenetzky reserve (NR) at the Pechora River mouth (68,5°N, 53,5°E). The basic data for these 2 points were back trajectories of air mass transport calculated for every day of January, April, July, and October during 10 years from 2001 to 2010. We used NCEP/NCAR Reanalysis Data Files with HYSPLIT 4 model and two approaches for analyzing the trajectories. The main source-regions were chosen for each reserve. The annual source emissions for the last decade are generalized from the data published by Roshydromet of Russia (http://www.nii-atmosphere.ru/files/PUBL/Eg_2008.doc). The deposition velocity was a sum of dry and wet components. The equal values of deposition velocities onto the surface were assumed for all impurities because they are mainly on submicron aerosol particles under atmospheric transport for a long distance. The seasonal and spatial variations of averaged deposition velocity were accounted in accordance with surface properties and precipitation regimes. As a result, the maximal air concentrations of aerosol pollutants are observed in cold seasons, whereas the maximal fluxes onto the surface occur in warm period. Thus, it's possible that the cleanest air does not indicate the same surface. Fe and Al are the crust (dust or soil) elements. Thus, their main
Jackson, D.; Delgado-Fernandez, I.; Lynch, K.; Baas, A. C.; Cooper, J. A.; Beyers, M.
2010-12-01
The input of aeolian sediment into foredune systems from beaches represents a key component of sediment budget analysis along many soft sedimentary coastlines. Where there are significant offshore wind components in local wind regimes this is normally excluded from analysis. However, recent work has shown that if the topography of the foredune is favourable then this offshore component is steered or undergoes flow reversal through leeside eddying to give onshore transport events at the back beach under offshore flow conditions. At particular distances from the foredune crest flow reattaches to the surface to continue its incident offshore direction. The location of this reattachment point has important implications for aeolian transport of sand on the back beach and foredune toe locations. This study reports initial results where the positioning of the reattachment point is mobile and is driven by incident wind velocity (at the foredune crest) and the actual undulations of the foredune crest’s topography, dictating heterogeneous flow behaviour at the beach. Using detailed field measurements (25 Hz, three-dimensional sonic anemometry) and computational fluid dynamic modelling, a temporal and spatial pattern of reattachment positions are described. Implications for aeolian transport and dune evolution are also examined.
Haberer, Christina M; Rolle, Massimo; Liu, Sanheng; Cirpka, Olaf A; Grathwohl, Peter
2011-03-25
Oxygen transport across the capillary fringe is relevant for many biogeochemical processes. We present a non-invasive technique, based on optode technology, to measure high-resolution concentration profiles of oxygen across the unsaturated/saturated interface. By conducting a series of quasi two-dimensional flow-through laboratory experiments, we show that vertical hydrodynamic dispersion in the water-saturated part of the capillary fringe is the process limiting the mass transfer of oxygen. A number of experimental conditions were tested in order to investigate the influence of grain size and horizontal flow velocity on transverse vertical dispersion in the capillary fringe. In the same setup, analogous experiments were simultaneously carried out in the fully water-saturated zone, therefore allowing a direct comparison with oxygen transfer across the capillary fringe. The outcomes of the experiments under various conditions show that oxygen transport in the two zones of interest (i.e., the unsaturated/saturated interface and the saturated zone) is characterized by very similar transverse dispersion coefficients. An influence of the capillary fringe morphology on oxygen transport has not been observed. These results may be explained by the narrow grain size distribution used in the experiments, leading to a steep decline in water saturation at the unsaturated/saturated interface and to the absence of trapped gas in this transition zone. We also modeled flow (applying the van Genuchten and the Brooks-Corey relationships) and two-dimensional transport across the capillary fringe, obtaining simulated profiles of equivalent aqueous oxygen concentration that were in good agreement with the observations. Copyright © 2010 Elsevier B.V. All rights reserved.
Sandpile dynamics as a paradigm for turbulent transport
International Nuclear Information System (INIS)
Newman, D.E.; Carreras, B.A.; Diamond, P.H.
1995-01-01
To shed some light on the apparent discrepancies between most theoretical models of turbulent transport and experimental observations of the transport in magnetically confined plasmas, a model for transport has been developed based on the concept of self-organized criticality (SOC). This model seeks to describe the dynamics of the transport without relying on the underlying local fluctuation mechanisms. Computations based on a cellular automata model have found that SOC systems maintain average profiles that are linearly stable (submarginal) and yet are able to sustain active transport dynamics in contrast to naive marginal stability arguments. It is also found that the dominant scales in the transport dynamics in the absence of sheared flow are system scales rather than the underlying local fluctuation scales. However, the addition of sheared flow into the dynamics leads to a large reduction of the system-scale transport events and a commensurate increase in the fluctuation-scale transport events needed to maintain the constant flux. The dynamics of these models and the potential ramifications for transport studies are discussed
Optimization of the transporting beam for the CMS Barrel under a displacement constraint
AUTHOR|(CDS)2139604; Spadinger, Markus
The aim of this research was to find the optimal solution for the design of the new transporting beam for the Compact Muon Solenoid (CMS) Barrel. Once the new crane in the experimental cavern is installed, the previous design of the beam will become obsolete due to its weight. The current beam is made from steel and has four air-pads to support it. The new design of the beam, which will be presented in this thesis, will be made of aluminium alloy and will have only two air-pads supporting it. Two main issues that guided the direction of this research were the concentrations of stresses and the displacements due to bending. At the beginning of the research, all of the focus will be on the beam. This approach will prove to be limited, which will lead to the gradual inclusion of other interfacing components in the analysis. In order to correctly mimic the behaviour of the beam under such loads, representative models of the air-pads will be introduced into the Finite Element Analysis (FEA). Part of the original B...
DEFF Research Database (Denmark)
Bouzinova, Elena; Wiborg, Ove; Aalkjær, Christian
Major depression and cardiovascular diseases have strong co-morbidity but the reason for this is unknown. In CMS model of depression only some rats develop depression-like symptoms (i.e. anhedonia, measured by sucrose intake) while others are resilient to 8 weeks of CMS. Anhedonic rats have...... decreased cardiac output and unchanged blood pressure, suggesting increased total peripheral resistance. Small mesenteric and femoral arteries from CMS and non-stressed rats responded similarly to noradrenaline (NA) under control conditions but inhibition of neuronal reuptake with cocaine increased NA...... sensitivity stronger in anhedonic than in resilient and non-stressed groups. In contrast, corticosterone-sensitive extra-neuronal monoamine uptake was diminished in rats exposed to CMS. These changes in monoamine homeostasis were associated with upregulation neuronal NA transporter and reduced expression...
ADVANCED CUTTINGS TRANSPORT STUDY
Energy Technology Data Exchange (ETDEWEB)
Stefan Miska; Troy Reed; Ergun Kuru
2004-09-30
The Advanced Cuttings Transport Study (ACTS) was a 5-year JIP project undertaken at the University of Tulsa (TU). The project was sponsored by the U.S. Department of Energy (DOE) and JIP member companies. The objectives of the project were: (1) to develop and construct a new research facility that would allow three-phase (gas, liquid and cuttings) flow experiments under ambient and EPET (elevated pressure and temperature) conditions, and at different angle of inclinations and drill pipe rotation speeds; (2) to conduct experiments and develop a data base for the industry and academia; and (3) to develop mechanistic models for optimization of drilling hydraulics and cuttings transport. This project consisted of research studies, flow loop construction and instrumentation development. Following a one-year period for basic flow loop construction, a proposal was submitted by TU to the DOE for a five-year project that was organized in such a manner as to provide a logical progression of research experiments as well as additions to the basic flow loop. The flow loop additions and improvements included: (1) elevated temperature capability; (2) two-phase (gas and liquid, foam etc.) capability; (3) cuttings injection and removal system; (4) drill pipe rotation system; and (5) drilling section elevation system. In parallel with the flow loop construction, hydraulics and cuttings transport studies were preformed using drilling foams and aerated muds. In addition, hydraulics and rheology of synthetic drilling fluids were investigated. The studies were performed under ambient and EPET conditions. The effects of temperature and pressure on the hydraulics and cuttings transport were investigated. Mechanistic models were developed to predict frictional pressure loss and cuttings transport in horizontal and near-horizontal configurations. Model predictions were compared with the measured data. Predominantly, model predictions show satisfactory agreements with the measured data. As a
29 CFR 780.911 - Preparation for transportation.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Preparation for transportation. 780.911 Section 780.911... Employment in Fruit and Vegetable Harvest Transportation; Exemption From Overtime Pay Requirements Under Section 13(b)(16) Exempt Operations on Fruits Or Vegetables § 780.911 Preparation for transportation. The...
Boron transport in plants: co-ordinated regulation of transporters
Miwa, Kyoko; Fujiwara, Toru
2010-01-01
Background The essentiality of boron (B) for plant growth was established >85 years ago. In the last decade, it has been revealed that one of the physiological roles of B is cross-linking the pectic polysaccharide rhamnogalacturonan II in primary cell walls. Borate cross-linking of pectic networks serves both for physical strength of cell walls and for cell adhesion. On the other hand, high concentrations of B are toxic to plant growth. To avoid deficiency and toxicity problems, it is important for plants to maintain their tissue B concentrations within an optimum range by regulating transport processes. Boron transport was long believed to be a passive, unregulated process, but the identification of B transporters has suggested that plants sense and respond to the B conditions and regulate transporters to maintain B homeostasis. Scope Transporters responsible for efficient B uptake by roots, xylem loading and B distribution among leaves have been described. These transporters are required under B limitation for efficient acquisition and utilization of B. Transporters important for tolerating high B levels in the environment have also been identified, and these transporters export B from roots back to the soil. Two types of transporters are involved in these processes: NIPs (nodulin-26-like intrinsic proteins), boric acid channels, and BORs, B exporters. It is demonstrated that the expression of genes encoding these transporters is finely regulated in response to B availability in the environment to ensure tissue B homeostasis. Furthermore, plants tolerant to stress produced by low B or high B in the environment can be generated through altered expression of these transporters. Conclusions The identification of the first B transporter led to the discovery that B transport was a process mediated not only by passive diffusion but also by transporters whose activity was regulated in response to B conditions. Now it is evident that plants sense internal and external B
Tang, K. P. M.; Chau, K. H.; Kan, C. W.; Fan, J. T.
2015-11-01
The water absorption and transport properties of fabrics are critical to wear comfort, especially for sportswear and protective clothing. A new testing apparatus, namely Forced Flow Water Transport Tester (FFWTT), was developed for characterizing the transplanar and in-plane wicking properties of fabrics based on gravimetric and image analysis technique. The uniqueness of this instrument is that the rate of water supply is adjustable to simulate varying sweat rates with reference to the specific end-use conditions ranging from sitting, walking, running to other strenuous activities. This instrument is versatile in terms of the types of fabrics that can be tested. Twenty four types of fabrics with varying constructions and surface finishes were tested. The results showed that FFWTT was highly sensitive and reproducible in differentiating these fabrics and it suggests that water absorption and transport properties of fabrics are sweat rate-dependent. Additionally, two graphic methods were proposed to map the direction of liquid transport and its relation to skin wetness, which provides easy and direct comparison among different fabrics. Correlation analysis showed that FFWTT results have strong correlation with subjective wetness sensation, implying validity and usefulness of the instrument.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Ruichang [Chinese Academy of Sciences, Key Laboratory of Soil Environment and Pollution Remediation, Institute of Soil Science (China); Zhang, Haibo; Tu, Chen; Hu, Xuefeng; Li, Lianzhen [Chinese Academy of Sciences, Key Laboratory of Coastal Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research (China); Luo, Yongming, E-mail: ymluo@yic.ac.cn; Christie, Peter [Chinese Academy of Sciences, Key Laboratory of Soil Environment and Pollution Remediation, Institute of Soil Science (China)
2015-04-15
The transport behavior of titanium dioxide nanoparticles (TiO{sub 2} NPs, 30 nm in diameter) was studied in well-defined porous media composed of clean quartz sand over a range of solution chemistry under acidic conditions. Transport of TiO{sub 2} NPs was dramatically enhanced by humic substances (HS) at acidic pH (4.0, 5.0 and 6.0), even at a low HS concentration of 0.5 mg L{sup −1}. Facilitated transport of TiO{sub 2} NPs was likely attributable to the increased stability of TiO{sub 2} NPs and repulsive interaction between TiO{sub 2} NPs and quartz sands due to the adsorbed HS. The mobility of TiO{sub 2} NPs was also increased with increasing pH from 4.0 to 6.0. Although transport of TiO{sub 2} NPs was insensitive to low ionic strength, it was significantly inhibited by high concentrations of NaCl and CaCl{sub 2}. In addition, calculated Derjaguin–Landau–Verwey–Overbeek (DLVO) interaction energy indicated that high energy barriers were responsible for the high mobility of TiO{sub 2} NPs, while the secondary energy minimum could play an important role in the retention of TiO{sub 2} NPs at 100 mmol L{sup −1} NaCl. Straining and gravitational settlement of larger TiO{sub 2} NPs aggregates at 1 mg L{sup −1} HS, pH 5.0, and 2 mmol L{sup −1} CaCl{sub 2} could be responsible for the significant retention even in the presence of high energy barriers. Moreover, more favorable interaction between approaching TiO{sub 2} NPs and TiO{sub 2} NPs that had been already deposited on the collector resulted in a ripening-shape breakthrough curve at 2 mmol L{sup −1} CaCl{sub 2}. Overall, a combination of mechanisms including DLVO-type force, straining, and physical filtration was involved in the retention of TiO{sub 2} NPs over the range of solution chemistry examined in this study.
Directory of Open Access Journals (Sweden)
O'Donovan Michael
2008-05-01
Full Text Available Abstract Background The most effective pharmacological treatments for depression inhibit the transporters that reuptake serotonin (Selective Serotonin Reuptake Inhibitors – SSRIs and noradrenaline (Noradrenaline Reuptake Inhibitors – NaRIs into the presynaptic terminal. There is evidence to suggest that noradrenaline and serotonin enhancing drugs work through separate mechanisms to produce their clinical antidepressant action. Although most of the current evidence suggests there is little difference in overall efficacy between SSRIs and NaRIs, there are patients who respond to one class of compounds and not another. This suggests that treatment response could be predicted by genetic and/or clinical characteristics. Firstly, this study aims to investigate the influence of a polymorphism (SLC6A4 in the 5HT transporter in altering response to SSRI medication. Secondly, the study will investigate whether those with more severe depression have a better response to NaRIs than SSRIs. Methods/design The GenPod trial is a multi-centre randomised controlled trial. GPs referred patients aged between 18–74 years presenting with a new episode of depression, who did not have any medical contraindications to antidepressant medication and who had no history of psychosis or alcohol/substance abuse. Patients were interviewed to ascertain their suitability for the study. Eligible participants (with a primary diagnosis of depression according to ICD10 criteria and a Beck Depression Inventory (BDI score > 14 were randomised to receive one of two antidepressant treatments, either the SSRI Citalopram or the NaRI Reboxetine, stratified according to severity. The final number randomised to the trial was 601. Follow-up assessments took place at 2, 6 and 12 weeks following randomisation. Primary outcome was measured at 6 weeks by the BDI. Outcomes will be analysed on an intention-to-treat basis and will use multiple regression models to compare treatments
Modeling of water and solute transport under variably saturated conditions: state of the art
International Nuclear Information System (INIS)
Lappala, E.G.
1980-01-01
This paper reviews the equations used in deterministic models of mass and energy transport in variably saturated porous media. Analytic, quasi-analytic, and numerical solution methods to the nonlinear forms of transport equations are discussed with respect to their advantages and limitations. The factors that influence the selection of a modeling method are discussed in this paper; they include the following: (1) the degree of coupling required among the equations describing the transport of liquids, gases, solutes, and energy; (2) the inclusion of an advection term in the equations; (3) the existence of sharp fronts; (4) the degree of nonlinearity and hysteresis in the transport coefficients and boundary conditions; (5) the existence of complex boundaries; and (6) the availability and reliability of data required by the models
2007-01-01
Faculty ii INDUSTRY TRAVEL Domestic Assistant Deputy Under Secretary of Defense (Transportation Policy), Washington, DC Department of...developed between the railroad and trucking industries. Railroads: Today’s seven Class I freight railroad systems move 42% of the nation’s intercity ...has been successfully employed in London to reduce congestion and observed by this industry study during its travels . It is currently being
Coupled Transport Phenomena in the Opalinus Clay: Implications for Radionuclide Transport
International Nuclear Information System (INIS)
Soler, J.M.
1999-09-01
performance, in agreement with the previous estimates. Finally, the results of two- and three-dimensional simple flow models incorporating advection (Darcy's law) and thermal osmosis show that, under the conditions in the vicinity of the repository at the time scales of interest, the advective component of flow will oppose and cancel the thermal-osmotic component. After evaluating the different coupled transport mechanisms, the conclusion is that coupled phenomena will only have a very minor impact on radionuclide transport in the Opalinus Clay, at least under the conditions at times equal to or greater than the expected lifetime of the waste canisters (about 1000 years). (author)
Coupled Transport Phenomena in the Opalinus Clay: Implications for Radionuclide Transport
Energy Technology Data Exchange (ETDEWEB)
Soler, J.M.
1999-09-01
performance, in agreement with the previous estimates. Finally, the results of two- and three-dimensional simple flow models incorporating advection (Darcy's law) and thermal osmosis show that, under the conditions in the vicinity of the repository at the time scales of interest, the advective component of flow will oppose and cancel the thermal-osmotic component. After evaluating the different coupled transport mechanisms, the conclusion is that coupled phenomena will only have a very minor impact on radionuclide transport in the Opalinus Clay, at least under the conditions at times equal to or greater than the expected lifetime of the waste canisters (about 1000 years). (author)
Porters and neurotransmitter transporters.
Nelson, N; Lill, H
1994-11-01
Uptake of neurotransmitters involves multiple transporters acting in different brain locations under different physiological conditions. The vesicular transporters are driven by a proton-motive force generated by a V-ATPase and their substrates are taken up via proton/substrate exchange. The plasma membrane transporters are driven by an electrochemical gradient of sodium generated by a Na+/K(+)-ATPase. Two distinct families of transporters were identified in this group. One cotransports sodium with glutamate and other amino acids and requires additionally an outwardly directed potassium gradient. The second cotransports sodium, chloride and a variety of neurotransmitters, including gamma-aminobutyric acid (GABA), glycine and monoamines. Genes and cDNA encoding several members of the latter family have been cloned and studied in detail. The structure and function as well as the evolutionary relationships among these neurotransmitter transporters are discussed.
Directory of Open Access Journals (Sweden)
D. Baer
2009-07-01
Full Text Available Recent studies have demonstrated direct methane emission from plant foliage under aerobic conditions, particularly under high ultraviolet (UV irradiance. We examined the potential importance of this phenomenon in a high-elevation conifer forest using micrometeorological techniques. Vertical profiles of methane and carbon dioxide in forest air were monitored every 2 h for 6 weeks in summer 2007. Day to day variability in above-canopy CH4 was high, with observed values in the range 1790 to 1910 nmol mol−1. High CH4 was correlated with high carbon monoxide and related to wind direction, consistent with pollutant transport from an urban area by a well-studied mountain-plain wind system. Soils were moderately dry during the study. Vertical gradients of CH4 were small but detectable day and night, both near the ground and within the vegetation canopy. Gradients near the ground were consistent with the forest soil being a net CH4 sink. Using scalar similarity with CO2, the magnitude of the summer soil CH4 sink was estimated at ~1.7 mg CH4 m−2 h−1, which is similar to other temperate forest upland soils. The high-elevation forest was naturally exposed to high UV irradiance under clear sky conditions, with observed peak UVB irradiance >2 W m−2. Gradients and means of CO2 within the canopy under daytime conditions showed net uptake of CO2 due to photosynthetic drawdown as expected. No evidence was found for a significant foliar CH4 source in the vegetation canopy, even under high UV conditions. While the possibility of a weak foliar source cannot be excluded given the observed soil sink, overall this subalpine forest was a net sink for atmospheric methane during the growing season.
Tritium transport analysis for CFETR WCSB blanket
Energy Technology Data Exchange (ETDEWEB)
Zhao, Pinghui, E-mail: phzhao@mail.ustc.edu.cn; Yang, Wanli; Li, Yuanjie; Ge, Zhihao; Nie, Xingchen; Gao, Zhongping
2017-01-15
Highlights: • A simplified tritium transport model for CFETR WCSB blanket was developed. • Tritium transport process in CFETR WCSB blanket was analyzed. • Sensitivity analyses of tritium transport parameters were carried out. - Abstract: Water Cooled Solid Breeder (WCSB) blanket was put forward as one of the breeding blanket candidate schemes for Chinese Fusion Engineering Test Reactor (CFETR). In this study, a simplified tritium transport model was developed. Based on the conceptual engineering design, neutronics and thermal-hydraulic analyses of CFETR WCSB blanket, tritium transport process was analyzed. The results show that high tritium concentration and inventory exist in primary water loop and total tritium losses exceed CFETR limits under current conditions. Conducted were sensitivity analyses of influential parameters, including tritium source, temperature, flow-rate capacity and surface condition. Tritium performance of WCSB blanket can be significantly improved under a smaller tritium impinging rate, a larger flow-rate capacity or a better surface condition. This work provides valuable reference for the enhancement of tritium transport behavior in CFETR WCSB blanket.
Electronic transport in VO{sub 2}—Experimentally calibrated Boltzmann transport modeling
Energy Technology Data Exchange (ETDEWEB)
Kinaci, Alper; Rosenmann, Daniel; Chan, Maria K. Y., E-mail: debasish.banerjee@toyota.com, E-mail: mchan@anl.gov [Center for Nanoscale Materials, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Kado, Motohisa [Higashifuji Technical Center, Toyota Motor Corporation, Susono, Shizuoka 410-1193 (Japan); Ling, Chen; Zhu, Gaohua; Banerjee, Debasish, E-mail: debasish.banerjee@toyota.com, E-mail: mchan@anl.gov [Materials Research Department, Toyota Motor Engineering and Manufacturing North America, Inc., Ann Arbor, Michigan 48105 (United States)
2015-12-28
Materials that undergo metal-insulator transitions (MITs) are under intense study, because the transition is scientifically fascinating and technologically promising for various applications. Among these materials, VO{sub 2} has served as a prototype due to its favorable transition temperature. While the physical underpinnings of the transition have been heavily investigated experimentally and computationally, quantitative modeling of electronic transport in the two phases has yet to be undertaken. In this work, we establish a density-functional-theory (DFT)-based approach with Hubbard U correction (DFT + U) to model electronic transport properties in VO{sub 2} in the semiconducting and metallic regimes, focusing on band transport using the Boltzmann transport equations. We synthesized high quality VO{sub 2} films and measured the transport quantities across the transition, in order to calibrate the free parameters in the model. We find that the experimental calibration of the Hubbard correction term can efficiently and adequately model the metallic and semiconducting phases, allowing for further computational design of MIT materials for desirable transport properties.
Rybchenko, Zh I; Palladina, T O
2011-01-01
Participations of electrogenic H+-pumps of plasma and vacuolar membranes represented by E1-E2 and V-type H+-ATPases in plant cell adaptation to salt stress conditions has been studied by determination of their transport activities. Experiments were carried out on corn seedlings exposed during 1 or 10 days at 0.1 M NaCl. Preparations Methyure and Ivine were used by seed soaking at 10(-7) M. Plasma and vacuolar membrane fractions were isolated from corn seedling roots. In variants without NaCl a hydrolytical activity of plasma membrane H+-ATPase was increased with seedling age and its transport one was changed insignificantly, wherease the response of the weaker vacuolar H+-ATPase was opposite. NaCl exposition decreased hydrolytical activities of both H+-ATPases and increased their transport ones. These results demonstrated amplification of H+-pumps function especially represented by vacuolar H+-ATPase. Both preparations, Methyure mainly, caused a further increase of transport activity which was more expressed in NaCl variants. Obtained results showed the important role of these H+-pumps in plant adaptation under salt stress conditions realized by energetical maintenance of the secondary active Na+/H+ -antiporters which remove Na+ from cytoplasm.
Tyurin-Kuzmin, Pyotr A.; Fadeeva, Julia I.; Kanareikina, Margarita A.; Kalinina, Natalia I.; Sysoeva, Veronika Yu.; Dyikanov, Daniyar T.; Stambolsky, Dmitriy V.; Tkachuk, Vsevolod A.
2016-01-01
Sympathetic neurons are important components of mesenchymal stem cells (MSCs) niche and noradrenaline regulates biological activities of these cells. Here we examined the mechanisms of regulation of MSCs responsiveness to noradrenaline. Using flow cytometry, we demonstrated that α1A adrenergic receptors isoform was the most abundant in adipose tissue-derived MSCs. Using calcium imaging in single cells, we demonstrated that only 6.9 ± 0.8% of MSCs responded to noradrenaline by intracellular calcium release. Noradrenaline increases MSCs sensitivity to catecholamines in a transitory mode. Within 6 hrs after incubation with noradrenaline the proportion of cells responding by Ca2+ release to the fresh noradrenaline addition has doubled but declined to the baseline after 24 hrs. Increased sensitivity was due to the elevated quantities of α1A-adrenergic receptors on MSCs. Such elevation depended on the stimulation of β-adrenergic receptors and adenylate cyclase activation. The data for the first time clarify mechanisms of regulation of MSCs sensitivity to noradrenaline. PMID:27596381
International Nuclear Information System (INIS)
Gureghian, A.B.
1979-01-01
A mathematical model of ground water transport through an aquifer is presented. The solute of interest is a metal tracer or radioactive material which may undergo decay through a sorbing unconfined aquifer. The subject is developed under the following headings: flow equation, solute equation, boundary conditions, finite element formulation, element formulation, solution scheme (flow equation, solute equation), results and discussions, water movement in a ditch drained aquifer under transient state, water and solute movement in a homogeneous and unsaturated soil, transport of 226 Ra in nonhomogeneous aquifer, tailings pond lined, and tailings pond unlined. It is concluded that this mathematical model may have a wide variety of applications. The uranium milling industry may find it useful to evaluate the hydrogeological suitability of their disposal sites. It may prove suited for the design of clay disposal ponds destined to hold hazardous liquids. It may also provide a means of estimating the long-term impact of radionuclides or other pollutants on the quality of ground water. 31 references, 9 figures, 3 tables
Ogino, Hirokazu; Yamano, Yasuhiko; Ishikawa, Genta; Tomishima, Yutaka; Jinta, Torahiko; Takahashi, Osamu; Chohnabayashi, Naohiko
2015-01-01
Aim High‐flow oxygen is often administered to patients during emergency transport and can sometimes cause respiratory acidosis with disturbed consciousness, thereby necessitating mechanical ventilation. Although oxygen titration in chronic obstructive pulmonary disease patients during emergency transport reduces mortality rates, the clinical risk factors for respiratory acidosis in emergency settings are not fully understood. Therefore, we analyzed the clinical backgrounds of patients who developed respiratory acidosis during pre‐hospital transport. Methods This was a retrospective study of patients who arrived at our hospital by emergency transport in 2010 who received high‐flow oxygen while in transit. Respiratory acidosis was defined by the following arterial blood gas readings: pH, ≤7.35; PaCO 2, ≥45 mmHg; and HCO 3 −, ≥24 mmol/L. The risk factors were identified using multivariable logistic regression analysis. Results In 765 study patients, 66 patients showed respiratory acidosis. The following risk factors for respiratory acidosis were identified: age, ≥65 years (odds ratio [OR] 1.4; 95% confidence interval [CI], 0.7–2.8); transportation time, ≥10 min (OR 2.0; 95% CI, 1.1–3.7); three digits on the Japan Coma Scale (OR 3.1; 95% CI, 1.7–5.8); percutaneous oxygen saturation, ≤90% (OR 1.6; 95% CI, 0.8–3.0); tuberculosis (OR 4.5; 95% CI, 1.4–15.1); asthma (OR 1.8; 95% CI, 0.6–5.3); pneumonia (OR 1.5; 95% CI, 0.7–3.1); and lung cancer (OR 3.9; 95% CI, 1.5–10.1). These underlying diseases as risk factors included both comorbid diseases and past medical conditions. Conclusions The factors identified may contribute to the development of respiratory acidosis. Further studies on preventing respiratory acidosis will improve the quality of emergency medical care. PMID:29123744
International Nuclear Information System (INIS)
Gustafsson, E.; Klockars, C.-E.
1981-04-01
The purpose of the investigation has been study the following parameters along existing fractures between two boreholes: hydraulic properties of rock mass and fractures; adsorptive properties of some selected tracers during transport along fractures; dispersivity and dilution of tracers during transport in fractures; kinematic porosity of fractured bedrock. The procedure has been to determine the hydraulic properties of a rock mass by means of conventional hydraulic testing methods in 100 m deep boreholes, and to study transport mechanisms and properties of selected tracers in a selected fracture zone between two boreholes. (Auth.)
Uncertainties in Transport Project Evaluation: Editorial
DEFF Research Database (Denmark)
Salling, Kim Bang; Nielsen, Otto Anker
2015-01-01
University of Denmark, September 2013. The conference was held under the auspices of the project ‘Uncertainties in transport project evaluation’ (UNITE) which is a research project (2009-2014) financed by the Danish Strategic Research Agency. UNITE was coordinated by the Department of Transport......This following special issue of the European Journal of Transport Infrastructure Research (EJTIR) containing five scientific papers is the result of an open call for papers at the 1st International Conference on Uncertainties in Transport Project Evaluation that took place at the Technical...
Analysis of moisture transport between connected enclosures under a forced thermal gradient
DEFF Research Database (Denmark)
Staliulionis, Zygimantas; Joshy, Salil; Ambat, Rajan
2016-01-01
and humidity control solutions. While high fidelity CFD codes are too time consuming due to computational effort/time, the well-known Resistor-Capacitor (RC) approach has much lower calculation time and is more efficient to use in enclosures without too complex geometry in their interior. Thus, the objective...... of this paper is to build an in-house code based on the RC approach for simulating coupled heat and mass transport. The developed code is used for simulating moisture transport between two boxes/enclosures having different temperatures, connected with a tube of known geometry. It has also the capability...
Classical dissipation and transport in plasmas
International Nuclear Information System (INIS)
Hinton, F.L.
1989-01-01
This paper reviews the subject of classical and neoclassical transport. The paper is organized into four main parts, dealing with plasma kinetic theory, classical transport, neoclassical transport, and the present state of the subject. The results of the neoclassical theory of transport are still being used to give the lower limit on the transport rates in tokamaks, which would apply if instabilities and turbulence could be suppressed. So far, only the ion thermal conductivity and the current density have been found experimentally to agree with this theory, and only under special conditions. The electron thermal conductivity has been found experimentally to be much larger than the neoclassical prediction
Monitoring of transport contamination
International Nuclear Information System (INIS)
Turkin, N.F.
1980-01-01
Organization of monitoring of transport contamination is considered. A particularly thorough monitoring is recommended to be carried out in loading-unloading operations. The monitoring is performed when leaving loading-unloading site and zone under control and prior to preventive examination, technical service or repair. The method of monitoring of auto transport contamination with high-energy β-emitters by means of a special stand permitting the automation of the monitoring process is described [ru
Coupled electron-photon radiation transport
International Nuclear Information System (INIS)
Lorence, L.; Kensek, R.P.; Valdez, G.D.; Drumm, C.R.; Fan, W.C.; Powell, J.L.
2000-01-01
Massively-parallel computers allow detailed 3D radiation transport simulations to be performed to analyze the response of complex systems to radiation. This has been recently been demonstrated with the coupled electron-photon Monte Carlo code, ITS. To enable such calculations, the combinatorial geometry capability of ITS was improved. For greater geometrical flexibility, a version of ITS is under development that can track particles in CAD geometries. Deterministic radiation transport codes that utilize an unstructured spatial mesh are also being devised. For electron transport, the authors are investigating second-order forms of the transport equations which, when discretized, yield symmetric positive definite matrices. A novel parallelization strategy, simultaneously solving for spatial and angular unknowns, has been applied to the even- and odd-parity forms of the transport equation on a 2D unstructured spatial mesh. Another second-order form, the self-adjoint angular flux transport equation, also shows promise for electron transport
Transport losses in finisher pigs: impact of transport distance and season of the year
Directory of Open Access Journals (Sweden)
Eva Voslarova
2017-01-01
Full Text Available Objective The death of animals during transport for slaughter is a major factor indicating the level of welfare in transported animals. The aim of this study was to assess mortality related to the commercial transport of finisher pigs for slaughter in the Czech Republic. Methods The inspectors of the State Veterinary Administration of the Czech Republic recorded the numbers of finisher pigs transported to processing plants in the Czech Republic for slaughter and the mortality in these pigs in relation to transport in the period from 2009 to 2014. Results Our results show that the likelihood of death losses in transported pigs increases with increasing transport distance. The transport-related mortality ranged from 0.049% in pigs transported for distances below 50 km to 0.145% in pigs transported for distances exceeding 300 km. The impact of external air temperature on the transport-related mortality found in our study clearly shows that current transport practices fail to ensure the welfare of pigs transported under other than moderate weather. Particularly cold temperatures below −2°C were associated with increased death losses in winter transport. Conclusion Despite a decreasing trend in the mortality of finisher pigs transported for slaughter in Europe, our study suggests that current transport conditions are not efficient at ensuring the welfare of pigs during transport for longer distances and the protection of pigs against the negative impact of extreme ambient temperatures. Further research should focus on developing practical guidelines to improve the welfare of pigs in transit accordingly.
DEFF Research Database (Denmark)
Larsen, Mie; Larsen, Birger Brodin; Frølund, Bente
2008-01-01
The objective of this study was to investigate transepithelial amino acid transport as a function of Caco-2 cell culture time. Furthermore, the objective was to investigate apical uptake characteristics of hPAT1-mediated transport under various experimental conditions. Apical amino acid uptake......, which has been shown to function as a carboxylic acid bioisostere for substrates of the GABA receptor and transport systems....
Atlabachew, Abunu; Shu, Longcang; Wu, Peipeng; Zhang, Yongjie; Xu, Yang
2018-03-01
This laboratory study improves the understanding of the impacts of horizontal hydraulic gradient, artificial recharge, and groundwater pumping on solute transport through aquifers. Nine experiments and numerical simulations were carried out using a sand tank. The variable-density groundwater flow and sodium chloride transport were simulated using the three-dimensional numerical model SEAWAT. Numerical modelling results successfully reproduced heads and concentrations observed in the sand tank. A higher horizontal hydraulic gradient enhanced the migration of sodium chloride, particularly in the groundwater flow direction. The application of constant artificial recharge increased the spread of the sodium chloride plume in both the longitudinal and lateral directions. In addition, groundwater pumping accelerated spreading of the sodium chloride plume towards the pumping well. Both higher hydraulic gradient and pumping rate generated oval-shaped plumes in the horizontal plane. However, the artificial recharge process produced stretched plumes. These effects of artificial recharge and groundwater pumping were greater under higher hydraulic gradient. The concentration breakthrough curves indicated that emerging solutions never attained the concentration of the originally injected solution. This is probably because of sorption of sodium chloride onto the silica sand and/or the exchange of sodium chloride between the mobile and immobile liquid domains. The fingering and protruding plume shapes in the numerical models constitute instability zones produced by buoyancy-driven flow. Overall, the results have substantiated the influences of hydraulic gradient, boundary condition, artificial recharge, pumping rate and density differences on solute transport through a homogeneous unconfined aquifer. The implications of these findings are important for managing liquid wastes.
Lifescience Database Archive (English)
Full Text Available 212 ... Norepinephrine ... D00076 ... Noradrenaline (JP17); Norepinephrine (INN) ... D05206 ... Norepinephrine bitartr...USP); Isoprenaline sulfate (JAN) ... D02150 ... l-Isoprenaline hydrochloride (JP17) ... DG00212 ... Norepinephrine ... D00076 ... Noradrenaline...DG00212 ... Norepinephrine ... D00076 ... Noradrenaline (JP17); Norepinephrine (INN) ...
Directory of Open Access Journals (Sweden)
R. B. Ivut
2010-01-01
Full Text Available The paper presents a methodology for evaluation of economic efficiency pertaining to usage of automotive transport facilities while executing international cargo transportation on the basis of average internal norm calculation of automotive operational profitability of a specific model under conditions which are typical for the given market by an average carrier.
Framework for Sustainability Assessment by Transportation Agencies
DEFF Research Database (Denmark)
Ramani, Tara Lakshmi; Zietsman, Josias; Gudmundsson, Henrik
2011-01-01
and outcomes. The framework development process was an extension of findings from literature review, case studies, and interviews conducted as part of ongoing research under the NCHRP project Sustainability Performance Measures for State Departments of Transportation and Other Transportation Agencies...
Moisture transport and equilibrium in organic coatings
Wel, van der G.K.; Adan, O.C.G.
2000-01-01
Improving coating performance in regard of protection of substrates and structures against moisturerelated degradation requires detailed knowledge of underlying transport mechanisms. In this paper a review is given on transport and equilibrium sorption of moisture in polymer films and organic
Multipurpose containers for the transport of nuclear material: The example of transport flask CF6
International Nuclear Information System (INIS)
Gualdrini, G.F.; Borgia, M.G.
1989-03-01
The present paper summarizes the design and licensing activity carried out in the frame work of an ENEA working group which was set up with the aim of developing transport flasks for radioactive and non radioactive dangerous materials. In particular the nuclear design of the multipurpose transport flask CF6 is described. The paper was presented at the seminar on 'Nuclear wastes and transport of radioactive materials' held in Bologna on June 4th and 5th 1987 under the aegis of the Department of Physics of the University of Bologna. (author)
First-principles calculation of transport property in nano-devices under an external magnetic field
International Nuclear Information System (INIS)
Chen Jingzhe; Zhang Jin; Han Rushan
2008-01-01
The mesoscopic quantum interference phenomenon (QIP) can be observed and behaves as the oscillation of conductance in nano-devices when the external magnetic field changes. Excluding the factor of impurities or defects, specific QIP is determined by the sample geometry. We have improved a first-principles method based on the matrix Green's function and the density functional theory to simulate the transport behaviour of such systems under a magnetic field. We have studied two kinds of QIP: universal conductance fluctuation (UCF) and Aharonov–Bohm effect (A–B effect). We find that the amplitude of UCF is much smaller than the previous theoretical prediction. We have discussed the origin of difference and concluded that due to the failure of ergodic hypothesis, the ensemble statistics is not applicable, and the conductance fluctuation is determined by the flux-dependent density of states (DOSs). We have also studied the relation between the UCF and the structure of sample. For a specific structure, an atomic circle, the A–B effect is observed and the origin of the oscillation is also discussed
International Nuclear Information System (INIS)
Despois, J.
1977-01-01
Recalling the close connections existing between heat transport and storage, some general considerations on the problem of heat distribution and transport are presented 'in order to set out the problem' of storage in concrete form. This problem is considered in its overall plane, then studied under the angle of the different technical choices it involves. The two alternatives currently in consideration are described i.e.: storage in a mined cavity and underground storage as captive sheet [fr
Mihaela, Istrate; Alexandru, Boroiu; Viorel, Nicolae; Ionel, Vieru
2017-10-01
One of the major problems facing the Pitesti city is the road congestion that occurs in the central area of the city during the peak hours. With all the measures taken in recent years - the widening of road arteries, increasing the number of parking spaces, the creation of overground road passages - it is obvious that the problem can only be solved by a new philosophy regarding urban mobility: it is no longer possible to continue through solutions to increase the accessibility of the central area of the city, but it is necessary, on the contrary, to promote a policy of discouraging the penetration of vehicles in the city center, coupled with a policy of improving the connection between urban public transport and county public transport. This new approach is also proposed in the new Urban Mobility Plan of Pitesti city, under development. The most convincing argument for the necessity of this new orientation in the Pitesti city mobility plan is based on the analysis of the current situation of passenger transport on the territory of Pitesti city: the analysis of “public transport versus private transport” reveals a very low occupancy rate for cars and the fact that the road surface required for a passenger (the dynamic area) is much higher in the case of private transport than in the case of public transport. Measurements of passenger flows and vehicle flows on the 6 penetration ways in the city have been made and the calculations clearly demonstrate the benefits of an urban public transport system connected by “transshipment buses” to be made at the edge of the city, to the county public transport system. In terms of inter-county transport, it will continue to be connected to the urban public transport system by existing bus Station, within the city: South Bus Station and North Bus Station. The usefulness of the paper is that it identifies the solutions for sustainable mobility in Pitesti city and proposes concrete solutions for the development of the
Frequency dependent magneto-transport in charge transfer Co(II) complex
Energy Technology Data Exchange (ETDEWEB)
Shaw, Bikash Kumar; Saha, Shyamal K., E-mail: cnssks@iacs.res.in
2014-09-01
A charge transfer chelated system containing ferromagnetic metal centers is the ideal system to investigate the magneto-transport and magneto-dielectric effects due to the presence of both electronic as well as magnetic properties and their coupling. Magneto-transport properties in materials are usually studied through dc charge transport under magnetic field. As frequency dependent conductivity is an essential tool to understand the nature of carrier wave, its spatial extension and their mutual interaction, in the present work, we have investigated frequency dependent magneto-transport along with magnetization behavior in [Co{sub 2}(II)-(5-(4-PhMe)-1,3,4-oxadiazole-H{sup +}-2-thiolate){sub 5}](OAc){sub 4} metal complex to elucidate the nature of above quantities and their response under magnetic field in the transport property. We have used the existing model for ac conduction incorporating the field dependence to explain the frequency dependent magneto-transport. It is seen that the frequency dependent magneto-transport could be well explained using the existing model for ac conduction. -Highlights: • Chelated Co(II) complex is synthesized for magneto-transport applications. • Frequency dependent magneto-transport and magnetization behavior are studied. • Nature of carrier wave, its spatial extension is investigated under magnetic field. • Existing model for ac conduction is used with magnetic field dependence.
26 CFR 49.4262(a)-1 - Taxable transportation.
2010-04-01
... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Taxable transportation. 49.4262(a)-1 Section 49...) MISCELLANEOUS EXCISE TAXES FACILITIES AND SERVICES EXCISE TAXES Transportation of Persons § 49.4262(a)-1 Taxable transportation. (a) In general. Unless excluded under section 4262(b) (see § 49.4262(b)-1), taxable...
Evaluation of intelligent transport systems impact on school transport safety
Directory of Open Access Journals (Sweden)
Jankowska-Karpa Dagmara
2017-01-01
Full Text Available The integrated system of safe transport of children to school using Intelligent Transport Systems was developed and implemented in four locations across Europe under the Safeway2School (SW2S project, funded by the EU. The SW2S system evaluation included speed measurements and an eye-tracking experiment carried out among drivers who used the school bus route, where selected elements of the system were tested. The subject of the evaluation were the following system elements: pedestrian safety system at the bus stop (Intelligent Bus Stop and tags for children, Driver Support System, applications for parents’ and students’ mobile phones, bus stop inventory tool and data server. A new sign designed for buses and bus stops to inform about child transportation/children waiting at the bus stop was added to the system. Training schemes for system users were also provided. The article presents evaluation results of the impact of selected elements of the SW2S system on school transport safety in Poland.
Analysis of physical mechanisms underlying density-dependent transport in porous media
Landman, A.J.
2005-01-01
In this thesis, the interaction between (large) density gradients and flow and transport in porous media is studied. Large gradients in the density of groundwater exist for example near deep salt rock formations, which are considered as possible long-term storage sites for radioactive waste.
DEFF Research Database (Denmark)
Sørensen, Claus Hedegaard; Gudmundsson, Henrik
2010-01-01
'Sustainable transport' has become a priority for transport planning and policy making around the world. Sustainable transport plans often promote efforts to shift passengers from private cars to other modes such as public transport. However, the actual success of such efforts is likely to depend...... on how the transport sector is organised and governed. In this paper, we study the impacts of new public management (NPM) reforms in the British local transport sector on the attraction of passengers to buses. Britain is an interesting example since high level sustainable transport policies have been...... contributions. Second, we apply theoretical notions of 'governance modes', to examine whether the strengths and failures of 'market', 'hierarchy' and 'network' governance respectively can help to explain the results we observe. We find that these concepts are particularly useful to clarify the conditions under...
Energy Technology Data Exchange (ETDEWEB)
Ribeiro, Diego Varela; Campos, Carlos Hebert
2011-01-15
The paper expose on the activity of petroleum, natural gas and bio fuels transportation, outlining the transportation means used by the petroleum industry. After that, analyses the importance and the economic relevance of the Transpetro. Yet, proceeds an examination of the transportation activity under a constitutional optics, based on the EC 9/95; a legal optic, from the Petroleum Law (Law 9478/97) and some other legal documents related to the theme. Finally, presents the importance that the Law of Natural Gas (Law 11909/09) brought for that activity, by making possible that the natural gas transportation can also be effectuated through the Concession.
10 CFR 71.71 - Normal conditions of transport.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Normal conditions of transport. 71.71 Section 71.71 Energy..., Special Form, and LSA-III Tests 2 § 71.71 Normal conditions of transport. (a) Evaluation. Evaluation of each package design under normal conditions of transport must include a determination of the effect on...
Suitability of Commercial Transport Media for Biological Pathogens under Nonideal Conditions
Directory of Open Access Journals (Sweden)
Kyle Hubbard
2011-01-01
Full Text Available There is extensive data to support the use of commercial transport media as a stabilizer for known clinical samples; however, there is little information to support their use outside of controlled conditions specified by the manufacturer. Furthermore, there is no data to determine the suitability of said media for biological pathogens, specifically those of interest to the US military. This study evaluates commercial off-the-shelf (COTS transport media based on sample recovery, viability, and quality of nucleic acids and peptides for nonpathogenic strains of Bacillus anthracis, Yersinia pestis, and Venezuelan equine encephalitis virus, in addition to ricin toxin. Samples were stored in COTS, PBST, or no media at various temperatures over an extended test period. The results demonstrate that COTS media, although sufficient for the preservation of nucleic acid and proteinaceous material, are not capable of maintaining an accurate representation of biothreat agents at the time of collection.
CSIR Research Space (South Africa)
Van der Merwe, GH
2004-01-15
Full Text Available of Food and Agriculture J Sci Food Agric 84:52?58 (online: 2003) DOI: 10.1002/jsfa.1609 Changes in chemical quality indices during long-term storage of palm-olein oil under heated storage and transport-type conditions Gretel H van der Merwe,1asteriskmath... Lourens M du Plessis1 and John RN Taylor2 1CSIR Bio/Chemtek, PO Box 395, Pretoria 0001, South Africa 2Department of Food Science, University of Pretoria, Pretoria 0002, South Africa Abstract: Six quality indices, namely free fatty acids (FFA), peroxide...
International Nuclear Information System (INIS)
Pelletier, C.; Wortmann, J.C.
2009-01-01
The natural gas industry in Western Europe went through drastic changes induced by the unbundling of the national companies, followed by the liberalization of gas trade and the regulation of gas transmission. Natural gas transmission is operated through a network of interconnected grids, and is capacity constrained. Each of the grids is locally regulated in terms of price limits on transportation services. Local tariff differences may induce unnatural gas routing within a network, creating congestion in some part of it. This phenomena is referred to as the Jepma effect. Following Jepma (2001. Gaslevering onder druk. Stichting JIN. Available at: www.jiqweb.org (52pp) (in Dutch)) this may lead to misguided investment decisions. In this paper a multi-stage linear program is used to simulate the repartition of the natural gas flow in an interconnected grid system on a succession of contracting periods. By this simulation, the risk linked to infrastructure investment is assessed. The risk measured can be seen as the probability of a negative present net value for the investment. The model is applied on an example of two grids that are on alternative routes serving same destinations. When applied to a specific situation of North-West Europe (Germany and The Netherlands), the model clearly demonstrates that the risks turn out to be too high to invest: there are hardly any scenarios under which an acceptable ROI will be realized. Given the current tariff policy and current publicly available forecasts of demand and supply, it is unlikely that market forces will attract additional investments in transportation capacity. This reluctance to invest can be prohibitive for further growth of supply if the demand would increase significantly. (author)
Energy Technology Data Exchange (ETDEWEB)
Pelletier, C.; Wortmann, J.C. [Information System Cluster, Faculty of Economics and Business, Rijksuniversiteit Groningen, Landleven 5, Postbus 800, 9700 AV Groningen (Netherlands)
2009-02-15
The natural gas industry in Western Europe went through drastic changes induced by the unbundling of the national companies, followed by the liberalization of gas trade and the regulation of gas transmission. Natural gas transmission is operated through a network of interconnected grids, and is capacity constrained. Each of the grids is locally regulated in terms of price limits on transportation services. Local tariff differences may induce unnatural gas routing within a network, creating congestion in some part of it. This phenomena is referred to as the Jepma effect. Following Jepma (2001. Gaslevering onder druk. Stichting JIN. Available at: www.jiqweb.org (52pp) (in Dutch)) this may lead to misguided investment decisions. In this paper a multi-stage linear program is used to simulate the repartition of the natural gas flow in an interconnected grid system on a succession of contracting periods. By this simulation, the risk linked to infrastructure investment is assessed. The risk measured can be seen as the probability of a negative present net value for the investment. The model is applied on an example of two grids that are on alternative routes serving same destinations. When applied to a specific situation of North-West Europe (Germany and The Netherlands), the model clearly demonstrates that the risks turn out to be too high to invest: there are hardly any scenarios under which an acceptable ROI will be realized. Given the current tariff policy and current publicly available forecasts of demand and supply, it is unlikely that market forces will attract additional investments in transportation capacity. This reluctance to invest can be prohibitive for further growth of supply if the demand would increase significantly. (author)
Directory of Open Access Journals (Sweden)
Miao Zhenyan
2012-02-01
Full Text Available Abstract Background Medicago truncatula has been chosen as a model species for genomic studies. It is closely related to an important legume, alfalfa. Transporters are a large group of membrane-spanning proteins. They deliver essential nutrients, eject waste products, and assist the cell in sensing environmental conditions by forming a complex system of pumps and channels. Although studies have effectively characterized individual M. truncatula transporters in several databases, until now there has been no available systematic database that includes all transporters in M. truncatula. Description The M. truncatula transporter database (MTDB contains comprehensive information on the transporters in M. truncatula. Based on the TransportTP method, we have presented a novel prediction pipeline. A total of 3,665 putative transporters have been annotated based on International Medicago Genome Annotated Group (IMGAG V3.5 V3 and the M. truncatula Gene Index (MTGI V10.0 releases and assigned to 162 families according to the transporter classification system. These families were further classified into seven types according to their transport mode and energy coupling mechanism. Extensive annotations referring to each protein were generated, including basic protein function, expressed sequence tag (EST mapping, genome locus, three-dimensional template prediction, transmembrane segment, and domain annotation. A chromosome distribution map and text-based Basic Local Alignment Search Tools were also created. In addition, we have provided a way to explore the expression of putative M. truncatula transporter genes under stress treatments. Conclusions In summary, the MTDB enables the exploration and comparative analysis of putative transporters in M. truncatula. A user-friendly web interface and regular updates make MTDB valuable to researchers in related fields. The MTDB is freely available now to all users at http://bioinformatics.cau.edu.cn/MtTransporter/.
Energy Technology Data Exchange (ETDEWEB)
Gokirmak, Ali [Univ. of Connecticut, Storrs, CT (United States); Silva, Helena [Univ. of Connecticut, Storrs, CT (United States)
2017-08-30
This project focused on thermoelectric transport in semiconductor micro and nanostructures where moderate and typical operating voltages and currents lead to extreme thermal gradients and current densities. Models that describe behavior of semiconducting materials typically assume an equilibrium condition or slight deviations from it. In these cases the generation-recombination processes are assumed to have reached a local equilibrium for a given temperature. Hence, free carrier concentrations and their mobilities, band-gap, thermal conductivity, thermoelectric properties, mobility of atoms and mechanical properties of the material, can be described as a function of temperature. In the case of PN junctions under electrical bias, carrier concentrations can change up to ~ 1020 cm-3 and a drift-diffusion approximation is typically used to obtain the carrier concentrations while assuming that the material properties do not change. In non-equilibrium conditions, the assumption that the material properties remain the same may not be valid. While the increased conduction-band electron concentration may not have a drastic effect on the material, large hole concentration is expected to soften the material as ‘a hole’ comes into existence as a broken bond in the lattice. As the hole density approaches 1022 cm-3, the number of bonds holding the lattice together is significantly reduced, making it easier to break additional bonds, reduce band-gap and inhibit phonon transport. As these holes move away from where they were generated, local properties are expected to deviate significantly from the equilibrium case. Hence, temperature alone is not sufficient to describe the behavior of the material. The behavior of the solid material close to a molten region (liquid-solid interfaces) is also expected to deviate from the equilibrium case as a function of hole injection rate, which can be drastically increased or decreased in the presence of an electric field. In the past years
Radiological environmental impacts from transportation of nuclear materials
International Nuclear Information System (INIS)
Shuai Zhengqing
1994-01-01
The author describes radiological impacts from transportation of nuclear materials. RADTRAN 4.0 supplied by IAEA was adopted to evaluate radiological consequence of incident-free transportation as well as the radiological risks from vehicular accidents occurring during transportation. The results of calculation show that the collective effective dose equivalent of incident-free transportation to the public and transportation workers is 7.94 x 10 -4 man·Sv. The calculated data suggest that the environmental impacts under normal and assumed accidental conditions are acceptable
Weth, Agnes; Dippl, Carsten; Striedner, Yasmin; Tiemann-Boege, Irene; Vereshchaga, Yana; Golenhofen, Nikola; Bartelt-Kirbach, Britta; Baumgartner, Werner
2017-04-03
In the intestine water has to be reabsorbed from the chymus across the intestinal epithelium. The osmolarity within the lumen is subjected to high variations meaning that water transport often has to take place against osmotic gradients. It has been hypothesized that LI-cadherin is important in this process by keeping the intercellular cleft narrow facilitating the buildup of an osmotic gradient allowing water reabsorption. LI-cadherin is exceptional among the cadherin superfamily with respect to its localization along the lateral plasma membrane of epithelial cells being excluded from adherens junction. Furthermore it has 7 but not 5 extracellular cadherin repeats (EC1-EC7) and a small cytosolic domain. In this study we identified the peptide VAALD as an inhibitor of LI-cadherin trans-interaction by modeling the structure of LI-cadherin and comparison with the known adhesive interfaces of E-cadherin. This inhibitory peptide was used to measure LI-cadherin dependency of water transport through a monolayer of epithelial CACO2 cells under various osmotic conditions. If LI-cadherin trans-interaction was inhibited by use of the peptide, water transport from the luminal to the basolateral side was impaired and even reversed in the case of hypertonic conditions whereas no effect could be observed at isotonic conditions. These data are in line with a recently published model predicting LI-cadherin to keep the width of the lateral intercellular cleft small. In this narrow cleft a high osmolarity can be achieved due to ion pumps yielding a standing osmotic gradient allowing water absorption from the gut even if the faeces is highly hypertonic.
International Nuclear Information System (INIS)
Meng, Jianxin; Mei, Deqing; Yang, Keji; Fan, Zongwei
2014-01-01
In existing ultrasonic transportation methods, the long-range transportation of micro-particles is always realized in step-by-step way. Due to the substantial decrease of the driving force in each step, the transportation is lower-speed and stair-stepping. To improve the transporting velocity, a non-stepping ultrasonic transportation approach is proposed. By quantitatively analyzing the acoustic potential well, an optimal region is defined as the position, where the largest driving force is provided under the condition that the driving force is simultaneously the major component of an acoustic radiation force. To keep the micro-particle trapped in the optimal region during the whole transportation process, an approach of optimizing the phase-shifting velocity and phase-shifting step is adopted. Due to the stable and large driving force, the displacement of the micro-particle is an approximately linear function of time, instead of a stair-stepping function of time as in the existing step-by-step methods. An experimental setup is also developed to validate this approach. Long-range ultrasonic transportations of zirconium beads with high transporting velocity were realized. The experimental results demonstrated that this approach is an effective way to improve transporting velocity in the long-range ultrasonic transportation of micro-particles
Kitao, M; Lei, T T
2007-01-01
We investigated the patterns of response to a long-term drought in the field in cotton cultivars (genotypes) with known differences in their drought tolerance. Four cotton genotypes with varying physiological and morphological traits, suited to different cropping conditions, were grown in the field and subjected to a long-term moderate drought. In general, cotton leaves developed under drought had significantly higher area-based leaf nitrogen content (N (area)) than those under well irrigation. Droughted plants showed a lower light-saturated net photosynthetic rate (A (sat)) with lower stomatal conductance (g (s)) and intercellular CO (2) concentration (C (i)) than irrigated ones. Based on the responses of A (sat) to g (s) and C (i), there was no decreasing trend in A (sat) at a given g (s) and C (i) in droughted leaves, suggesting that the decline in A (sat) in field-grown cotton plants under a long-term drought can be attributed mainly to stomatal closure, but not to nonstomatal limitations. There was little evidence of an increase in thermal energy dissipation as indicated by the lack of a decrease in the photochemical efficiency of open PSII (F (v)'/F (m)') in droughted plants. On the basis of electron transport (ETR) and photochemical quenching (q (P)), however, we found evidence indicating that droughted cotton plants can circumvent the risk of excessive excitation energy in photosystem (PS) II by maintaining higher electron transport rates associated with higher N (area), even while photosynthetic rates were reduced by stomatal closure.
SEAWAT-based simulation of axisymmetric heat transport.
Vandenbohede, Alexander; Louwyck, Andy; Vlamynck, Nele
2014-01-01
Simulation of heat transport has its applications in geothermal exploitation of aquifers and the analysis of temperature dependent chemical reactions. Under homogeneous conditions and in the absence of a regional hydraulic gradient, groundwater flow and heat transport from or to a well exhibit radial symmetry, and governing equations are reduced by one dimension (1D) which increases computational efficiency importantly. Solute transport codes can simulate heat transport and input parameters may be modified such that the Cartesian geometry can handle radial flow. In this article, SEAWAT is evaluated as simulator for heat transport under radial flow conditions. The 1971, 1D analytical solution of Gelhar and Collins is used to compare axisymmetric transport with retardation (i.e., as a result of thermal equilibrium between fluid and solid) and a large diffusion (conduction). It is shown that an axisymmetric simulation compares well with a fully three dimensional (3D) simulation of an aquifer thermal energy storage systems. The influence of grid discretization, solver parameters, and advection solution is illustrated. Because of the high diffusion to simulate conduction, convergence criterion for heat transport must be set much smaller (10(-10) ) than for solute transport (10(-6) ). Grid discretization should be considered carefully, in particular the subdivision of the screen interval. On the other hand, different methods to calculate the pumping or injection rate distribution over different nodes of a multilayer well lead to small differences only. © 2013, National Ground Water Association.
The transport of radioactive materials - Future challenges
International Nuclear Information System (INIS)
Wilkinson, W.L.
2008-01-01
The International Atomic Energy Agency (IAEA) Regulations for the Safe Transport of Radioactive Materials, TS-R-1, set the standards for the packages used in the transport of radioactive materials under both normal and accident conditions. Transport organisations are also required to implement Radiation Protection Programmes to control radiation dose exposure to both workers and the public. The industry has now operated under this regulatory regime safely and efficiently for nearly 50 years. It is vital that this record be maintained in the future when the demands on the transport industry are increasing. Nuclear power is being called upon more and more to satisfy the world's growing need for sustainable, clean and affordable electricity and there will be a corresponding demand for nuclear fuel cycle services. There will also be a growing need for other radioactive materials, notably large sources such as Cobalt 60 sources for a range of important medical and industrial uses, as well as radio-pharmaceuticals. A reliable transport infrastructure is essential to support all these industry sectors and the challenge will be to ensure that this can be maintained safely and securely in a changing world where public and political concerns are increasing. This paper will discuss the main issues which need to be addressed. The demand for uranium has led to increased exploration and the development of mines in new locations far removed from the demand centres. This inevitably leads to more transport, sometimes from areas potentially lacking in transport infrastructure, service providers, and experience. The demand for sources for medical applications will also increase, particularly from the rapidly developing regions and this will also involve new transport routes and increased traffic. This raises a variety of issues concerning the ability of the transport infrastructure to meet the future challenge, particularly in an environment where there already exists reluctance on
Energy Technology Data Exchange (ETDEWEB)
Tomaschek, Jan
2013-12-11
-GEECO, the other demand sectors (such as residential or industry) are also represented. In this thesis, a comprehensive analysis was conducted of alternative fuels, vehicle technologies as well as transport infrastructure for the transport sector of Gauteng. As a result, there are many possibilities of reducing GHG emissions and/or of increasing energy efficiency in the transport sector by using alternative fuels or vehicle technologies. In scenario analysis, it was recognized that under current policies significant growth in both energy consumption and climate emissions can be expected in Gauteng. Marginal GHG abatement cost curves have been calculated, which permit the identification of least-cost mitigation measures for the transport sector under consideration of the whole energy system. It was shown that biofuels from waste cooking oil and cellulosic biomass as well as the substitution of fossil synthetic fuels with crude oil products could result in significant GHG emission reductions. Moreover, hybrid vehicles offer prospects for increasing energy efficiency and reducing GHG emissions at low marginal mitigation costs, where, it was identified that measures should first be applied for vehicles with high annual mileages such as buses, minibuses and heavy-duty vehicles (HDVs). However, the analysis also showed that the transport sector is not the first sector to address for GHG mitigation as significant mitigation potentials with low associated costs lie in the provision of electricity and in the supply of fuels.
International Nuclear Information System (INIS)
Tomaschek, Jan
2013-01-01
-GEECO, the other demand sectors (such as residential or industry) are also represented. In this thesis, a comprehensive analysis was conducted of alternative fuels, vehicle technologies as well as transport infrastructure for the transport sector of Gauteng. As a result, there are many possibilities of reducing GHG emissions and/or of increasing energy efficiency in the transport sector by using alternative fuels or vehicle technologies. In scenario analysis, it was recognized that under current policies significant growth in both energy consumption and climate emissions can be expected in Gauteng. Marginal GHG abatement cost curves have been calculated, which permit the identification of least-cost mitigation measures for the transport sector under consideration of the whole energy system. It was shown that biofuels from waste cooking oil and cellulosic biomass as well as the substitution of fossil synthetic fuels with crude oil products could result in significant GHG emission reductions. Moreover, hybrid vehicles offer prospects for increasing energy efficiency and reducing GHG emissions at low marginal mitigation costs, where, it was identified that measures should first be applied for vehicles with high annual mileages such as buses, minibuses and heavy-duty vehicles (HDVs). However, the analysis also showed that the transport sector is not the first sector to address for GHG mitigation as significant mitigation potentials with low associated costs lie in the provision of electricity and in the supply of fuels.
Liability and insurance aspects of international transport of nuclear materials
International Nuclear Information System (INIS)
van Gijn, S.H.
1985-01-01
The Paris and Vienna Conventions do not affect the application of any international transport agreement already in force. However, in certain circumstances both the nuclear operator and the carrier may be held liable for nuclear damage which arises during international transports of nuclear materials. The ensuing cumulation of liabilities under the Nuclear and Transport Conventions may cause serious problems in obtaining adequate insurance cover for such transports. The 1971 Brussels Convention seeks to solve this problem by exonerating any person who might be held liable for nuclear damage under an international maritime convention or national law. Similar difficulties are encountered in the case of transports of nuclear materials between states which have and states which have not ratified the Paris and Vienna Conventions. (NEA) [fr
Directory of Open Access Journals (Sweden)
David L García-Ramírez
Full Text Available Gain control of primary afferent neurotransmission at their intraspinal terminals occurs by several mechanisms including primary afferent depolarization (PAD. PAD produces presynaptic inhibition via a reduction in transmitter release. While it is known that descending monoaminergic pathways complexly regulate sensory processing, the extent these actions include modulation of afferent-evoked PAD remains uncertain. We investigated the effects of serotonin (5HT, dopamine (DA and noradrenaline (NA on afferent transmission and PAD. Responses were evoked by stimulation of myelinated hindlimb cutaneous and muscle afferents in the isolated neonatal mouse spinal cord. Monosynaptic responses were examined in the deep dorsal horn either as population excitatory synaptic responses (recorded as extracellular field potentials; EFPs or intracellular excitatory postsynaptic currents (EPSCs. The magnitude of PAD generated intraspinally was estimated from electrotonically back-propagating dorsal root potentials (DRPs recorded on lumbar dorsal roots. 5HT depressed the DRP by 76%. Monosynaptic actions were similarly depressed by 5HT (EFPs 54%; EPSCs 75% but with a slower time course. This suggests that depression of monosynaptic EFPs and DRPs occurs by independent mechanisms. DA and NA had similar depressant actions on DRPs but weaker effects on EFPs. IC50 values for DRP depression were 0.6, 0.8 and 1.0 µM for 5HT, DA and NA, respectively. Depression of DRPs by monoamines was nearly-identical in both muscle and cutaneous afferent-evoked responses, supporting a global modulation of the multimodal afferents stimulated. 5HT, DA and NA produced no change in the compound antidromic potentials evoked by intraspinal microstimulation indicating that depression of the DRP is unrelated to direct changes in the excitability of intraspinal afferent fibers, but due to metabotropic receptor activation. In summary, both myelinated afferent-evoked DRPs and monosynaptic
Transportation Energy Data Book, Edition 19
Energy Technology Data Exchange (ETDEWEB)
Davis, S.C.
1999-09-01
The Transportation Energy Data Book: Edition 19 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (http://www-cta.ornl.gov/data/tedb.htm).
Transportation energy data book
2009-01-01
The Transportation Energy Data Book: Edition 28 is a statistical compendium prepared and : published by Oak Ridge National Laboratory (ORNL) under contract with the U.S. Department of : Energy, Office of Energy Efficiency and Renewable Energy, Vehicl...
Cremer, Clemens; Neuweiler, Insa; Bechtold, Michel; Vanderborght, Jan
2016-04-01
Quantification of flow and solute transport in the shallow subsurface adjacent to the atmosphere is decisive to prevent groundwater pollution and conserve groundwater quality, to develop successful remediation strategies and to understand nutrient cycling. In nature, due to erratic precipitation-evaporation patterns, soil moisture content and related hydraulic conductivity in the vadose zone are not only variable in space but also in time. Flow directions and flow paths locally change between precipitation and evaporation periods. This makes the identification and description of solute transport processes in the vadose zone a complex problem. Recent studies (Lehmann and Or, 2009; Bechtold et al., 2011a) focused on the investigation of upward transport of solutes during evaporation in heterogeneous soil columns, where heterogeneity was introduced by a sharp vertical material interface between two types of sand. Lateral solute transport through the interface in both (lateral) directions was observed at different depths of the investigated soil columns. Following recent approaches, we conduct two-dimensional numerical simulations in a similar setup which is composed of two sands with a sharp vertical material interface. The investigation is broadened from the sole evaporation to combined precipitation-evaporation cycles in order to quantify transport processes resulting from the combined effects of heterogeneous soil structure and dynamic flow conditions. Simulations are performed with a coupled finite volume and random walk particle tracking algorithm (Ippisch et al., 2006; Bechtold et al., 2011b). By comparing scenarios with cyclic boundary conditions and stationary counterparts with the same net flow rate, we found that duration and intensity of precipitation and evaporation periods potentially have an influence on lateral redistribution of solutes and thus leaching rates. Whether or not dynamic boundary conditions lead to significant deviations in the transport
Can, Adem; Zanos, Panos; Moaddel, Ruin; Kang, Hye Jin; Dossou, Katinia S. S.; Wainer, Irving W.; Cheer, Joseph F.; Frost, Douglas O.; Huang, Xi-Ping
2016-01-01
Following administration at subanesthetic doses, (R,S)-ketamine (ketamine) induces rapid and robust relief from symptoms of depression in treatment-refractory depressed patients. Previous studies suggest that ketamine’s antidepressant properties involve enhancement of dopamine (DA) neurotransmission. Ketamine is rapidly metabolized to (2S,6S)- and (2R,6R)-hydroxynorketamine (HNK), which have antidepressant actions independent of N-methyl-d-aspartate glutamate receptor inhibition. These antidepressant actions of (2S,6S;2R,6R)-HNK, or other metabolites, as well as ketamine’s side effects, including abuse potential, may be related to direct effects on components of the dopaminergic (DAergic) system. Here, brain and blood distribution/clearance and pharmacodynamic analyses at DA receptors (D1–D5) and the DA, norepinephrine, and serotonin transporters were assessed for ketamine and its major metabolites (norketamine, dehydronorketamine, and HNKs). Additionally, we measured electrically evoked mesolimbic DA release and decay using fast-scan cyclic voltammetry following acute administration of subanesthetic doses of ketamine (2, 10, and 50 mg/kg, i.p.). Following ketamine injection, ketamine, norketamine, and multiple hydroxynorketamines were detected in the plasma and brain of mice. Dehydronorketamine was detectable in plasma, but concentrations were below detectable limits in the brain. Ketamine did not alter the magnitude or kinetics of evoked DA release in the nucleus accumbens in anesthetized mice. Neither ketamine’s enantiomers nor its metabolites had affinity for DA receptors or the DA, noradrenaline, and serotonin transporters (up to 10 μM). These results suggest that neither the side effects nor antidepressant actions of ketamine or ketamine metabolites are associated with direct effects on mesolimbic DAergic neurotransmission. Previously observed in vivo changes in DAergic neurotransmission following ketamine administration are likely indirect. PMID
Energy Technology Data Exchange (ETDEWEB)
Fradera, J., E-mail: jfradera@ubu.es; Cuesta-López, S., E-mail: scuesta@ubu.es
2013-12-15
The present work intend to be a first step towards the understanding and quantification of the hydrogen isotope complex phenomena in liquid metals for nuclear technology. Liquid metals under nuclear irradiation in, e.g., breeding blankets of a nuclear fusion reactor would generate tritium which is to be extracted and recirculated as fuel. At the same time that tritium is bred, helium is also generated and may precipitate in the form of nano bubbles. Other liquid metal systems of a nuclear reactor involve hydrogen isotope absorption processes, e.g., tritium extraction system. Hence, hydrogen isotope absorption into gas bubbles modelling and control may have a capital importance regarding design, operation and safety. Here general models for hydrogen isotopes transport in liquid metal and absorption into gas phase, that do not depend on the mass transfer limiting regime, are exposed and implemented in OpenFOAM® CFD tool for 0D–3D simulations. Results for a 0D case show the impact of a He dispersed phase of nano bubbles on hydrogen isotopes inventory at different temperatures as well as the inventory evolution during a He nucleation event. In addition, 1D and 2D axisymmetric cases are exposed showing the effect of a He dispersed gas phase on hydrogen isotope permeation through a lithium lead eutectic alloy and the effect of vortical structures on hydrogen isotope transport at a backward facing step. Exposed results give a valuable insight on current nuclear technology regarding the importance of controlling hydrogen isotope transport and its interactions with nucleation event through gas absorption processes.
Anisotropic amplification of proton transport in proton exchange membrane fuel cells
Thimmappa, Ravikumar; Fawaz, Mohammed; Devendrachari, Mruthyunjayachari Chattanahalli; Gautam, Manu; Kottaichamy, Alagar Raja; Shafi, Shahid Pottachola; Thotiyl, Musthafa Ottakam
2017-07-01
Though graphene oxide (GO) membrane shuttles protons under humid conditions, it suffer severe disintegration and anhydrous conditions lead to abysmal ionic conductivity. The trade-off between mechanical integrity and ionic conductivity challenge the amplification of GO's ionic transport under anhydrous conditions. We show anisotropic amplification of GO's ionic transport with a selective amplification of in plane contribution under anhydrous conditions by doping it with a plant extract, phytic acid (PA). The hygroscopic nature of PA stabilized interlayer water molecules and peculiar geometry of sbnd OH functionalities around saturated hydrocarbon ring anisotropically enhanced ionic transport amplifying the fuel cell performance metrics.
29 CFR 1202.12 - National Air Transport Adjustment Board.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false National Air Transport Adjustment Board. 1202.12 Section... § 1202.12 National Air Transport Adjustment Board. Under section 205, title II, of the Railway Labor Act... four representatives to constitute a Board known as the National Air Transport Adjustment Board. Two...
The thermoballistic transport model a novel approach to charge carrier transport in semiconductors
Lipperheide, Reinhard
2014-01-01
The book presents a comprehensive survey of the thermoballistic approach to charge carrier transport in semiconductors. This semi-classical approach, which the authors have developed over the past decade, bridges the gap between the opposing drift-diffusion and ballistic models of carrier transport. While incorporating basic features of the latter two models, the physical concept underlying the thermoballistic approach constitutes a novel, unifying scheme. It is based on the introduction of "ballistic configurations" arising from a random partitioning of the length of a semiconducting sample into ballistic transport intervals. Stochastic averaging of the ballistic carrier currents over the ballistic configurations results in a position-dependent thermoballistic current, which is the key element of the thermoballistic concept and forms the point of departure for the calculation of all relevant transport properties. In the book, the thermoballistic concept and its implementation are developed in great detai...
Li, Y.; Akbariyeh, S.; Gomez Peña, C. A.; Bartlet-Hunt, S.
2017-12-01
Understanding the impacts of future climate change on soil hydrological processes and solute transport is crucial to develop appropriate strategies to minimize adverse impacts of agricultural activities on groundwater quality. The goal of this work is to evaluate the direct effects of climate change on the fate and transport of nitrate beneath a center-pivot irrigated corn field in Nebraska Management Systems Evaluation Area (MSEA) site. Future groundwater recharge rate and actual evapotranspiration rate were predicted based on an inverse modeling approach using climate data generated by Weather Research and Forecasting (WRF) model under the RCP 8.5 scenario, which was downscaled from global CCSM4 model to a resolution of 24 by 24 km2. A groundwater flow model was first calibrated based on historical groundwater table measurement and was then applied to predict future groundwater table in the period 2057-2060. Finally, predicted future groundwater recharge rate, actual evapotranspiration rate, and groundwater level, together with future precipitation data from WRF, were used in a three-dimensional (3D) model, which was validated based on rich historic data set collected from 1993-1996, to predict nitrate concentration in soil and groundwater from the year 2057 to 2060. Future groundwater recharge was found to be decreasing in the study area compared to average groundwater recharge data from the literature. Correspondingly, groundwater elevation was predicted to decrease (1 to 2 ft) over the five years of simulation. Predicted higher transpiration data from climate model resulted in lower infiltration of nitrate concentration in subsurface within the root zone.
Khanday, Mudasir Ahmad; Somarajan, Bindu I; Mehta, Rachna; Mallick, Birendra Nath
2016-01-01
Normally, rapid eye movement sleep (REMS) does not appear during waking or non-REMS. Isolated, independent studies showed that elevated noradrenaline (NA) levels inhibit REMS and induce REMS loss-associated cytomolecular, cytomorphological, psychosomatic changes and associated symptoms. However, the source of NA and its target in the brain for REMS regulation and function in health and diseases remained to be confirmed in vivo . Using tyrosine hydroxylase (TH)-siRNA and virus-coated TH-shRNA in normal freely moving rats, we downregulated NA synthesis in locus coeruleus (LC) REM-OFF neurons in vivo . These TH-downregulated rats showed increased REMS, which was prevented by infusing NA into the pedunculo-pontine tegmentum (PPT), the site of REM-ON neurons, normal REMS returned after recovery. Moreover, unlike normal or control-siRNA- or shRNA-injected rats, upon REMS deprivation (REMSD) TH-downregulated rat brains did not show elevated Na-K ATPase (molecular changes) expression and activity. To the best of our knowledge, these are the first in vivo findings in an animal model confirming that NA from the LC REM-OFF neurons (1) acts on the PPT REM-ON neurons to prevent appearance of REMS, and (2) are responsible for inducing REMSD-associated molecular changes and symptoms. These observations clearly show neuro-physio-chemical mechanism of why normally REMS does not appear during waking. Also, that LC neurons are the primary source of NA, which in turn causes some, if not many, REMSD-associated symptoms and behavioral changes. The findings are proof-of-principle for the first time and hold potential to be exploited for confirmation toward treating REMS disorder and amelioration of REMS loss-associated symptoms in patients.
The Exchange Value Embedded in a Transport System
International Nuclear Information System (INIS)
Xia Qinglan; Xu Shaofeng
2010-01-01
This paper shows that a well designed transport system has an embedded exchange value by serving as a market for potential exchange between consumers. Under suitable conditions, one can improve the welfare of consumers in the system simply by allowing some exchange of goods between consumers during transportation without incurring additional transportation cost. We propose an explicit valuation formula to measure this exchange value for a given compatible transport system. This value is always nonnegative and bounded from above. Criteria based on transport structures, preferences and prices are provided to determine the existence of a positive exchange value. Finally, we study a new optimal transport problem with an objective taking into account of both transportation cost and exchange value.
COLLOID-FACILITATED TRANSPORT OF RADIONUCLIDES THROUGH THE VADOSE ZONE
International Nuclear Information System (INIS)
Flury, Markus
2003-01-01
Contaminants have leaked into the vadose zone at the USDOE Hanford reservation. It is important to understand the fate and transport of these contaminants to design remediation strategies and long-term waste management plans at the Hanford reservation. Colloids may play an important role in fate and transport of strongly sorbing contaminants, such as Cs or Pu. This project seeks to improve the basic understanding of colloid and colloid-facilitated transport of contaminants in the vadose zone. The specific objectives addressed are: (1) Determine the structure, composition, and surface charge characteristics of colloidal particles formed under conditions similar to those occurring during leakage of waste typical of Hanford tank supernatants into soils and sediments surrounding the tanks. (2) Characterize the mutual interactions between colloids, contaminant, and soil matrix in batch experiments under various ionic strength and pH conditions. We will investigate the nature of the solid-liquid interactions and the kinetics of the reactions. (3) Evaluate mobility of colloids through soil under different degrees of water saturation and solution chemistry (ionic strength and pH). (4) Determine the potential of colloids to act as carriers to transport the contaminant through the vadose zone and verify the results through comparison with field samples collected under leaking tanks. (5) Improve conceptual characterization of colloid-contaminant-soil interactions and colloid-facilitated transport for implementation into reactive chemical transport models. This project was in part supported by an NSF-IGERT grant to Washington State University. The IGERT grant provided funding for graduate student research and education, and two graduate students were involved in the EMSP project. The IGERT program also supported undergraduate internships. The project is part of a larger EMSP program to study fate and transport of contaminants under leaking Hanford waste tanks. The project has
Mervine, K. E.
This bibliography is part of a series of Environmental Resource Packets prepared under a grant from EXXON Education Foundation. The most authoritative and accessible references in the urban transportation field are reviewed. The authors, publisher, point of view, level, and summary are given for each reference. The references are categorized…
Safety analysis report for radwaste foam transport cask
International Nuclear Information System (INIS)
Ku, J. H.; Lee, J. C.; Bang, K. S.; Seo, K. S.; Lee, D. W.; Kim, J. H.; Park, S. W.; Lee, J. W.; Kim, K. H.
1999-08-01
For the tests and examinations of radwaste foam which generated in domestic nuclear power plants a radioactive material transport cask is needed to transport the radwaste foam from the power plants to KAERI. This cask should be easy to handle in the facilities and safe to maintain the shielding safety of operators. According to the regulations, it should be verified that this cask maintains the thermal and structural integrities under prescribed load conditions by the regulations. The basic structural functions and the integrities of the cask under required load conditions were evaluated. Therefore, it was verified that the cask is suitable to transport radwaste foam from nuclear power plants to KAERI. (author). 11 refs., 10 tabs., 25 figs
Kaneko, Tomoaki; Ohno, Takahisa
2018-03-01
We investigate the electronic structure and the transport properties of graphene adsorbed onto h-BN with carbon impurities or atomic vacancies using density functional theory and the non-equilibrium Green's function method. We find that the transport properties are degraded due to carrier doping and scattering off of localized defect states in h-BN. When graphene is doped by introducing defects in h-BN, the transmission spectra become asymmetric owing to the reduction of the electronic density of states, which contributes significantly to the degradation of graphene transport properties as compared with the effect of defect levels.
Some issues on environmental impact report of radioactive material transport
International Nuclear Information System (INIS)
Wang Jiaming
2001-01-01
The author puts forward some issues which should be paid attention to when compiling a environmental impact report of radioactive material transport. The main issues discussed are as follows: (1) Optimization analysis for transport routes. (2) Source terms under accident conditions in transport. (3) Precautions against accidents and emergency preparedness. (4) Quality assurance of transport, etc
Comparison of mass transport using average and transient rainfall boundary conditions
International Nuclear Information System (INIS)
Duguid, J.O.; Reeves, M.
1976-01-01
A general two-dimensional model for simulation of saturated-unsaturated transport of radionuclides in ground water has been developed and is currently being tested. The model is being applied to study the transport of radionuclides from a waste-disposal site where field investigations are currently under way to obtain the necessary model parameters. A comparison of the amount of tritium transported is made using both average and transient rainfall boundary conditions. The simulations indicate that there is no substantial difference in the transport for the two conditions tested. However, the values of dispersivity used in the unsaturated zone caused more transport above the water table than has been observed under actual conditions. This deficiency should be corrected and further comparisons should be made before average rainfall boundary conditions are used for long-term transport simulations
Transport Statistics - Transport - UNECE
Sustainable Energy Statistics Trade Transport Themes UNECE and the SDGs Climate Change Gender Ideas 4 Change UNECE Weekly Videos UNECE Transport Areas of Work Transport Statistics Transport Transport Statistics About us Terms of Reference Meetings and Events Meetings Working Party on Transport Statistics (WP.6
Transport processes in plasmas
International Nuclear Information System (INIS)
Balescu, R.
1988-01-01
This part is devoted to the classical transport theory in plasmas. Ch. 1 is a chapter of 'pure' hamiltonian mechanics and starts with the study of the motion of an individual charged particle in the presence of an electromagnetic field. Ch. 2 introduces the tools of statistical mechanics for the study of large collections of charged particles. A kinetic theory is derived as a basic tool for transport theory. In ch. 3 the hydro-dynamic - or plasmadynamic - balance equations are derived. The macroscopic dynamical equations have the structure of an infinite hierarchy. This introduces the necessity of construction of a transport theory, by which te infinite set of equations can be reduced to a finite, closed set. This can only be done by a detailed analysis of the kinetic equation under well defined conditions. The tools for such nan analysis are developed in ch. 4. In ch. 5 the transport equations, relating the unknown fluxes of matter, momentum, energy and electricity to the hydrodynamic variables, are derived and discussed. In ch. 6 the results are incorporated into the wider framework of non-equilibrium thermodynamics by connecting the transport processes to the central concept of entropy production. In ch. 7 the results of transport theory are put back into the equations of plasmadynamics
Zhang, Linling; Long, Ruyin; Chen, Hong; Yang, Tong
2018-02-01
Along with the rapid development of the transportation industry, the problems of the energy crisis and transport emissions have become increasingly serious. The success of traffic emission reduction is related to the realization of global low-carbon goals. Placing priority on public transport is the internationally recognized traffic development model. This paper takes Shanghai, China, as an example to examine the optimal public transport structure. Five factors were selected from personal and public perspectives, including travel costs, crowding degree, occupied area, traffic emissions, and operating subsidies. The objective functions of these factors were transformed into satisfaction functions, and a multi-objective programming model was used to solve for the optimal proportions of the ground bus and rail transit, and the carbon emission reduction potential was analyzed in different scenarios. The study showed that the actual proportion of rail transit in Shanghai was slightly lower than the optimal value, and accompanied by low satisfaction with each factor relative to the optimal value. It was difficult to achieve the traffic emission reduction targets by only reducing satisfaction with other factors except carbon emissions assuming a fixed proportion of public transport. As the proportion of total travel represented by public transport increased, rail transit became the main mode of public transport and the usage trend was more obvious, but the structure of public transport gradually reached a relatively stable state after a certain level of development. Compared to reducing carbon emissions by changing satisfaction with other factors, it was easier to achieve traffic emission reduction targets by increasing the proportion of public transport. To increase the proportion of public transport travel and achieve the goal of traffic reduction in the future, further improvements are needed in the quality of public transport system services, public transport
Osmotic stress alters chromatin condensation and nucleocytoplasmic transport
Energy Technology Data Exchange (ETDEWEB)
Finan, John D.; Leddy, Holly A. [Department of Orthopaedic Surgery, Duke University Medical Center, Durham, NC (United States); Department of Biomedical Engineering, Duke University, Durham, NC (United States); Guilak, Farshid, E-mail: guilak@duke.edu [Department of Orthopaedic Surgery, Duke University Medical Center, Durham, NC (United States); Department of Biomedical Engineering, Duke University, Durham, NC (United States)
2011-05-06
Highlights: {yields} The rate of nucleocytoplasmic transport increases under hyper-osmotic stress. {yields} The mechanism is a change in nuclear geometry, not a change in permeability of the nuclear envelope. {yields} Intracytoplasmic but not intranuclear diffusion is sensitive to osmotic stress. {yields} Pores in the chromatin of the nucleus enlarge under hyper-osmotic stress. -- Abstract: Osmotic stress is a potent regulator of biological function in many cell types, but its mechanism of action is only partially understood. In this study, we examined whether changes in extracellular osmolality can alter chromatin condensation and the rate of nucleocytoplasmic transport, as potential mechanisms by which osmotic stress can act. Transport of 10 kDa dextran was measured both within and between the nucleus and the cytoplasm using two different photobleaching methods. A mathematical model was developed to describe fluorescence recovery via nucleocytoplasmic transport. As osmolality increased, the diffusion coefficient of dextran decreased in the cytoplasm, but not the nucleus. Hyper-osmotic stress decreased nuclear size and increased nuclear lacunarity, indicating that while the nucleus was getting smaller, the pores and channels interdigitating the chromatin had expanded. The rate of nucleocytoplasmic transport was increased under hyper-osmotic stress but was insensitive to hypo-osmotic stress, consistent with the nonlinear osmotic properties of the nucleus. The mechanism of this osmotic sensitivity appears to be a change in the size and geometry of the nucleus, resulting in a shorter effective diffusion distance for the nucleus. These results may explain physical mechanisms by which osmotic stress can influence intracellular signaling pathways that rely on nucleocytoplasmic transport.
International Nuclear Information System (INIS)
Tani, Hiroshi
2003-01-01
Since the creation of the United Nations, the international community initiated efforts to harmonize international practices for the safe transport of hazardous goods, including radioactive material. And, IAEA is playing a key role in fostering the establishment of transport regulations on radioactive material. This current worldwide system of regulatory control has achieved an excellent safety record. However, some concerns still remain regarding the transport of radioactive material, as the discussion of this topic at IAEA General Conferences in the last few years. IAEA Transport conference planed as a forum in which to better understand these concerns, and to answer relevant underlying questions. At the same time, outside these technical areas, discussions also covered related issues such as liability resulting from an accident during the transport and communication between concerned governments, and between these governments and the public at large. The International Conference on the Safety of Transport of Radioactive Material took place in Vienna, Austria, from 7 to 11 July 2003. There were 534 nominated participants from 82 States, 9 intergovernmental organizations (IGOs), and 5 non-governmental organizations (NGOs), and there were 132 contributed and invited papers. By this report, I report the recent international situation on the transport of radioactive material and result of the IAEA 2003 Transport Conference. (author)
Croonenberghs, J; Delmeire, L; Verkerk, R; Lin, A H; Meskal, A; Neels, H; Van der Planken, M; Scharpe, S; Deboutte, D; Pison, G; Maes, M
2000-03-01
Some studies have suggested that disorders in the peripheral and central metabolism of serotonin (5-HT) and noradrenaline may play a role in the pathophysiology of autistic disorder. This study examines serotonergic and noradrenergic markers in a study group of 13 male, post-pubertal, caucasian autistic patients (age 12-18 y; I.Q. > 55) and 13 matched volunteers. [3H]-paroxetine binding Kd values were significantly higher in patients with autism than in healthy volunteers. Plasma concentrations of tryptophan, the precursor of 5-HT, were significantly lower in autistic patients than in healthy volunteers. There were no significant differences between autistic and normal children in the serum concentrations of 5-HT, or the 24-hr urinary excretion of 5-hydroxy-indoleacetic acid (5-HIAA), adrenaline, noradrenaline, and dopamine. There were no significant differences in [3H]-rauwolscine binding Bmax or Kd values, or in the serum concentrations of tyrosine, the precursor of noradrenaline, between both study groups. There were highly significant positive correlations between age and 24-hr urinary excretion of 5-HIAA and serum tryptophan. The results suggest that: 1) serotonergic disturbances, such as defects in the 5-HT transporter system and lowered plasma tryptophan, may play a role in the pathophysiology of autism; 2) autism is not associated with alterations in the noradrenergic system; and 3) the metabolism of serotonin in humans undergoes significant changes between the ages of 12 and 18 years.
49 CFR 222.51 - Under what conditions will quiet zone status be terminated?
2010-10-01
...-Quiet Zones § 222.51 Under what conditions will quiet zone status be terminated? (a) New Quiet Zones... 49 Transportation 4 2010-10-01 2010-10-01 false Under what conditions will quiet zone status be terminated? 222.51 Section 222.51 Transportation Other Regulations Relating to Transportation (Continued...
International Nuclear Information System (INIS)
Liu, Shuanglong; Feng, Yuan Ping; Zhang, Chun
2013-01-01
We show that when a molecular junction is under an external bias, its properties cannot be uniquely determined by the total electron density in the same manner as the density functional theory for ground state properties. In order to correctly incorporate bias-induced nonequilibrium effects, we present a dual mean field (DMF) approach. The key idea is that the total electron density together with the density of current-carrying electrons are sufficient to determine the properties of the system. Two mean fields, one for current-carrying electrons and the other one for equilibrium electrons can then be derived. Calculations for a graphene nanoribbon junction show that compared with the commonly used ab initio transport theory, the DMF approach could significantly reduce the electric current at low biases due to the non-equilibrium corrections to the mean field potential in the scattering region
Brief note about plasma catecholamines kinetics and submaximal exercise in untrained standardbreds
Directory of Open Access Journals (Sweden)
Paolo Baragli
2010-03-01
Full Text Available Four untrained standardbred horses performed a standardized exercise test on the treadmill and an automated blood collection system programmed to obtain blood samples every 15 s was used for blood collection in order to evaluate the kinetics of adrenaline and noradrenaline. The highest average values obtained for adrenaline and noradrenaline were 15.0 ± 3.0 and 15.8 ± 2.8 nmol/l respectively, with exponential accumulation of adrenaline (r = 0.977 and noradrenaline (r = 0.976 during the test. Analysis of the correlation between noradrenaline and adrenaline for each phase of the test shows that correlation coefficient decreases as the intensity of exercise increases (from r = 0.909 to r = 0.788. This suggests that during submaximal exercise, the process for release, distribution and clearance of adrenaline into blood circulation differs from that of noradrenaline.
Doummar, Joanna; Margane, Armin; Geyer, Tobias; Sauter, Martin
2018-03-01
Artificial tracer experiments were conducted in the mature karst system of Jeita (Lebanon) under various flow conditions using surface and subsurface tracer injection points, to determine the variation of transport parameters (attenuation of peak concentration, velocity, transit times, dispersivity, and proportion of immobile and mobile regions) along fast and slow flow pathways. Tracer breakthrough curves (TBCs) observed at the karst spring were interpreted using a two-region nonequilibrium approach (2RNEM) to account for the skewness in the TBCs' long tailings. The conduit test results revealed a discharge threshold in the system dynamics, beyond which the transport parameters vary significantly. The polynomial relationship between transport velocity and discharge can be related to the variation of the conduit's cross-sectional area. Longitudinal dispersivity in the conduit system is not a constant value (α = 7-10 m) and decreases linearly with increasing flow rate because of dilution effects. Additionally, the proportion of immobile regions (arising from conduit irregularities) increases with decreasing water level in the conduit system. From tracer tests with injection at the surface, longitudinal dispersivity values are found to be large (8-27 m). The tailing observed in some TBCs is generated in the unsaturated zone before the tracer actually arrives at the major subsurface conduit draining the system. This work allows the estimation and prediction of the key transport parameters in karst aquifers. It shows that these parameters vary with time and flow dynamics, and they reflect the geometry of the flow pathway and the origin of infiltrating (potentially contaminated) recharge.
International Nuclear Information System (INIS)
Caratini, G.
2012-01-01
The modern industrial activities (storage of nuclear waste, geothermal wells, nuclear power plants,...) can submit cementitious materials to some extreme conditions, for example at temperatures above 200 C. This level of temperature will induce phenomena of dehydration in the cement paste, particularly impacting the CSH hydrates which led to the mechanical cohesion. The effects of these temperatures on the mechanical and transport properties have been the subject of this thesis.To understand these effects, we need to take into account the heterogeneous, porous, multi-scale aspects of these materials. To do this, micro-mechanics and homogenization tools based on the Eshelby problem's solution were used. Moreover, to support this multi-scale modeling, mechanical testing based on the theory of porous media were conducted. The measurements of modulus compressibility, permeability and porosity under confining pressure were used to investigate the mechanisms of degradation of these materials during thermal loads up to 400 C. (author)
Electron transport in nanometer GaAs structure under radiation exposure
Demarina, N V
2002-01-01
One investigates into effect of neutron and proton irradiation on electron transport in nanometer GaAs structures. Mathematical model takes account of radiation defects via introduction of additional mechanisms od scattering of carriers at point defects and disordered regions. To investigate experimentally into volt-ampere and volt-farad characteristics one used a structure based on a field-effect transistor with the Schottky gate and a built-in channel. Calculation results of electron mobility, drift rate of electrons, time of energy relaxation and electron pulse are compared with the experimental data
ADVANCED CUTTINGS TRANSPORT STUDY
Energy Technology Data Exchange (ETDEWEB)
Ergun Kuru; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira; Neelima Godugu
2000-07-30
ACTS flow loop is now operational under elevated pressure and temperature. Currently, experiments with synthetic based drilling fluids under pressure and temperature are being conducted. Based on the analysis of Fann 70 data, empirical correlations defining the shear stress as a function of temperature, pressure and the shear rate have been developed for Petrobras synthetic drilling fluids. PVT equipment has been modified for testing Synthetic oil base drilling fluids. PVT tests with Petrobras Synthetic base mud have been conducted and results are being analyzed Foam flow experiments have been conducted and the analysis of the data has been carried out to characterize the rheology of the foam. Comparison of pressure loss prediction from the available foam hydraulic models and the test results has been made. Cuttings transport experiments in horizontal annulus section have been conducted using air, water and cuttings. Currently, cuttings transport tests in inclined test section are being conducted. Foam PVT analysis tests have been conducted. Foam stability experiments have also been conducted. Effects of salt and oil concentration on the foam stability have been investigated. Design of ACTS flow loop modification for foam and aerated mud flow has been completed. A flow loop operation procedure for conducting foam flow experiments under EPET conditions has been prepared Design of the lab-scale flow loop for dynamic foam characterization and cuttings monitoring instrumentation tests has been completed. The construction of the test loop is underway. As part of the technology transport efforts, Advisory Board Meeting with ACTS-JIP industry members has been organized on May 13, 2000.
Transportation Energy Data Book, Edition 18
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy C.
1998-09-01
The Transportation Energy Data Book: Edition 18 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. This edition of the Data Book has 11 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2 - energy Chapter 3 - emissions; Chapter 4 - transportation and the economy; Chapter 5 - highway vehicles; Chapter 6 - Light vehicles; Chapter 7 - heavy vehicles; Chapter 8 - alternative fuel vehicles; Chapter 9 - fleet vehicles; Chapter 10 - household vehicles; and Chapter 11 - nonhighway modes. The sources used represent the latest available data.
Tun, Temdara; Kang, Young-Sook
2017-05-01
Hyperglycemia causes the breakdown of the blood-retinal barrier by impairing endothelial nitric oxide synthase (eNOS) function. Statins have many pleiotropic effects such as improving endothelial barrier permeability and increasing eNOS mRNA stability. The objective of this study was to determine effect of simvastatin on l-arginine transport and NO production under high-glucose conditions in conditionally immortalized rat retinal capillary endothelial cell line (TR-iBRB). Changes in l-arginine transport uptake and, expression levels of cationic amino acid transporter 1 (CAT-1) and eNOS mRNA were investigated after pre-treatment with simvastatin and NOS inhibitors (l-NMMA and l-NAME) under high-glucose conditions using TR-iBRB, an in vitro model of iBRB. The NO level released from TR-iBRB cells was examined using Griess reagents. Under high glucose conditions, [ 3 H]l-arginine uptake was decreased in TR-iBRB cells. Simvastatin pretreatment elevated [ 3 H]l-arginine uptake, the expression levels of CAT-1 and eNOS mRNA, and NO production under high-glucose conditions. Moreover, the co-treatment with simvastatin and NOS inhibitors reduced [ 3 H]l-arginine uptake compared to pretreatment with simvastatin alone. Our results suggest that, in the presence of high-glucose levels, increased l-arginine uptake due to simvastatin treatment was associated with increased CAT-1 and eNOS mRNA levels, leading to higher NO production in TR-iBRB cells. Thus, simvastatin might be a good modulator for diabetic retinopathy therapy by increasing of the l-arginine uptake and improving endothelial function in retinal capillary endothelial cells. Copyright © 2017 Elsevier Inc. All rights reserved.
Visioni, Daniele; Pitari, Giovanni; Tuccella, Paolo; Curci, Gabriele
2018-02-01
Sustained injection of sulfur dioxide (SO2) in the tropical lower stratosphere has been proposed as a climate engineering technique for the coming decades. Among several possible environmental side effects, the increase in sulfur deposition deserves additional investigation. In this study we present results from a composition-climate coupled model (University of L'Aquila Composition-Chemistry Model, ULAQ-CCM) and a chemistry-transport model (Goddard Earth Observing System Chemistry-Transport Model, GEOS-Chem), assuming a sustained lower-stratospheric equatorial injection of 8 Tg SO2 yr-1. Total S deposition is found to globally increase by 5.2 % when sulfate geoengineering is deployed, with a clear interhemispheric asymmetry (+3.8 and +10.3 % in the Northern Hemisphere (NH) and the Southern Hemisphere (SH), due to +2.2 and +1.8 Tg S yr-1, respectively). The two models show good consistency, both globally and on a regional scale under background and geoengineering conditions, except for S-deposition changes over Africa and the Arctic. The consistency exists with regard to time-averaged values but also with regard to monthly and interannual deposition changes. The latter is driven essentially by the variability in stratospheric large-scale transport associated with the quasi-biennial oscillation (QBO). Using an externally nudged QBO, it is shown how a zonal wind E shear favors aerosol confinement in the tropical pipe and a significant increase in their effective radius (+13 % with respect to W shear conditions). The net result is an increase in the downward cross-tropopause S flux over the tropics with dominant E shear conditions with respect to W shear periods (+0.61 Tg S yr-1, +42 %, mostly due to enhanced aerosol gravitational settling) and a decrease over the extratropics (-0.86 Tg S yr-1, -35 %, mostly due to decreased large-scale stratosphere-troposphere exchange of geoengineering sulfate). This translates into S-deposition changes that are significantly
Contaminated sediment transport during floods
International Nuclear Information System (INIS)
Fontaine, T.A.
1992-01-01
Over the past 48 years, operations and waste disposal activities at Oak Ridge National Laboratory have resulted in the contamination of parts of the White Oak Creek catchment. The contaminants presenting the highest risk to human health and the environment are particle reactive and are associated with the soils and sediments in the White Oak Creek drainage system. The erosion of these sediments during floods can result in the transport of contaminants both within the catchment and off-site into the Clinch River. A data collection program and a modeling investigation are being used to evaluate the probability of contaminated sediment transport during floods and to develop strategies for controlling off-site transport under present and future conditions
Urban transport in Eastern Europe
International Nuclear Information System (INIS)
Crass, M.; Short, J.
1995-01-01
In the cities of central and easter Europe rapidly rising numbers of motor vehicles are flooding streets, choking city centres and emitting alarming volumes of air pollution. Decision-makers in the region face difficult choices in the design and development of their urban transport systems. Saddled with the legacy of transport networks conceived under central planning - aged, often obsolete fleets, facilities and equipment -they must find ways to address the economic, social and environmental pressures caused by the skyrocketing growth in the use of cars and lorries. They also have to reconcile a decline in demand for public transport with tight budgetary constraints and pressure to recover more of their costs through rises in fares. (authors). 4 refs
Structural and Thermal Safety Analysis Report for the Type B Radioactive Waste Transport Package
Energy Technology Data Exchange (ETDEWEB)
Kim, D. H.; Seo, K. S.; Lee, J. C.; Bang, K. S
2007-09-15
We carried out structural safety evaluation for the type B radioactive waste transport package. Requirements for type B packages according to the related regulations such as IAEA Safety Standard Series No. TS-R-1, Korea Most Act. 2001-23 and US 10 CFR Part 71 were evaluated. General requirements for packages such as those for a lifting attachment, a tie-down attachment and pressure condition were considered. For the type B radioactive waste transport package, the structural, thermal and containment analyses were carried out under the normal transport conditions. Also the safety analysis were conducted under the accidental transport conditions. The 9 m drop test, 1 m puncture test, fire test and water immersion test under the accidental transport conditions were consecutively done. The type B radioactive waste transport packages were maintained the structural and thermal integrities.
Lei, Bo; Huang, Yuan; Sun, Jingyu; Xie, Junjun; Niu, Mengliang; Liu, Zhixiong; Fan, Molin; Bie, Zhilong
2014-12-01
Grafting onto salt-tolerant pumpkin rootstock can increase cucumber salt tolerance. Previous studies have suggested that this can be attributed to pumpkin roots with higher capacity to limit the transport of Na(+) to the shoot than cucumber roots. However, the mechanism remains unclear. This study investigated the transport of Na(+) in salt-tolerant pumpkin and salt-sensitive cucumber plants under high (200 mM) or moderate (90 mM) NaCl stress. Scanning ion-selective electrode technique showed that pumpkin roots exhibited a higher capacity to extrude Na(+), and a correspondingly increased H(+) influx under 200 or 90 mM NaCl stress. The 200 mM NaCl induced Na(+)/H(+) exchange in the root was inhibited by amiloride (a Na(+)/H(+) antiporter inhibitor) or vanadate [a plasma membrane (PM) H(+) -ATPase inhibitor], indicating that Na(+) exclusion in salt stressed pumpkin and cucumber roots was the result of an active Na(+)/H(+) antiporter across the PM, and the Na(+)/H(+) antiporter system in salt stressed pumpkin roots was sufficient to exclude Na(+) X-ray microanalysis showed higher Na(+) in the cortex, but lower Na(+) in the stele of pumpkin roots than that in cucumber roots under 90 mM NaCl stress, suggesting that the highly vacuolated root cortical cells of pumpkin roots could sequester more Na(+), limit the radial transport of Na(+) to the stele and thus restrict the transport of Na(+) to the shoot. These results provide direct evidence for pumpkin roots with higher capacity to limit the transport of Na(+) to the shoot than cucumber roots. © 2014 Scandinavian Plant Physiology Society.
[EDRP public local inquiry] Statement by the Department of Transport
International Nuclear Information System (INIS)
1985-01-01
The safety responsibilities of the UK Secretary of State for Transport, in relation to radioactive materials under normal and accident conditions of transport, are outlined. The basic regulatory requirements necessitated by the IAEA regulations for safe transport of radioactive materials are summarised. A list of national and international regulations concerning the safe transport of radioactive materials to, from, or within the UK is provided. (U.K.)
Technology evaluation for time sensitive data transport
DEFF Research Database (Denmark)
Wessing, Henrik; Breach, Tony; Colmenero, Alberto
. The NREN communities must provide underlying network infrastructures and transport technologies to facilitate ser-vices with such requirements to the network. In this paper we investigate and evaluate circuit and packet based transport technologies from classic best effort IP over MPLS flavours, Provider...... Backbone Bridging (PBB), “Transparent Interconnect of Lots of Links” (TRILL) to Optical Transport Network (OTN) and SDH. The transport technologies are evaluated theoreti-cally, using simulations and/or experimentally. Each transport technology is evaluated based on its performances and capabilities...... overhead and restoration time. Thirdly, complexity and automation possibilities for establishment of paths for high demanding applica-tions, and finally how the technologies are backed by research communities and major vendors like Ciena, Alcatel-Lucent, Nokia-Siemens and Huawei. The technologies...
Highway and interline transportation routing models
International Nuclear Information System (INIS)
Joy, D.S.; Johnson, P.E.
1994-01-01
The potential impacts associated with the transportation of hazardous materials are important issues to shippers, carriers, and the general public. Since transportation routes are a central characteristic in most of these issues, the prediction of likely routes is the first step toward the resolution of these issues. In addition, US Department of Transportation requirements (HM-164) mandate specific routes for shipments of highway controlled quantities of radioactive materials. In response to these needs, two routing models have been developed at Oak Ridge National Laboratory under the sponsorship of the U.S. Department of Energy (DOE). These models have been designated by DOE's Office of Environmental Restoration and Waste Management, Transportation Management Division (DOE/EM) as the official DOE routing models. Both models, HIGHWAY and INTERLINE, are described
Transportation Energy Data Book, Edition 19; TOPICAL
International Nuclear Information System (INIS)
Davis, S.C.
1999-01-01
The Transportation Energy Data Book: Edition 19 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (http://www-cta.ornl.gov/data/tedb.htm)
Compressed Air/Vacuum Transportation Techniques
Guha, Shyamal
2011-03-01
General theory of compressed air/vacuum transportation will be presented. In this transportation, a vehicle (such as an automobile or a rail car) is powered either by compressed air or by air at near vacuum pressure. Four version of such transportation is feasible. In all versions, a ``c-shaped'' plastic or ceramic pipe lies buried a few inches under the ground surface. This pipe carries compressed air or air at near vacuum pressure. In type I transportation, a vehicle draws compressed air (or vacuum) from this buried pipe. Using turbine or reciprocating air cylinder, mechanical power is generated from compressed air (or from vacuum). This mechanical power transferred to the wheels of an automobile (or a rail car) drives the vehicle. In type II-IV transportation techniques, a horizontal force is generated inside the plastic (or ceramic) pipe. A set of vertical and horizontal steel bars is used to transmit this force to the automobile on the road (or to a rail car on rail track). The proposed transportation system has following merits: virtually accident free; highly energy efficient; pollution free and it will not contribute to carbon dioxide emission. Some developmental work on this transportation will be needed before it can be used by the traveling public. The entire transportation system could be computer controlled.
Neo-classical impurity transport
International Nuclear Information System (INIS)
Stringer, T.E.
The neo-classical theory for impurity transport in a toroidal plasma is outlined, and the results discussed. A general account is given of the impurity behaviour and its dependence on collisionality. The underlying physics is described with special attention to the role of the poloidal rotation
International Nuclear Information System (INIS)
Valenta, B.; Singer, E.A.
1991-01-01
Guinea pig papillary muscles were preincubated in the presence of 5 x 10 - 9 mol/L unlabeled noradrenaline or adrenaline then incubated with ( 3 H)-noradrenaline and superfused. Electrical field stimulation with 180 pulses delivered at 1 or 3 Hz was used to induce overflow of radioactivity. Comparison of the effects of preexposure of the tissue to adrenaline or noradrenaline revealed that adrenaline incubation caused an enhancement of stimulation-evoked overflow of ( 3 H)noradrenaline and a reduction of the effect of exogenously added isoprenaline. Furthermore, the selective beta 2-adrenoceptor antagonist ICI 118,551 (10 - 7 mol/L), but not the selective beta 1-adrenoceptor antagonist ICI 89,406 (10 - 7 mol/L), reduced electrically evoked overflow of ( 3 H)noradrenaline in tissue preincubated with adrenaline but not in tissue preincubated with noradrenaline. The overflow-reducing effect of ICI 118.551 occurred at stimulation with 3 Hz but not at stimulation with 1 Hz. The present results support the hypothesis that noradrenergic transmission in guinea pig papillary muscle is facilitated via beta 2-adrenoceptors, and that adrenaline may serve as transmitter in this positive feedback mechanism after its incorporation into sympathetic nerves
Cholinergic, noradrenergic and GABAergic control of sexual behaviour
DEFF Research Database (Denmark)
Nedergaard, Per
2000-01-01
acethylcholine, noradrenalin, GABA, sexual dysfunction, erectile dysfunction, rat, human, male, female......acethylcholine, noradrenalin, GABA, sexual dysfunction, erectile dysfunction, rat, human, male, female...
International Nuclear Information System (INIS)
Núñez, M A; Mendoza, R
2015-01-01
Several methods to estimate the velocity field of atmospheric flows, have been proposed to the date for applications such as emergency response systems, transport calculations and for budget studies of all kinds. These applications require a wind field that satisfies the conservation of mass but, in general, estimated wind fields do not satisfy exactly the continuity equation. An approach to reduce the effect of using a divergent wind field as input in the transport-diffusion equations, was proposed in the literature. In this work, a linear local analysis of a wind field, is used to show analytically that the perturbation of a large-scale nondivergent flow can yield a divergent flow with a substantially different structure. The effects of these structural changes in transport calculations are illustrated by means of analytic solutions of the transport equation
Network Performance Improvement under Epidemic Failures in Optical Transport Networks
DEFF Research Database (Denmark)
Fagertun, Anna Manolova; Ruepp, Sarah Renée
2013-01-01
In this paper we investigate epidemic failure spreading in large- scale GMPLS-controlled transport networks. By evaluating the effect of the epidemic failure spreading on the network, we design several strategies for cost-effective network performance improvement via differentiated repair times....... First we identify the most vulnerable and the most strategic nodes in the network. Then, via extensive simulations we show that strategic placement of resources for improved failure recovery has better performance than randomly assigning lower repair times among the network nodes. Our OPNET simulation...... model can be used during the network planning process for facilitating cost- effective network survivability design....
Directory of Open Access Journals (Sweden)
Nabanita Chatterjee
2011-01-01
Full Text Available The SLC6 class of membrane transporters, known primarily as neurotransmitter transporters, is increasingly appreciated for its roles in nutritional uptake of amino acids and other developmentally specific functions. A Drosophila SLC6 gene, Neurotransmitter transporter-like (Ntl, is expressed only in the male germline. Mobilization of a transposon inserted near the 3' end of the Ntl coding region yields male-sterile mutants defining a single complementation group. Germline transformation with Ntl cDNAs under control of male germline-specific control elements restores Ntl/Ntl homozygotes to normal fertility, indicating that Ntl is required only in the germ cells. In mutant males, sperm morphogenesis appears normal, with elongated, individualized and coiled spermiogenic cysts accumulating at the base of the testes. However, no sperm are transferred to the seminal vesicle. The level of polyglycylation of Ntl mutant sperm tubulin appears to be significantly lower than that of wild type controls. Glycine transporters are the most closely related SLC6 transporters to Ntl, suggesting that Ntl functions as a glycine transporter in developing sperm, where augmentation of the cytosolic pool of glycine may be required for the polyglycylation of the massive amounts of tubulin in the fly's giant sperm. The male-sterile phenotype of Ntl mutants may provide a powerful genetic system for studying the function of an SLC6 transporter family in a model organism.
Transportation Energy Data Book: Edition 23
Energy Technology Data Exchange (ETDEWEB)
Davis, S.C.
2003-10-24
The ''Transportation Energy Data Book: Edition 23'' is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (www-cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2--energy; Chapter 3--highway vehicles; Chapter 4--light vehicles; Chapter 5--heavy vehicles; Chapter 6--alternative fuel vehicles; Chapter 7--fleet vehicles; Chapter 8--household vehicles; and Chapter 9--nonhighway modes; Chapter 10--transportation and the economy; Chapter 11--greenhouse gas emissions; and Chapter 12--criteria pollutant emissions. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Transportation Energy Data Book: Edition 24
Energy Technology Data Exchange (ETDEWEB)
Davis, S.C.
2005-03-08
The ''Transportation Energy Data Book: Edition 24'' is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2--energy; Chapter 3--highway vehicles; Chapter 4--light vehicles; Chapter 5--heavy vehicles; Chapter 6--alternative fuel vehicles; Chapter 7--fleet vehicles; Chapter 8--household vehicles; and Chapter 9--nonhighway modes; Chapter 10--transportation and the economy; Chapter 11--greenhouse gas emissions; and Chapter 12--criteria pollutant emissions. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Transportation Energy Data Book: Edition 27
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL; Boundy, Robert Gary [ORNL
2008-06-01
The Transportation Energy Data Book: Edition 27 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2 energy; Chapter 3 highway vehicles; Chapter 4 light vehicles; Chapter 5 heavy vehicles; Chapter 6 alternative fuel vehicles; Chapter 7 fleet vehicles; Chapter 8 household vehicles; and Chapter 9 nonhighway modes; Chapter 10 transportation and the economy; Chapter 11 greenhouse gas emissions; and Chapter 12 criteria pollutant emissions. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Transportation Energy Data Book: Edition 26
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL
2007-07-01
The Transportation Energy Data Book: Edition 26 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2 - energy; Chapter 3 - highway vehicles; Chapter 4 - light vehicles; Chapter 5 - heavy vehicles; Chapter 6 - alternative fuel vehicles; Chapter 7 - fleet vehicles; Chapter 8 - household vehicles; and Chapter 9- nonhighway modes; Chapter 10 - transportation and the economy; Chapter 11 - greenhouse gas emissions; and Chapter 12 - criteria pollutant emissions. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Transportation Energy Data Book: Edition 25
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL
2006-06-01
The Transportation Energy Data Book: Edition 25 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2 - energy; Chapter 3 - highway vehicles; Chapter 4 - light vehicles; Chapter 5 - heavy vehicles; Chapter 6 - alternative fuel vehicles; Chapter 7 - fleet vehicles; Chapter 8 - household vehicles; and Chapter 9- nonhighway modes; Chapter 10 - transportation and the economy; Chapter 11 - greenhouse gas emissions; and Chapter 12 - criteria pollutant emissions. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Transportation Energy Data Book: Edition 22
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy C.; Diegel, Susan W.
2002-12-04
The Transportation Energy Data Book: Edition 22 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Planning, Budget Formulation, and Analysis, under the Energy Efficiency and Renewable Energy (EERE) program in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. The latest editions of the Data Book are available to a larger audience via the Internet (www.cta.ornl.gov/data). This edition of the Data Book has 12 chapters which focus on various aspects of the transportation industry. Chapter 1 focuses on petroleum; Chapter 2 - energy; Chapter 3 - greenhouse gas emissions; Chapter 4 - criteria pollutant emissions; Chapter 5 - transportation and the economy; Chapter 6 - highway vehicles; Chapter 7 - light vehicles; Chapter 8 - heavy vehicles; Chapter 9 - alternative fuel vehicles; Chapter 10 - fleet vehicles; Chapter 11 - household vehicles; and Chapter 12- nonhighway modes. The sources used represent the latest available data. There are also three appendices which include detailed source information for some tables, measures of conversion, and the definition of Census divisions and regions. A glossary of terms and a title index are also included for the readers convenience.
Regional transport sector mitigation options
Energy Technology Data Exchange (ETDEWEB)
Zhou, Peter [EECG Consultants, Gaborone (Botswana)
1998-10-01
The rationale for conducting climate change mitigation studies in the transport sector is on the premise that: The transport sector is the second largest consumer of fossil fuels in the region; The regional transport sector is an area with high opportunity for infrastructural development under UNFCCC financial mechanism; The regional transport sector is crucial in the SADC region for trade and coupled with the Trade Protocol will play a major role in development hence the need to make it efficient in terms of energy demand and provision of services; The sector offers many mitigation options but with a challenge to evaluate their energy saving and GHG saving potential and yet there is need to quantify possible emission reduction for possible future emission trading. This is also a sector with potential to qualify for financing through Clean Development Mechanism (CDM) recently stipulated in the Kyoto Protocol. (au)
Regional transport sector mitigation options
International Nuclear Information System (INIS)
Zhou, Peter
1998-01-01
The rationale for conducting climate change mitigation studies in the transport sector is on the premise that: The transport sector is the second largest consumer of fossil fuels in the region; The regional transport sector is an area with high opportunity for infrastructural development under UNFCCC financial mechanism; The regional transport sector is crucial in the SADC region for trade and coupled with the Trade Protocol will play a major role in development hence the need to make it efficient in terms of energy demand and provision of services; The sector offers many mitigation options but with a challenge to evaluate their energy saving and GHG saving potential and yet there is need to quantify possible emission reduction for possible future emission trading. This is also a sector with potential to qualify for financing through Clean Development Mechanism (CDM) recently stipulated in the Kyoto Protocol. (au)
Standardization of transportation classes for object-oriented deployment simulations.
Energy Technology Data Exchange (ETDEWEB)
Burke, J. F., Jr.; Howard, D. L.; Jackson, J.; Macal, C. M.; Nevins, M. R.; Van Groningen, C. N.
1999-07-30
Many recent efforts to integrate transportation and deployment simulations, although beneficial, have lacked a feature vital for seamless integration: a common data class representation. It is an objective of the Department of Defense (DoD) to standardize all classes used in object-oriented deployment simulations by developing a standard class attribute representation and behavior for all deployment simulations that rely on an underlying class representation. The Extensive Hierarchy and Object Representation for Transportation Simulations (EXHORT) is a collection of three hierarchies that together will constitute a standard and consistent class attribute representation and behavior that could be used directly by a large set of deployment simulations. The first hierarchy is the Transportation Class Hierarchy (TCH), which describes a significant portion of the defense transportation system; the other two deal with infrastructure and resource classes. EXHORT will allow deployment simulations to use the same set of underlying class data, ensure transparent exchanges, reduce the effort needed to integrate simulations, and permit a detailed analysis of the defense transportation system. This paper describes EXHORT's first hierarchy, the TCH, and provides a rationale for why it is a helpful tool for modeling major portions of the defense transportation system.
Transportation of irradiated fuel elements
International Nuclear Information System (INIS)
Preece, A.H.
1980-01-01
The report falls under the headings: introduction (explaining the special interest of the London Borough of Brent, as forming part of the route for transportation of irradiated fuel elements); nuclear power (with special reference to transport of spent fuel and radioactive wastes); the flask aspect (design, safety regulations, criticisms, tests, etc.); the accident aspect (working manual for rail staff, train formation, responsibility, postulated accident situations); the emergency arrangements aspect; the monitoring aspect (health and safety reports); legislation; contingency plans; radiation - relevant background information. (U.K.)
Transportation energy conservation data book: edition I. 5
Energy Technology Data Exchange (ETDEWEB)
Shonka, D B; Loebl, A S; Ogle, M C; Johnson, M L; Howard, E B
1977-01-01
This document contains statistical information on the major transportation modes, their respective energy consumption patterns, and other pertinent factors influencing performance in the transportation sector. Data relating to past, present, and projected energy use and conservation in the transportation sector are presented under seven chapter headings. These focus on (1) modal transportation characteristics, (2) energy characteristics of the transportation sector, (3) energy conservation alternatives involving the transportation sector, (4) government impacts on the transportation sector, (5) the supply of energy to the transportation sector, (6) characteristics of transportation demand, and (7) miscellaneous reference materials such as energy conversion factors and geographical maps. References are included for each set of data presented, and a more general bibliography is included at the end of the book. In addition, a glossary of key terms and a subject index is provided for the user. A second edition of this document is scheduled for publication in September 1977.
49 CFR 195.412 - Inspection of rights-of-way and crossings under navigable waters.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Inspection of rights-of-way and crossings under navigable waters. 195.412 Section 195.412 Transportation Other Regulations Relating to Transportation... Inspection of rights-of-way and crossings under navigable waters. (a) Each operator shall, at intervals not...
Drift-Scale Radionuclide Transport
International Nuclear Information System (INIS)
Houseworth, J.
2004-01-01
The purpose of this model report is to document the drift scale radionuclide transport model, taking into account the effects of emplacement drifts on flow and transport in the vicinity of the drift, which are not captured in the mountain-scale unsaturated zone (UZ) flow and transport models ''UZ Flow Models and Submodels'' (BSC 2004 [DIRS 169861]), ''Radionuclide Transport Models Under Ambient Conditions'' (BSC 2004 [DIRS 164500]), and ''Particle Tracking Model and Abstraction of Transport Process'' (BSC 2004 [DIRS 170041]). The drift scale radionuclide transport model is intended to be used as an alternative model for comparison with the engineered barrier system (EBS) radionuclide transport model ''EBS Radionuclide Transport Abstraction'' (BSC 2004 [DIRS 169868]). For that purpose, two alternative models have been developed for drift-scale radionuclide transport. One of the alternative models is a dual continuum flow and transport model called the drift shadow model. The effects of variations in the flow field and fracture-matrix interaction in the vicinity of a waste emplacement drift are investigated through sensitivity studies using the drift shadow model (Houseworth et al. 2003 [DIRS 164394]). In this model, the flow is significantly perturbed (reduced) beneath the waste emplacement drifts. However, comparisons of transport in this perturbed flow field with transport in an unperturbed flow field show similar results if the transport is initiated in the rock matrix. This has led to a second alternative model, called the fracture-matrix partitioning model, that focuses on the partitioning of radionuclide transport between the fractures and matrix upon exiting the waste emplacement drift. The fracture-matrix partitioning model computes the partitioning, between fractures and matrix, of diffusive radionuclide transport from the invert (for drifts without seepage) into the rock water. The invert is the structure constructed in a drift to provide the floor of the
Monte Carlo simulation of nonlinear reactive contaminant transport in unsaturated porous media
International Nuclear Information System (INIS)
Giacobbo, F.; Patelli, E.
2007-01-01
In the current proposed solutions of radioactive waste repositories, the protective function against the radionuclide water-driven transport back to the biosphere is to be provided by an integrated system of engineered and natural geologic barriers. The occurrence of several nonlinear interactions during the radionuclide migration process may render burdensome the classical analytical-numerical approaches. Moreover, the heterogeneity of the barriers' media forces approximations to the classical analytical-numerical models, thus reducing their fidelity to reality. In an attempt to overcome these difficulties, in the present paper we adopt a Monte Carlo simulation approach, previously developed on the basis of the Kolmogorov-Dmitriev theory of branching stochastic processes. The approach is here extended for describing transport through unsaturated porous media under transient flow conditions and in presence of nonlinear interchange phenomena between the liquid and solid phases. This generalization entails the determination of the functional dependence of the parameters of the proposed transport model from the water content and from the contaminant concentration, which change in space and time during the water infiltration process. The corresponding Monte Carlo simulation approach is verified with respect to a case of nonreactive transport under transient unsaturated flow and to a case of nonlinear reactive transport under stationary saturated flow. Numerical applications regarding linear and nonlinear reactive transport under transient unsaturated flow are reported
Terminals for Suburb Bus Transport in Bratislava
Schlosser, Tibor; Schlosser, Peter; Cápayová, Silvia; Hodáková, Dominika
2017-10-01
The main objective of this article is to describe the strategy for development of the public transport terminals in the city of Bratislava, Capital of Slovak Republic. The reason goes from the private operator Slovak Lines, who operates the suburb bus transport in the agglomeration of the city. For this operator was created a transport model, while placing emphasis on optimizing the compliance of suburban public transport with urban public transport in the city of Bratislava and evaluating the significance of the new Bus Station to be constructed at Mlynské Nivy - in a new down town centre of the city. The main issue is to ensure the best available offer of public transport (PT) to passengers in the Bratislava agglomeration. The subject of the study was oriented to specify and propose changes in the transport infrastructure and integrated public transport organisation on the area of the city in terms of the significant position of the new Mlynské Nivy Bus Station (MN BS), which is under preparation with realization in the year 2017.
Végh, D; Somogyi, A; Bányai, D; Lakatos, M; Balogh, M; Al-Khrasani, M; Fürst, S; Vizi, E S; Hermann, P
2017-10-01
Since a significant proportion of diabetic patients have clinical or subclinical neuropathy, there may be concerns about the use of local anaesthetics. The present study was designed to determine and compare the effects of articaine, a widely used anaesthetic in dental practice, and lidocaine on the resting and axonal stimulation-evoked release of [ 3 H]noradrenaline ([ 3 H]NA) in prefrontal cortex slices and the release of [ 3 H]NA in spinal cord slices prepared from non-diabetic and streptozocin (STZ)-induced diabetic (glucose level=22.03±2.31mmol/l) rats. The peak of allodynia was achieved 9 weeks after STZ-treatment. Articaine and lidocaine inhibited the stimulation-evoked release in a concentration-dependent manner and increased the resting release by two to six times. These effects indicate an inhibitory action of these anaesthetics on Na + - and K + -channels. There was no difference in clinically important nerve conduction between non-diabetic and diabetic rats, as measured by the release of transmitter in response to axonal stimulation. The uptake and resting release of NA was significantly higher in the brain slices prepared from diabetic rats, but there were no differences in the spinal cord. For the adverse effects, the effects of articaine on K + channels (resting release) are more pronounced compared to lidocaine. In this respect, articaine has a thiophene ring with high lipid solubility, which may present potential risks for some patients. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Sørensen, Jakob B.; Larsen, Erik Hviid
1999-01-01
Adrenaline; carbachol; Cl- secretion; exocrine gland; isoproterenol; noradrenaline; prostaglandin E*U2......Adrenaline; carbachol; Cl- secretion; exocrine gland; isoproterenol; noradrenaline; prostaglandin E*U2...
International Nuclear Information System (INIS)
Wang Yu; Gao Bin; Morales, Verónica L.; Tian Yuan; Wu Lei; Gao Jie; Bai Wei; Yang Liuyan
2012-01-01
Because of its wide applications, nanosized titanium dioxide may become a potential environmental risk to soil and groundwater system. It is therefore important to improve current understanding of the environmental fate and transport of titanium oxides nanoparticles (TONPs). In this work, the effect of solution chemistry (i.e., pH, ionic strength, and natural organic matter (NOM) concentration) on the deposition and transport of TONPs in saturated porous media was examined in detail. Laboratory columns packed with acid-cleaned quartz sand were used in the experiment as porous media. Transport experiments were conducted with various chemistry combinations, including four ionic strengths, three pH levels, and two NOM concentrations. The results showed that TONP mobility increased with increasing solution pH, but decreased with increasing solution ionic strength. It is also found that the presence of NOM in the system enhanced the mobility of TONPs in the saturated porous media. The Derjaguin–Landau–Verwey–Overbeek (DLVO) theory was used to justify the mobility trends observed in the experimental data. Predictions from the theory agreed excellently with the experimental data.
Energy Technology Data Exchange (ETDEWEB)
Adkins, Harold [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Geelhood, Ken [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Koeppel, Brian [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coleman, Justin [Idaho National Lab. (INL), Idaho Falls, ID (United States); Bignell, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flores, Gregg [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wang, Jy-An [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sanborn, Scott [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Spears, Robert [Idaho National Lab. (INL), Idaho Falls, ID (United States); Klymyshyn, Nick [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2013-09-30
This document addresses Oak Ridge National Laboratory milestone M2FT-13OR0822015 Demonstration of Approach and Results on Used Nuclear Fuel Performance Characterization. This report provides results of the initial demonstration of the modeling capability developed to perform preliminary deterministic evaluations of moderate-to-high burnup used nuclear fuel (UNF) mechanical performance under normal conditions of storage (NCS) and normal conditions of transport (NCT) conditions. This report also provides results from the sensitivity studies that have been performed. Finally, discussion on the long-term goals and objectives of this initiative are provided.
Antidepressant therapy in epilepsy: can treating the comorbidities affect the underlying disorder?
Cardamone, L; Salzberg, MR; O'Brien, TJ; Jones, NC
2013-01-01
There is a high incidence of psychiatric comorbidity in people with epilepsy (PWE), particularly depression. The manifold adverse consequences of comorbid depression have been more clearly mapped in recent years. Accordingly, considerable efforts have been made to improve detection and diagnosis, with the result that many PWE are treated with antidepressant drugs, medications with the potential to influence both epilepsy and depression. Exposure to older generations of antidepressants (notably tricyclic antidepressants and bupropion) can increase seizure frequency. However, a growing body of evidence suggests that newer (‘second generation’) antidepressants, such as selective serotonin reuptake inhibitors or serotonin-noradrenaline reuptake inhibitors, have markedly less effect on excitability and may lead to improvements in epilepsy severity. Although a great deal is known about how antidepressants affect excitability on short time scales in experimental models, little is known about the effects of chronic antidepressant exposure on the underlying processes subsumed under the term ‘epileptogenesis’: the progressive neurobiological processes by which the non-epileptic brain changes so that it generates spontaneous, recurrent seizures. This paper reviews the literature concerning the influences of antidepressants in PWE and in animal models. The second section describes neurobiological mechanisms implicated in both antidepressant actions and in epileptogenesis, highlighting potential substrates that may mediate any effects of antidepressants on the development and progression of epilepsy. Although much indirect evidence suggests the overall clinical effects of antidepressants on epilepsy itself are beneficial, there are reasons for caution and the need for further research, discussed in the concluding section. PMID:23146067
Fire test of container for radioactive materials under the condition of transportation state
International Nuclear Information System (INIS)
Miyazaki, Sanae; Shimada, Hirohisa
1986-01-01
To secure the safe transportation of container for radioactive materials, furnace and open fire test for the thermal test of container are provided. Therefore, we have carried out furnace and open fire test using test model simulating a transportation state. Test model used in this test is made of stainless steel with diameter of 200 mm and length of 400 mm, and is set on the rest as in the case of transportation state. From the data on temperature measurement, some interesting results are obtained as follows. Near the surface of model, the temperature gradient in the direction perpendicular to the surface of model with the rest is greater than that without the rest. The temperature rise at the center of the model with the rest is less than that without the rest. In the experiment, temperature distributions are measured in the three radial directions. The temperature differences among three distributions in the model with rest are greater than that without rest. On the other hand, in the furnace test, the heat transfer coefficient on the surface of test model with the rest is 90 - 140 kcal/m 2 h · K for the range of furnace temperature from 700 to 950 deg C and this value is almost equal to the value without the rest. (author)
Thermal Transport in Phosphorene.
Qin, Guangzhao; Hu, Ming
2018-03-01
Phosphorene, a novel elemental 2D semiconductor, possesses fascinating chemical and physical properties which are distinctively different from other 2D materials. The rapidly growing applications of phosphorene in nano/optoelectronics and thermoelectrics call for comprehensive studies of thermal transport properties. In this Review, based on the theoretical and experimental progresses, the thermal transport properties of single-layer phosphorene, multilayer phosphorene (nanofilms), and bulk black phosphorus are summarized to give a general view of the overall thermal conductivity trend from single-layer to bulk form. The mechanism underlying the discrepancy in the reported thermal conductivity of phosphorene is discussed by reviewing the effect of different functionals and cutoff distances on the thermal transport evaluations. This Review then provides fundamental insight into the thermal transport in phosphorene by reviewing the role of resonant bonding in driving giant phonon anharmonicity and long-range interactions. In addition, the extrinsic thermal conductivity of phosphorene is reviewed by discussing the effects of strain and substrate, together with phosphorene based heterostructures and nanoribbons. This Review summarizes the progress of thermal transport in phosphorene from both theoretical calculations and experimental measurements, which would be of significance to the design and development of efficient phosphorene based nanoelectronics. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Onishi, Y.; Serne, R.J.; Arnold, E.M.; Cowan, C.E.; Thompson, F.L. [Pacific Northwest Lab., Richland, WA (United States)
1981-01-01
This report describes the results of a detailed literature review of radionuclide transport models applicable to rivers, estuaries, coastal waters, the Great Lakes, and impoundments. Some representatives sediment transport and water quality models were also reviewed to evaluate if they can be readily adapted to radionuclide transport modeling. The review showed that most available transport models were developed for dissolved radionuclide in rivers. These models include the mechanisms of advection, dispersion, and radionuclide decay. Since the models do not include sediment and radionuclide interactions, they are best suited for simulating short-term radionuclide migration where: (1) radionuclides have small distribution coefficients; (2) sediment concentrations in receiving water bodies are very low. Only 5 of the reviewed models include full sediment and radionuclide interactions: CHMSED developed by Fields; FETRA SERATRA, and TODAM developed by Onishi et al, and a model developed by Shull and Gloyna. The 5 models are applicable to cases where: (1) the distribution coefficient is large; (2) sediment concentrations are high; or (3) long-term migration and accumulation are under consideration. The report also discusses radionuclide absorption/desorption distribution ratios and addresses adsorption/desorption mechanisms and their controlling processes for 25 elements under surface water conditions. These elements are: Am, Sb, C, Ce, Cm, Co, Cr, Cs, Eu, I, Fe, Mn, Np, P, Pu, Pm, Ra, Ru, Sr, Tc, Th, {sup 3}H, U, Zn and Zr.
LeMonte, J.; Price, C. L.; Seiter, J.; Crocker, F. H.; Douglas, T.; Chappell, M. A.
2017-12-01
The roles and missions that the U.S. Department of Defense (DoD) undertakes in the Arctic are being reshaped by significant changes in the operational environment as a result of rising global temperatures and increased development of the vast training ranges available in Alaska. The Arctic is warming faster than any other region on Earth resulting in changing seasonality and precipitation patterns that, in turn, are leading to alterations in above ground vegetation, permafrost stability and summer sea ice extent. Collectively, these poorly defined ecosystem changes play critical roles in affecting the transport and eventual fate of persistent military relevant contaminants through unique Arctic and Subarctic terrestrial environments. As a result, management of military contaminants in a changing Arctic represents a unique and potentially significant liability to the Army and the DoD. The United States footprint in the Arctic region falls within the state of Alaska and U.S. Army Alaska manages 10% of all active Army training lands worldwide, which cover nearly 2,500 square miles in total land area. Primary recalcitrant contaminants of concern at active training ranges and at legacy sites include energetics (i.e. RDX and 2,4-dinitrotoluene) and heavy metals (i.e. antimony and lead). Through a series of field sampling and laboratory experiments, the objectives of this work are to: 1) quantify soil biogeochemical attributes that effect the physical fate and transport of military relevant contaminants in Arctic and subarctic soils under freeze-thaw conditions with a focus on near surface processes, and 2) quantify microbial diversity in Arctic and subarctic soils and the environmental constraints on community activity while exploring the effects of amendments on community function as they relate to contaminant transformation.
Winter Counter-Wind Transport in the Inner Southwestern Yellow Sea
Wu, Hui; Gu, Jinghua; Zhu, Ping
2018-01-01
Coastal currents generally flow downshelf with land on the right side (Northern Hemisphere) under the geostrophic balance, and are often strengthened by downwelling-favorable winds. However, the recent mooring observation in the inner southwestern Yellow Sea showed that coastal transport direction can be substantially changed by tidal forcing. In the survey, the tidal-averaged transports at two out of three sites remained northward (i.e., in the upshelf direction) and opposite the downwelling-favorable northerly wind, except during a brief neap tide period. Numerical experiments showed that the incoming Poincaré wave tide from the East China Sea plays a key role in forming this counter-wind transport system. This tidal wave produces a shoreward tidal stress south of 33.5°N in the inner southwestern Yellow Sea, driving an upshelf transport under the Earth's rotation. Counterpropagating tidal waves from the East China Sea and the northern Yellow Sea collide in coastal water in 32.5-34°N, which produce a standing tidal wave and therefore a mean sea-surface setup with alongshore and cross-shelf scales of both >100 km. This sea-surface setup causes an alongshore sea surface gradient, which veers the upshelf transport to the offshore direction under geostrophic balance. The strong tidal current increases the tidal-mean bottom resistance in the SCW, thus reduces the wind-driven current to a magnitude smaller than the tide-induced residual transport velocity. Therefore, upshelf transport persists in the inner southwestern Yellow Sea, and the Changjiang River Estuary becomes a major source area for the inner southwestern Yellow Sea.
Hypothalamic digoxin, hemispheric chemical dominance, and sleep.
Kurup, Ravi Kumar; Kurup, Parameswara Achutha
2003-04-01
The isoprenoid path way produces endogenous digoxin, a substance that can regulate neurotransmitter and amino acid transport. Digoxin synthesis and neurotransmitter patterns were assessed in individuals with chronic insomnia. The patterns were compared in those with right hemispheric and left hemispheric dominance. The activity of HMG GoA reductase and serum levels of digoxin, magnesium, tryptophan catabolites, and tyrosine catabolites were measured in individuals with chronic insomnia and in individuals with differing hemispheric dominance. Digoxin synthesis was increased with upregulated tryptophan catabolism (increased levels of serotonin, strychnine, and nicotine), and downregulated tyrosine catabolism (decreased levels of dopamine, noradrenaline, and morphine) in those with chronic insomnia and right hemispheric chemical dominance. Digoxin synthesis was reduced with downregulated tryptophan catabolism (decreased levels of serotonin, strychnine, and nicotine) and upregulated tyrosine catabolism (increased levels of dopamine, noradrenaline, and morphine) in those with normal sleep patterns and left hemispheric chemical dominance. Hypothalamic digoxin plays a central role in the regulation of sleep behavior. Hemispheric chemical dominance in relation to digoxin status is also crucial.
Guo, Yangyu; Wang, Moran
2017-10-01
The single mode relaxation time approximation has been demonstrated to greatly underestimate the lattice thermal conductivity of two-dimensional materials due to the collective effect of phonon normal scattering. Callaway's dual relaxation model represents a good approximation to the otherwise ab initio solution of the phonon Boltzmann equation. In this work we develop a discrete-ordinate-method (DOM) scheme for the numerical solution of the phonon Boltzmann equation under Callaway's model. Heat transport in a graphene ribbon with different geometries is modeled by our scheme, which produces results quite consistent with the available molecular dynamics, Monte Carlo simulations, and experimental measurements. Callaway's lattice thermal conductivity model with empirical boundary scattering rates is examined and shown to overestimate or underestimate the direct DOM solution. The length convergence of the lattice thermal conductivity of a rectangular graphene ribbon is explored and found to depend appreciably on the ribbon width, with a semiquantitative correlation provided between the convergence length and the width. Finally, we predict the existence of a phonon Knudsen minimum in a graphene ribbon only at a low system temperature and isotope concentration so that the average normal scattering rate is two orders of magnitude stronger than the intrinsic resistive one. The present work will promote not only the methodology for the solution of the phonon Boltzmann equation but also the theoretical modeling and experimental detection of hydrodynamic phonon transport in two-dimensional materials.
Min, Leilei; Shen, Yanjun; Pei, Hongwei; Wang, Ping
2018-04-01
Groundwater-fed agriculture has caused water table declines and groundwater quality degradation in the North China Plain. Based on sediment sampling in deep vadose zone (with a maximum depth of 11.0 m), groundwater recharge, seepage velocity, solute inventory and transport under four typical irrigated agricultural land-use types (winter wheat and summer maize, WM; pear orchards, PO; outdoor vegetables, VE; and cotton, CO) were investigated in this study. The results reveal that there are many solutes stored in the vadose zone. Nitrate storage per unit depth in the vadose zone is highest under PO (1703 kg/ha), followed by VE (970 kg/ha), WM (736 kg/ha) and CO (727 kg/ha). However, the amount of annual leached nitrate under the four land-use types results in a different order (VE, 404 kg/ha; WM, 108 kg/ha; PO, 23 kg/ha; CO, 13 kg/ha). The estimated average recharge rates are 180 mm/yr for WM, 27 mm/yr for CO, 320 mm/yr for VE and 49 mm/yr for PO. The seepage velocity under VE (2.22 m/yr) exceeds the values under the other three land-use types (WM, 0.85 m/yr; PO, 0.49 m/yr; CO, 0.09 m/yr). The highest seepage velocity under VE caused significant nitrate contamination in groundwater, whereas the other two land-use types (WM and PO) had no direct influence on groundwater quality. The results of this work could be used for groundwater resources management.
DEFF Research Database (Denmark)
Jacobsen, Niels Gjøl; Fredsøe, Jørgen
2014-01-01
In Part 2 of this work, the hydrodynamic model described in Part 1 is applied for the simulation of sediment transport and the associated morphological development of breaker bars. The sediment description is split into bed load and suspended load, and like the hydrodynamics the sediment transport...
Transportation energy data book: edition 16
Energy Technology Data Exchange (ETDEWEB)
Davis, S.C. [Lockheed Martin Energy Systems, Inc., Oak Ridge, TN (United States); McFarlin, D.N. [Tennessee Univ., Knoxville, TN (United States)
1996-07-01
The Transportation Energy Data Book: Edition 16 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes is treated in separate chapters or sections. Chapter 1 compares U.S. transportation data with data from other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet vehicles, federal standards, fuel economies, and high- occupancy vehicle lane data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternative fuel vehicles. Chapter 6 covers the major nonhighway modes: air, water, and rail. The last chapter, Chapter 7, presents data on environmental issues relating to transportation.
ipole: Semianalytic scheme for relativistic polarized radiative transport
Moscibrodzka, Monika; Gammie, Charles F.
2018-04-01
ipole is a ray-tracing code for covariant, polarized radiative transport particularly useful for modeling Event Horizon Telescope sources, though may also be used for other relativistic transport problems. The code extends the ibothros scheme for covariant, unpolarized transport using two representations of the polarized radiation field: in the coordinate frame, it parallel transports the coherency tensor, and in the frame of the plasma, it evolves the Stokes parameters under emission, absorption, and Faraday conversion. The transport step is as spacetime- and coordinate- independent as possible; the emission, absorption, and Faraday conversion step is implemented using an analytic solution to the polarized transport equation with constant coefficients. As a result, ipole is stable, efficient, and produces a physically reasonable solution even for a step with high optical depth and Faraday depth.
Overview of toroidal momentum transport
International Nuclear Information System (INIS)
Peeters, A.G.; Hornsby, W.A.; Angioni, C.; Hein, T.; Kluy, N.; Strintzi, D.; Tardini, G.; Bortolon, A.; Camenen, Y.; Casson, F.J.; Snodin, A.P.; Szepesi, G.; Duval, B.; Fiederspiel, L.; Idomura, Y.; Mantica, P.; Parra, F.I.; Tala, T.; De Vries, P.; Weiland, J.
2011-01-01
Toroidal momentum transport mechanisms are reviewed and put in a broader perspective. The generation of a finite momentum flux is closely related to the breaking of symmetry (parity) along the field. The symmetry argument allows for the systematic identification of possible transport mechanisms. Those that appear to lowest order in the normalized Larmor radius (the diagonal part, Coriolis pinch, E x B shearing, particle flux, and up-down asymmetric equilibria) are reasonably well understood. At higher order, expected to be of importance in the plasma edge, the theory is still under development.
Institute of Scientific and Technical Information of China (English)
Deng Aimin; Tian Feng; Haasis H.D; Mao Lang; Cai Jia
2012-01-01
The coordinated development is the core of sustainable development and the hot issue of international research. Inland water transport (IWT) is an important part of the water resources exploiting system and comprehensive transport system under socio-economic context of river basin, and also the country' s sustainable development priorities to achieve resource-conserving and environment-friendly strategy. Based on the coordinated development content, the paper combined Germany' s successful development experience, explored the elements and problem of the coordinated development of IWT system of China' s national economic strategy and basin economy, water resourse system, comprehensive transport system, and system itself, and their countermeasures and suggestions, in order to facilitate rapid and coordinated development of China' s inland water transport.
Organic anion transporting polypeptide 1B transporters modulate hydroxyurea pharmacokinetics.
Walker, Aisha L; Lancaster, Cynthia S; Finkelstein, David; Ware, Russell E; Sparreboom, Alex
2013-12-15
Hydroxyurea is currently the only FDA-approved drug that ameliorates the pathophysiology of sickle cell anemia. Unfortunately, substantial interpatient variability in the pharmacokinetics (PK) of hydroxyurea may result in variation of the drug's efficacy. However, little is known about mechanisms that modulate hydroxyurea PK. Recent in vitro studies identifying hydroxyurea as a substrate for organic anion transporting polypeptide (OATP1B) transporters prompted the current investigation assessing the role of OATP1B transporters in modulating hydroxyurea PK. Using wild-type and Oatp1b knockout (Oatp1b(-/-)) mice, hydroxyurea PK was analyzed in vivo by measuring [(14)C]hydroxyurea distribution in plasma, kidney, liver, urine, or the exhaled (14)CO2 metabolite. Plasma levels were significantly reduced by 20% in Oatp1b(-/-) mice compared with wild-type (area under the curve of 38.64 or 48.45 μg·h(-1)·ml(-1), respectively) after oral administration, whereas no difference was observed between groups following intravenous administration. Accumulation in the kidney was significantly decreased by twofold in Oatp1b(-/-) mice (356.9 vs. 748.1 pmol/g), which correlated with a significant decrease in urinary excretion. Hydroxyurea accumulation in the liver was also decreased (136.6 vs. 107.3 pmol/g in wild-type or Oatp1b(-/-) mice, respectively) correlating with a decrease in exhaled (14)CO2. These findings illustrate that deficiency of Oatp1b transporters alters the absorption, distribution, and elimination of hydroxyurea thus providing the first in vivo evidence that cell membrane transporters may play a significant role in modulating hydroxyurea PK. Future studies to investigate other transporters and their role in hydroxyurea disposition are warranted for understanding the sources of variation in hydroxyurea's PK.
Subsurface transport program: Research summary
International Nuclear Information System (INIS)
1987-01-01
DOE's research program in subsurface transport is designed to provide a base of fundamental scientific information so that the geochemical, hydrological, and biological mechanisms that contribute to the transport and long term fate of energy related contaminants in subsurface ecosystems can be understood. Understanding the physical and chemical mechanisms that control the transport of single and co-contaminants is the underlying concern of the program. Particular attention is given to interdisciplinary research and to geosphere-biosphere interactions. The scientific results of the program will contribute to resolving Departmental questions related to the disposal of energy-producing and defense wastes. The background papers prepared in support of this document contain additional information on the relevance of the research in the long term to energy-producing technologies. Detailed scientific plans and other research documents are available for high priority research areas, for example, in subsurface transport of organic chemicals and mixtures and in the microbiology of deep aquifers. 5 figs., 1 tab
Molderings, G J; Menzel, S; Kathmann, M; Schlicker, E; Göthert, M
2000-01-01
In segments of rat vena cava preincubated with [3H]-noradrenaline and superfused with physiological salt solution, the influence of agmatine on the electrically evoked [3H]-noradrenaline release, the EP3 prostaglandin receptor-mediated and the α2D-adrenoceptor-mediated inhibition of evoked [3H]-noradrenaline release was investigated. Agmatine (0.1–10 μM) by itself was without effect on evoked [3H]-noradrenaline release. In the presence of 10 μM agmatine, the prostaglandin E2(PGE2)-induced EP3-receptor-mediated inhibition of [3H]-noradrenaline release was not modified, whereas the α2D-adrenoceptor-mediated inhibition of [3H]-noradrenaline release induced by noradrenaline, moxonidine or clonidine was more pronounced than in the absence of agmatine. However, 1 mM agmatine antagonized the moxonidine-induced inhibition of [3H]-noradrenaline release. Agmatine concentration-dependently inhibited the binding of [3H]-clonidine and [3H]-rauwolscine to rat brain cortex membranes (Ki values 6 μM and 12 μM, respectively). In addition, 30 and 100 μM agmatine increased the rate of association and decreased the rate of dissociation of [3H]-clonidine resulting in an increased affinity of the radioligand for the α2D-adrenoceptors. [14C]-agmatine labelled specific binding sites on rat brain cortex membranes. In competition experiments. [14C]-agmatine was inhibited from binding to its specific recognition sites by unlabelled agmatine, but not by rauwolscine and moxonidine. In conclusion, the present data indicate that agmatine both acts as an antagonist at the ligand recognition site of the α2D-adrenoceptor and enhances the effects of α2-adrenoceptor agonists probably by binding to an allosteric binding site of the α2D-adrenoceptor which seems to be labelled by [14C]-agmatine. PMID:10928978
Basic Studies of Non-Diffusive Transport in Plasmas
Energy Technology Data Exchange (ETDEWEB)
Morales, George J. [University of California, Los Angeles, CA (United States); Maggs, James E. [University of California, Los Angeles, CA (United States)
2014-10-25
The project expanded and developed mathematical descriptions, and corresponding numerical modeling, of non-diffusive transport to incorporate new perspectives derived from basic transport experiments performed in the LAPD device at UCLA, and at fusion devices throughout the world. By non-diffusive it is meant that the transport of fundamental macroscopic parameters of a system, such as temperature and density, does not follow the standard diffusive behavior predicted by a classical Fokker-Planck equation. The appearance of non-diffusive behavior is often related to underlying microscopic processes that cause the value of a system parameter, at one spatial position, to be linked to distant events, i.e., non-locality. In the LAPD experiments the underlying process was traced to large amplitude, coherent drift-waves that give rise to chaotic trajectories. Significant advances were made in this project. The results have lead to a new perspective about the fundamentals of edge transport in magnetically confined plasmas; the insight has important consequences for worldwide studies in fusion devices. Progress was also made in advancing the mathematical techniques used to describe fractional diffusion.
Safety criteria for spent-fuel transport. Final report
International Nuclear Information System (INIS)
Goldmann, K.; Gekler, W.C.
1986-10-01
The focus of this study is on the question, ''Do current regulations provide reasonable assurance of safety for a transport scenario of spent fuel, as presently anticipated by the Department of Energy, under the Nuclear Waste Policy Act.'' This question has been addressed by developing a methodology for identifying the expected frequency of Accidents Which Exceed Regulatory Conditions in Severity (AWERCS) for spent fuel transport casks and then assessing the health effects resulting from that frequency. By applying the methodology to an illustrative case of road transports, it was found that the accidental release of radioactive material from impact AWERCS would make negligible contributions to health effects associated with spent fuel transports by road. It is also concluded that the current regulatory drop test requirements in 10 CFR 71.51 which form the basis for cask design and were used to establish AWERCS screening criteria for this study are adequate, and that no basis was found to conclude that cask performance under expected road accident conditions represents an undue risk to the public
Electrostatic Transport and Manipulation of Lunar Soil and Dust
International Nuclear Information System (INIS)
Kawamoto, Hiroyuki
2008-01-01
Transport and manipulation technologies of lunar soil and dust are under development utilizing the electrostatic force. Transport of particles is realized by an electrostatic conveyer consisting of parallel electrodes. Four-phase traveling electrostatic wave was applied to the electrodes to transport particles upon the conveyer and it was demonstrated that particles were efficiently transported under conditions of low frequency, high voltage, and the application of rectangular wave. Not only linear but also curved and closed transport was demonstrated. Numerical investigation was carried out with a three-dimensional hard-sphere model of the Distinct Element Method to clarify the mechanism of the transport and to predict performances in the lunar environment. This technology is expected to be utilized not only for the transport of bulk soil but also for the cleaning of a solar panel and an optical lens. Another technology is an electrostatic manipulation system to manipulate single particle. A manipulator consisted of two parallel pin electrodes. When voltage was applied between the electrodes, electrophoresis force generated in non-uniform electrostatic field was applied to the particle near the tip of the electrode. The particle was captured by the application of the voltage and released from the manipulator by turning off the voltage. It was possible to manipulate not only insulative but also conductive particles. Three-dimensional electrostatic field calculation was conducted to calculate the electrophoresis force and the Coulomb force
APTWG: The 4th Asia-Pacific Transport Working Group Meeting
International Nuclear Information System (INIS)
Ida, K.; Todo, Y.; Kwon, J.M.; Leconte, M.; Ko, W.H.; Inagaki, S.; Kosuga, Y.
2015-01-01
This conference report summarizes the contributions to, and discussions at, the 4th Asia-Pacific Transport Working Group Meeting held at Kyushu University, Japan, during 10–13 June 2014. The topics of the meeting were organized under five main headings: turbulence suppression and transport barrier formation, effect of magnetic topology on MHD activity and transport, non-diffusive contribution of momentum and particle transport, non-local transport and turbulence spreading and coupling, energetic particles and instability. The Young Researchers' Forum which was held in this meeting is also described in this report. (conference reports)
International Nuclear Information System (INIS)
Prignitz, R.; Saurbier, B.; Hoffmeister, G.
1976-01-01
In the myocardium of guinea-pigs, the behaviour of the catecholamines noradrenalin and adrenalin as well as the monoamine oxidase activity was biochemically studied following a local irradiation with 250 up to 6,000 R surface dose. The noradrenalin content is significantly reduced already after a surface dose of 250 R. This drop of the noradrenalin content is beginning 15 min after irradiation, and not till 72 hours later, a complete normalization of the noradrenalin content is to be shown. A fractionated irradiation with twice 250 R SD in an interval of 24 hours leads to a further reduction. The changes of the adrenalin content are uncharacteristic, the activity of the monoamine oxidase is unaffected. (orig.) [de
2001-04-01
The International Border Clearance (IBC) program was initiated under the provisions of the Intermodal Surface Transportation Efficiency Act (ISTEA) of 1991. The program was originally conceived as a means to test the feasibility of utilizing Intellig...
International Nuclear Information System (INIS)
De Wilde, Tineke; Spanoghe, Pieter; Ryckeboer, Jaak; Jaeken, Peter; Springael, Dirk
2010-01-01
Transport of bentazone, isoproturon, linuron, metamitron and metalaxyl were studied under three different flows in macrocosms. The aim was to verify the observations from Part I of the accompanying paper, with an increase in column volume and decrease in chemical and hydraulic load. Very limited breakthrough occurred in the macrocosms for all pesticides, except bentazone, at all flows. From batch degradation experiments, it was observed that the lag time of metamitron and linuron decreased drastically in time for all flows, indicating a growth in the pesticide degrading population. This in contrast to isoproturon and metalaxyl, where an increase in lag time could be observed in time for all flows. From the batch degradation experiments, it could be concluded that the influence of flow on the lag time was minimal and that the inoculation of the pesticide-primed soil had a little surplus value on degradation. - Retention and degradation of pesticides in macrocosms liable to different fluxes.
Energy Technology Data Exchange (ETDEWEB)
De Wilde, Tineke, E-mail: dewilde.tineke@gmail.co [Laboratory of Crop Protection Chemistry, Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, B-9000 Ghent (Belgium); Spanoghe, Pieter [Laboratory of Crop Protection Chemistry, Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, B-9000 Ghent (Belgium); Ryckeboer, Jaak [Division Soil and Water Management, Faculty of Bioscience Engineering, K.U. Leuven, Kasteelpark Arenberg 20, B-3001 Heverlee (Belgium); Jaeken, Peter [PCF-Royal Research Station of Gorsem, De Brede Akker 13, 3800 Sint-Truiden (Belgium); Springael, Dirk [Division Soil and Water Management, Faculty of Bioscience Engineering, K.U. Leuven, Kasteelpark Arenberg 20, B-3001 Heverlee (Belgium)
2010-10-15
Transport of bentazone, isoproturon, linuron, metamitron and metalaxyl were studied under three different flows in macrocosms. The aim was to verify the observations from Part I of the accompanying paper, with an increase in column volume and decrease in chemical and hydraulic load. Very limited breakthrough occurred in the macrocosms for all pesticides, except bentazone, at all flows. From batch degradation experiments, it was observed that the lag time of metamitron and linuron decreased drastically in time for all flows, indicating a growth in the pesticide degrading population. This in contrast to isoproturon and metalaxyl, where an increase in lag time could be observed in time for all flows. From the batch degradation experiments, it could be concluded that the influence of flow on the lag time was minimal and that the inoculation of the pesticide-primed soil had a little surplus value on degradation. - Retention and degradation of pesticides in macrocosms liable to different fluxes.
Unifying Concept of Serotonin Transporter-associated Currents*
Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H.; Sandtner, Walter
2012-01-01
Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents. PMID:22072712
Unifying concept of serotonin transporter-associated currents.
Schicker, Klaus; Uzelac, Zeljko; Gesmonde, Joan; Bulling, Simon; Stockner, Thomas; Freissmuth, Michael; Boehm, Stefan; Rudnick, Gary; Sitte, Harald H; Sandtner, Walter
2012-01-02
Serotonin (5-HT) uptake by the human serotonin transporter (hSERT) is driven by ion gradients. The stoichiometry of transported 5-HT and ions is predicted to result in electroneutral charge movement. However, hSERT mediates a current when challenged with 5-HT. This discrepancy can be accounted for by an uncoupled ion flux. Here, we investigated the mechanistic basis of the uncoupled currents and its relation to the conformational cycle of hSERT. Our observations support the conclusion that the conducting state underlying the uncoupled ion flux is in equilibrium with an inward facing state of the transporter with K+ bound. We identified conditions associated with accumulation of the transporter in inward facing conformations. Manipulations that increased the abundance of inward facing states resulted in enhanced steady-state currents. We present a comprehensive kinetic model of the transport cycle, which recapitulates salient features of the recorded currents. This study provides a framework for exploring transporter-associated currents.
Directory of Open Access Journals (Sweden)
Robson Ventura
2010-01-01
Full Text Available Target areas for Ucides cordatus (Linnaeus, 1763 restocking programs are often located far from the laboratory where larval rearing is developed. During translocation, the larvae are submitted to highly stressful conditions due to handling, packing, and transport activities. The aim of the present study was to assess the mortality rates of U. cordatus megalopae caused by different transportation procedures. Megalopae at loading densities of 50, 150, and 300 ind.L-1 were packed in double polyethylene 12 x 25 cm plastic bags with 200 ml of marine water at salinity 30. The bags were filled with oxygen at a proportion of 1:2 parts of water and sealed tightly. The trepidations during transport were simulated by the use of a shaker device (800 vibrations/minute over periods of three and six hours inside a dark container. The survivorship rates of larvae after simulation were compared to those obtained in control groups, which consisted of plastic vials with megalopae at a loading density of 50 ind.L-1 maintained at rest. Immediately after the two transport simulations, there was no significant difference in survivorship between the treatments and the control. However, 24 hours after simulation some of the tested densities resulted in significantly lower survivorships. The results demonstrated that U. cordatus megalopae can tolerate six hours of shaking during transportation, at high densities with minimal mortality.
Dynamic response analysis as a tool for investigating transport mechanisms
International Nuclear Information System (INIS)
Dudok de Wit, Th.; Joye, B.; Lister, J.B.; Moret, J.M.
1990-01-01
Dynamic response analysis provides an attractive method for studying transport mechanisms in tokamak plasmas. The analysis of the radial response has already been widely used for heat and particle transport studies. The frequency dependence of the dynamic response, which is often omitted, reveals further properties of the dominant transport mechanisms. Extended measurements of the soft X-ray emission were carried out on the TCA tokamak in order to determine the underlying transport processes. (author) 5 refs., 2 figs
Turgor-mediated transport of sugars
International Nuclear Information System (INIS)
Daie, J.
1986-01-01
Membrane associated processes have been suggested to be modulated by cellular turgor. The nature of this regulation is not, however, clearly understood. Evidence is presented that active but not passive transport of sugars is turgor regulated. Isolated phloem tissue, vascular bundles or storage parenchyma of celery were incubated in buffered solutions adjusted to 100, 200 or 400 m osmolal that contained various concentrations of 14 C-sugars. Cellular turgor was manipulated by using the non-permeating PEG (3350). Saturating carrier-mediated sucrose transport which is present only in phloem-containing tissue was enhanced under low turgor conditions. Sucrose diffusion, the predominant mode of uptake in non-phloem parenchyma tissue was not affected by cellular turgor. Furthermore, GA and IAA seem to interact with cellular turgor to bring about modified rates of sucrose uptake. The data are consistent with observations that sucrose loading is enhanced under mild water deficit conditions
Ordinance of the Prime Minister's Office concerning reports on transport of radioisotopes
International Nuclear Information System (INIS)
1981-01-01
This rule is established under the provisions of the law on the prevention of radiation injuries by radioisotopes and the enforcement ordinance for this law, and to execute the law. Radioisotopes or the goods contaminated by radioisotopes which require reports are the same as those defined in the enforcement regulation for the law. Persons who intend to report on the transport of radioisotopes under the law shall submit two copies of reports in the form specified in this rule to the public safety commissions of prefectures which exercise jurisdiction over the dispatching places of these radioisotopes. The indication matters defined in this rule include speed of the vehicles loaded with radioisotopes, the disposition of escort cars, the formation of these vehicles, cars and other vehicles which accompany to transport, parking areas, the places of loading and unloading, etc. When the transport reported is related to the areas which are under the jurisdiction of other public safety commissions, those commissions which have received the reports shall inform without delay to the commissions concerned the date of transport, course, the kinds and quantities of radioisotopes and other necessary matters. The examinations of transport are made according to the contents of the reports submitted as to whether the transport was made as notified. Reports may be collected on the circumstances of transport outside works or enterprises and the personal injuries by the transport concerned, etc. (Okada, K.)
Directory of Open Access Journals (Sweden)
Christopher Chukwutoo Ihueze
2017-01-01
Full Text Available This article employed the Hertz contact stress theory and the finite element method to evaluate the maximum contact pressure and the limit stresses of orange fruit under transportation and storage. The elastic properties of orange fruits subjected to axial and axial contact were measured such that elastic limit force, elastic modulus, Poisson’s ratio and bioyield stress were obtained as 18 N, 0.691 MPa, 0.367, 0.009 MPa for axial compression and for radial loading were 15.69 N, 0.645 MPa, 0.123, 0.010 MPa. The Hertz maximum contact pressure was estimated for axial and radial contacts as 0.036 MPa. The estimated limiting yield stress estimated as von Mises stresses for the induced surface stresses of the orange topologies varied from 0.005 MPa–0.03 MPa. Based on the distortion energy theory (DET the yield strength of orange fruit is recommended as 0.03 MPa while based on the maximum shear stress theory (MSST is 0.01 MPa for the design of orange transportation and storage system.