WorldWideScience

Sample records for non-protein nitrogen npn

  1. Relationship between ruminal ammonia and non-protein nitrogen utilization by ruminants

    International Nuclear Information System (INIS)

    Satter, L.D.; Roffler, R.E.

    1976-01-01

    Non-protein nitrogen (NPN) may be utilized as well as plant protein when ruminal ammonia nitrogen concentration is low ( 3 -N at 5 mg/100 ml will provide considerably less metabolizable protein, and the amount of metabolizable protein will be directly proportional to the amount of protein that escapes degradation. A simplified scheme for estimating metabolizable protein is presented. It has the flexibility needed for accommodating different feedstuffs, yet is easy to apply. The proposed scheme is based upon ruminal ammonia concentration, which in turn reflects protein intake, ration fermentability and protein degradation, the major determinants of protein supply to the lower intestine. It has the potential of more accurately describing the nutritional value of dietary crude protein, particularly if both protein and NPN are in the diet. (author)

  2. Analisis Kadar Protein Total Dan Non Protein Nitrogen Pada Air Dan Daging Buah Kelapa (Cocos Nucifera L.) Dengan Metode Kjeldahl

    OpenAIRE

    Margata, Linda

    2015-01-01

    In Indonesia, coconut palm is one of the big contributors for the economy of the people and nation. As food, coconut water and coconut meat contain some nutrients such as carbohydrates, fats, and also proteins. During maturation, changes in protein content of coconut water and coconut meat may happen. The purpose of this study was to determine the concentration of total protein and non protein nitrogen (NPN) in coconut water and coconut meat, and their changes in young and mature coconuts....

  3. Influence of energy concentration and source on the utilization of feed protein and NPN in lambs. 2

    International Nuclear Information System (INIS)

    Ulbrich, M.; Bassuny, S.M.; Geissler, C.; Hoffmann, M.

    1989-01-01

    In an experiment 12 lambs of the species merino meet sheep were divided into 4 groups. The variants HE received 740 or 718 EFU cattle /kg DM and the variants NE 689 or 671 EFU cattle /kg DM. The different energy concentrations resulted from differentiated quotas of dried sugar beet chips and wheat starch supplements. Within the variants, sub-variants with (HESZ, NESZ) or without (HES, NES) sugar supplement were formed. Due to varied DM intake, the average energy intake in all groups was 42 EFU cattle /kg LW 0.75 . N balance experiments using 15 N-labelled urea were carried out, and 15 N accumulation of N excretion was projected to a steady state. The partial utilization of pure protein and NPN in the ration was ascertained with the help of a 3-pool compartment model of N utilization in ruminants. In the non-amino acid N pool HE utilized 84% of NPN and NE 77% for the synthesis of amino and nucleic acids. The efficiency of protein synthesis in the amino acid N-pool were in HESZ 64%, HES 70%, NESZ 70% and NES 73% resp. The total utilization of NPN is the sum of the partial utilization in the two pools, whereas the total utilization of pure protein is calculated from the true digestibility and the efficiency of the utilization in the AA-N pool. The total utilization of NPN for the synthesis of protein for the protein pool amounted to 40/35/41/33% and that of pure protein to 54/51/49/50%. Energy intake being identical, energy concentration did not have an influence on the utilization of pure protein and NPN, whereas NPN utilization was better in rations containing sugar. The pure protein in the ration was by 19 - 52% better utilized than NPN. (author)

  4. Biuret, a NPN source for ruminants -- a review

    Energy Technology Data Exchange (ETDEWEB)

    Singhal, K K; Mudgal, V D [National Dairy Research Inst., Karnal (India)

    1980-06-01

    Biuret is a non toxic and palatable source of non protein nitrogen which is hydrolyzed slowly and has a slower solubility as compared to urea. It is hydrolyzed in rumen with the help of biuretase which is an induced enzyme, therefore animals require some time of adaptation before its proper utilization. Biuret is degraded into ammonia and urea which later on gets hydrolysed further into ammonia with the help of urease. The activity of urease might have been supressed in the rumen when the animals were fed on biuret supplemented diet. Biuret degradation into ammonia increases as the adaptation reaches. Biuret hydrolyzed slowly upto 24 hr of its feeding in adapted animals. For the best utilization of this NPN compound, the diet should contain low levels of natural protein and sufficient quantity of readily available source of energy and provide adequate essential minerals. Biuret can be successfully used for the maintenance and production ratio of the ruminants.

  5. Biuret, a NPN source for ruminants -- a review

    International Nuclear Information System (INIS)

    Singhal, K.K.; Mudgal, V.D.

    1980-01-01

    Biuret is a non toxic and palatable source of non protein nitrogen which is hydrolyzed slowly and has a slower solubility as compared to urea. It is hydrolyzed in rumen with the help of biuretase which is an induced enzyme, therefore animals require some time of adaptation before its proper utilization. Biuret is degraded into ammonia and urea which later on gets hydrolysed further into ammonia with the help of urease. The activity of urease might have been supressed in the rumen when the animals were fed on biuret supplemented diet. Biuret degradation into ammonia increases as the adaptation reaches. Biuret hydrolyzed slowly upto 24 hr of its feeding in adapted animals. For the best utilization of this NPN compound, the diet should contain low levels of natural protein and sufficient quantity of readily available source of energy and provide adequate essential minerals. Biuret can be successfully used for the maintenance and production ratio of the ruminants. (author)

  6. Effect of whole body gamma-irradiation and/or dietary protein deficiency on the levels of plasma non-protein nitrogen and amino acids; plasma and urinary ammonia and urea in desert rodent and albino rats

    International Nuclear Information System (INIS)

    Roushdy, H.M.; El-Husseini, M.; Saleh, F.

    1984-01-01

    The effect of gamma-irradiation exposure on the levels of non-protein nitrogen (N.P.N.) and amino acids in plasma; ammonia and urea in plasma and urine was studied in the desert rodent, Psammomys obesus obesus and albino rats subjected to dietary protein deficiency, N.P.N. and amino acids in plasma were shown to increase by irradiation exposure. The effect of radiation on blood ammonia was less marked, but it caused a significant increase in ammonia excretion in urine. Radiation exposure in albino rats caused a marked increase in urea concentration in plasma of animals fed the high protein diet and irradiated at 780 r. In urine, the tested radiation levels caused an initial increase in urea concentration followed by a subsequent decrease. In psammomys, radiation exposure exerted a little effect on the plasma urea level, whereas significant increase in the daily urea excretion was recorded. It seems that urea level in plasma is more stabilized in psammomys than in albino rats

  7. Effect of feeding of different sources of NPN on production performance of dairy cows

    Directory of Open Access Journals (Sweden)

    Juraj Karcol

    2016-12-01

    Full Text Available The aim of the study was to analyse the effect of feeding of different sources of NPN on nutrient utilization and production performance of dairy cows under field conditions. Balancing diets for crude protein without consideration of protein quality or rumen degradability often led to overfeeding of nitrogen and less than optimum production. High yielding dairy cows separated in two groups with 85 resp. 80 cows in each were set up for the trial. Groups were consistent according the stage of production and reproduction cycle as well as age structure. Both groups were fed concentrate mixture with the same composition with only difference in NPN/ microbial protein source, with same dosage of 100 g per cow and day. Field trial was performed for period of 3 subsequent months. Performance data were collected in accordance with official milk recording. In both groups majority of cows were on first lactation. Significant differences in daily milk production were observed 2.87 kg (P<0.01 for group 2, in fat content 0.07 % for group 2 non-significant, whereas in protein content 0.18% for group 1 significant (P<0.01 in case of first lactations. If considering first tree lactations, group 2 produced 1.7 kg milk per day more (P<0.08, with 0.05% fat more and 0.002 % protein less than group 1. The space created in dry matter intake by a concentrated slow-release NPN can be filled with high quality forage that could reduce the cost of feeding while maintaining levels of production.

  8. Karakteristik Protein dan Nitrogen Non Protein Daging Ikan Cucut Lanyam (Charcharhinus limbatus (Characteristics of Protein and Non Protein Nitrogen in Lanyam Shark Muscle

    Directory of Open Access Journals (Sweden)

    Yuspihana Fitrial

    2017-02-01

    Based on protein solubility of Lanyam muscle at pH 1.5 to 12 obtained two points which is minimum solubility at pH 4.5 and pH 9. Based on the classification Osborn, Lanyam muscle contained albumin (28.64%, globulin (13:44%, prolamin (03.29%, glutelin (33.70%. Observation of non-protein nitrogen levels indicated that the washing process was very effective to reduce non-protein nitrogen levels up to 62.34% and urea levels up to 58% . Differential Scanning Calorimetry Study of Lanyam mince showed two types of protein that has a different stability to heat and after added 2.5% NaCl formed a peak which is a fusion of both these proteins

  9. Influence of energy concentration and source on the utilization of feed protein and NPN in lambs. 3

    International Nuclear Information System (INIS)

    Ulbrich, M.; Geissler, C.; Bassuny, S.M.; Borowiec, F.; Hoffmann, M.

    1989-01-01

    In an N balance experiment with male crossbreeding lambs at an age of 3-4 months four different rations were given differing in energy concentration (high > 700 EFU cattle /kg DM and low cattle /kg DM) and in the energy source (sugar, starch or crude fibre) with crude protein intake being almost equal. The rations contained 2% urea. Microbial protein synthesis in the rumen was assessed according to Roth and Kichgessner (1978) (1), Rys et al. (1975) (2) and Bickel-Baumann and Landis (1986) (3) on the basis of allantoin excretion in urine. The highest ruminal protein synthesis quotas were 868-921 mg protein N per kg LW 0.75 in (2). In (3) 723-766 mg protein N/kg LW 0.75 were synthesized. From the 15 N labelling of the supplemented urea and the excreted allantoin it could be calculated that 26-40% of the microbial protein resulted from the urea-N of the ration. Despite a high crude protein content of the ration of between 16 and 17% in the DM and a relation of NPN: pure protein of 0.95 the utilization of the NPN in the ration was relatively high but slightly lower than the utilization of pure protein. The variants with higher energy concentration showed as a tendency higher allantoin excretion in spite of slightly lower dry matter intake and a slightly higher NPN utilization than the variants with lower energy concentration. (author)

  10. Influence of energy concentration and source on the utilization of feed protein and NPN in lambs. 3. Allantoin excretion and microbial protein synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Ulbrich, M; Geissler, C; Bassuny, S M; Borowiec, F; Hoffmann, M

    1989-06-01

    In an N balance experiment with male crossbreeding lambs at an age of 3-4 months four different rations were given differing in energy concentration (high > 700 EFU/sub cattle//kg DM and low < 650 EFU/sub cattle//kg DM) and in the energy source (sugar, starch or crude fibre) with crude protein intake being almost equal. The rations contained 2% urea. Microbial protein synthesis in the rumen was assessed according to Roth and Kichgessner (1978) (1), Rys et al. (1975) (2) and Bickel-Baumann and Landis (1986) (3) on the basis of allantoin excretion in urine. The highest ruminal protein synthesis quotas were 868-921 mg protein N per kg LW/sup 0.75/ in (2). In (3) 723-766 mg protein N/kg LW /sup 0.75/ were synthesized. From the /sup 15/N labelling of the supplemented urea and the excreted allantoin it could be calculated that 26-40% of the microbial protein resulted from the urea-N of the ration. Despite a high crude protein content of the ration of between 16 and 17% in the DM and a relation of NPN: pure protein of 0.95 the utilization of the NPN in the ration was relatively high but slightly lower than the utilization of pure protein. The variants with higher energy concentration showed as a tendency higher allantoin excretion in spite of slightly lower dry matter intake and a slightly higher NPN utilization than the variants with lower energy concentration. (author).

  11. Slow-release urea in supplement fed to beef steers

    Directory of Open Access Journals (Sweden)

    Ana Paula Gonçalves

    2015-02-01

    Full Text Available Replacing regular urea (RU by slow-release urea (SRU at two levels of non-protein nitrogen (NPN in concentrate, offered with low-quality roughage, was evaluated in beef steers on dry matter intake (DMI, ruminal fermentation parameters, plasma urea nitrogen (PUN, total tract apparent digestibility of diets and in situ degradability of nitrogen sources. Eight ruminally cannulated steers were allocated into two 4x4 Latin squares, totalizing four treatments: 40 NPN/0 SRU: 40% of concentrate crude protein (CP as NPN, resulting from 0% of SRU and 100% of RU; 40 NPN/50 SRU: 40% of concentrate CP as NPN, resulting from 50% of SRU and 50% of RU; 40 NPN/100 SRU: 40% of concentrate CP as NPN, resulting from 100% of SRU and 0% of RU; 80 NPN/100 SRU: 80% of concentrate CP as NPN, resulting from 100% of SRU and 0% of RU. Results showed that partial substitution of regular urea by slow-release urea did not alter dry matter intake, pattern of ruminal fermentation or plasma urea nitrogen concentrations and increased the total tract apparent digestibility of crude protein in steers diets. The increase in non-protein nitrogen content in crude protein of the concentrate could compromise feed intake and the efficiency of nutrient utilization in the steers fed complete diets based on low quality forage.

  12. Lattice thermal expansions of NpN, PuN and AmN

    International Nuclear Information System (INIS)

    Takano, Masahide; Akabori, Mitsuo; Arai, Yasuo; Minato, Kazuo

    2008-01-01

    Lattice parameters of NpN, PuN and AmN were measured by a high temperature X-ray diffraction method from room temperature up to 1478 K. Linear thermal expansions of these TRU nitrides were determined as a function of temperature. The average coefficients of linear thermal expansion from 293 to 1273 K were 8.8, 11.1 and 11.2 x 10 -6 K -1 for NpN, PuN and AmN, respectively. The instantaneous coefficient of thermal expansion either at 293 or at 1273 K against the reciprocal decomposition temperature under 1 atm of nitrogen showed a linear relationship for TiN, ZrN, HfN, UN, NpN and PuN. Based on this relationship, the decomposition temperature of AmN was roughly predicted to be 2700 K

  13. Ultilization of nitrogen from feed protein and NPN for milk protein synthesis in the ewe

    International Nuclear Information System (INIS)

    Ulbrich, M.; Boldt, E.; Geissler, C.

    1989-01-01

    Two lactating Merino ewes with a rumen fistula were housed in metabolic boxes for N balance studies and fed a diet composed of oats, sugar beet pulp and hay. After adaptation on dietary ammonium sulfate suplementation the ewes received 21 g 15 N-ammonium sulfate daily lasting for 10 days. Uptake and utilization of nitrogen especially for protein syntheses were determined. (author)

  14. Pengaruh Nisbah Energi-Protein, Nitrogen-Sulfur dan Kalsium-Fosfor Terhadap Produk Metabolisme Rumen dan Kecernaan Substrat

    Directory of Open Access Journals (Sweden)

    S.N.O. Suwandyastuti

    2013-10-01

    Full Text Available Influence of the ratio of energy-protein, nitrogen-sulphur, and calsium-phosphor upon rumen metabolism product and digestibility of substrat ABSTRACT. The Rumen microbes are capable to digest the glucosa polymer of plant waste for energy source and can used the Non Protein Nitrogen (NPN for body protein synthesis, if the other precussor (Sulphur, Phospor and Branch Chain of Carbon are available.  To know the effectivity of the utilization of plant waste for energy, an experiment have been conducted by in vitro method, used the Randomized Black Design, four replication, factorial 33.  The factors tested are : (1 three levels of energy : protein (E/P ratio : 4, 5 and 6; (2 three levels of Nitrogen : Sulphur (N/Sratio: 7.5, 10 and 12.5; (3 three levels of Calsium : Phospor (Ca/P ratio : 0.5, 1 and 2. The variables measured are : synthesis of protein microbes (SPM ; production of Volatile Fatty Acid (VFA and Nitrogen Ammonia (N-NH3; the digestibility of substrat. Based on the all variable measured, the experiment can be concluded : (1 the effectivity of the utilization of rice straw will be increased if it used is fortified with 50 percent TDN as energy source (E/P=4, 0.20 percent dry matter of sulphur (N/S=10 and 0.0625 - 0.125 percent dry matter (DM of phospor (Ca/P=1.0 – 2.0; (2 To stimulate the activity of cellulolytic microbes, its need the fortification of sulphur until reach the optimum level (must be investigated.

  15. PROTEOSE INTOXICATIONS AND INJURY OF BODY PROTEIN : V. THE INCREASE IN NON-PROTEIN NITROGEN OF THE BLOOD IN ACUTE INFLAMMATORY PROCESSES AND ACUTE INTOXICATIONS.

    Science.gov (United States)

    Cooke, J V; Whipple, G H

    1918-08-01

    Sterile abscess formation in the dog is accompanied by a large increase in output of urinary nitrogen and also by a small but definite increase in the blood non-protein nitrogen. All this nitrogenous material of course is derived from body protein injury and autolysis. Septic inflammation in the dog (pleurisy, pneumonia, peritonitis, etc.) likewise shows a distinct rise in the blood non-protein nitrogen. This rise is not often so great as that frequently observed in the intoxication of intestinal obstruction. Many acute infections in man (septicemia, peritonitis, pneumonia, etc.) show a definite rise in the non-protein nitrogen and urea nitrogen of the blood; some cases show a very great rise above normal (over 100 mg. of non-protein nitrogen per 100 cc. of blood). There may be no anatomical change in the kidney beyond the familiar picture of cloudy swelling. This does not exclude the possibility of some transient functional derangement of the kidney epithelium. Certain obscure intoxications in man may show a considerable rise in the non-protein nitrogen of the blood, indicating a large amount of protein disintegration. These findings must be taken into account in any clinical analysis and interpretation of high non-protein nitrogen of the blood in pathological conditions.

  16. Protein synthesis and intestinal flora in piglets

    International Nuclear Information System (INIS)

    Namioka, Shigeo

    1980-01-01

    Utilization of non-protein nitrogen (NPN) by the flora in piglet colon was studied by administration of 15 N-urea and 15 N-ammonium salt to aseptic piglets and to SPF piglets which had been acclimatized to a clean environment after settling of intestinal flora. Administration of 15 N-urea did not result in 15 N uptake by any tissue-constituting protein at any site of the aseptic piglets, almost all 15 N being excreted into the urine. In contrast, the tissue and skeletal muscle of the SPF piglets showed incorporated 15 N from urea. Urea was converted, by urease of the intestinal flora, into NH 3 , which was absorbed from the mucosa of the intestinal tract to reach the liver where it was synthesized into glutamic acid, followed by conversion into various amino acids. 15 N-ammonium administration produced a significant amount of 15 N even in the tissue protein of the aseptic piglets. After NPN administration, the liver protein-constituting amino acid fraction showed 15 N-labeling of almost all essential, as well as non-essential amino acids. Culture of colonic flora with 15 N-urea revealed 15 N-labeling of all amino acids that constituted bacterial cells, indicating the presence of urea recycling mediated by bacterial urease in single rumen animals.(Chiba, N.)

  17. Radiation induced changes in plasma total protein nitrogen and urinary total nitrogen in desert rodent and albino rats subjected to dietary protein deficiency

    International Nuclear Information System (INIS)

    Roushdy, H.; El-Husseini, M.; Saleh, F.

    1986-01-01

    The effect of gamma-irradiation on plasma total protein nitrogen and urinary total nitrogen was studied in the desert rodent, psammomy obesus obesus and albino rats subjected to dietary protein deficiency. In albino rats kept on high protein diet, the radiation syndrome resulted in urine retention, while in those kept on non-protein diet, such phenomenon was recorded only with the high radiation level of 1170r. Radiation exposure to 780 and 1170r caused remarkable diuresis in psammomys obesus obesus whereas they induced significant urine retention in albino rats. The levels of plasma total protein nitrogen and urinary total nitrogen were higher in albino rats maintained on high protein diet than in those kept on non-protein diet. Radiation exposure caused an initial drop in plasma total protein nitrogen concentration, concomitant with an initial rise in total urinary nitrogen, radiation exposure of psammomys obesus obesus caused significant increase in the levels of plasma protein nitrogen and urinary total nitrogen. Psammomys obesus obesus seemed to be more affected by radiation exposure than did the albino rats

  18. Radiation effect of doping and bias conditions on NPN bipolar junction transistors

    International Nuclear Information System (INIS)

    Xi Shanbin; Wang Yiyuan; Xu Fayue; Zhou Dong; Li Ming; Wang Fei; Wang Zhikuan; Yang Yonghui; Lu Wu

    2011-01-01

    In this paper,we investigate 60 Co γ-ray irradiation effects and annealing behaviors of NPN bipolar junction transistors of the same manufacturing technology but different doping concentrations. The transistors of different doping concentrations differ in responses of the radiation effect. More degradation was observed with the transistors of low concentration-doped NPN transistors than the high concentration-doped NPN transistors. The results also demonstrate that reverse-biased transistors are more sensitive to radiation than the forward-biased ones. Mechanisms of the radiation responses are analyzed. (authors)

  19. Vom work Book Journal 2010 6b

    African Journals Online (AJOL)

    USER

    1992; McDonald et al., 1995; Uza et al.,. 2005) have identified urea as the safest and cheapest of the non-protein nitrogen (NPN) compound to release ammonia for rumen microbes to create new proteins. This high caloric maize offal (waste) could be combined with complementary cheap protein source (urea) that can ...

  20. High total dose proton irradiation effects on silicon NPN rf power transistors

    International Nuclear Information System (INIS)

    Bharathi, M. N.; Praveen, K. C.; Prakash, A. P. Gnana; Pushpa, N.

    2014-01-01

    The effects of 3 MeV proton irradiation on the I-V characteristics of NPN rf power transistors were studied in the dose range of 100 Krad to 100 Mrad. The different electrical characteristics like Gummel, current gain and output characteristics were systematically studied before and after irradiation. The recovery in the I-V characteristics of irradiated NPN BJTs were studied by isochronal and isothermal annealing methods

  1. High total dose proton irradiation effects on silicon NPN rf power transistors

    Energy Technology Data Exchange (ETDEWEB)

    Bharathi, M. N.; Praveen, K. C.; Prakash, A. P. Gnana, E-mail: gnanaprakash@physics.uni-mysore.ac.in [Department of Studies in Physics, University of Mysore, Manasagangotri, Mysore-570006, Karnataka (India); Pushpa, N. [Department of PG Studies in Physics, JSS College, Ooty Road, Mysore-570025, Karnataka (India)

    2014-04-24

    The effects of 3 MeV proton irradiation on the I-V characteristics of NPN rf power transistors were studied in the dose range of 100 Krad to 100 Mrad. The different electrical characteristics like Gummel, current gain and output characteristics were systematically studied before and after irradiation. The recovery in the I-V characteristics of irradiated NPN BJTs were studied by isochronal and isothermal annealing methods.

  2. An enhanced close-in phase noise LC-VCO using parasitic V-NPN transistors in a CMOS process

    International Nuclear Information System (INIS)

    Gao Peijun; Min Hao; Oh, N J

    2009-01-01

    A differential LC voltage controlled oscillator (VCO) employing parasitic vertical-NPN (V-NPN) transistors as a negative g m -cell is presented to improve the close-in phase noise. The V-NPN transistors have lower flicker noise compared to MOS transistors. DC and AC characteristics of the V-NPN transistors are measured to facilitate the VCO design. The proposed VCO is implemented in a 0.18 μm CMOS RF/mixed signal process, and the measurement results show the close-in phase noise is improved by 3.5-9.1 dB from 100 Hz to 10 kHz offset compared to that of a similar CMOS VCO. The proposed VCO consumes only 0.41 mA from a 1.5 V power supply. (semiconductor integrated circuits)

  3. Digestibility and nitrogen balance of diets containing non conventional vegetable proteins fed to pigs of genetic strains suitable for outdoor systems

    Directory of Open Access Journals (Sweden)

    L. Sardi

    2010-04-01

    Full Text Available The study was carried out to evaluate on growing pigs kept in metabolism crates, either belonging to a “traditional” cross-breed (Duroc x Large White – DLW or a local breed (Cinta Senese – CS, the digestibility and the nitrogen balance of non-conventional vegetable protein sources (field beans, pea and sunflower cake when compared to soybean meal. The four diets were formulated so as to supply the same crude protein amount. CS pigs showed lower apparent digestibility coefficients (ADCs for crude protein (81,38% vs 82,65% and crude fibre (35,97% vs 40,65%. Nitrogen balance was more favourable in DLW pigs (32,12% vs 19,67% which showed a higher nitrogen retention (+69%.With respect to the protein source, no differences were observed for nitrogen balance. Sunflower diet showed the higher ADC for ether extract (+20% compared with soybean diet. Crude fibre digestibility was lowered in sunflower (-33% and field beans (-13% diets. Sunflower and field beans diets showed the lowest gross energy digestibility coefficients. Field pea diet had the highest ADC for crude fibre (+ 12% leading to ADCs for organic matter and gross energy comparable to those of soybean meal. It is concluded that field bean, sunflower cake and field pea could be considered as valuable non-conventional protein sources in swine nutrition.

  4. The binding cavity of mouse major urinary protein is optimised for a variety of ligand binding modes

    Energy Technology Data Exchange (ETDEWEB)

    Pertinhez, Thelma A.; Ferrari, Elena; Casali, Emanuela [Department of Experimental Medicine, University of Parma, Via Volturno, 39, 43100 Parma (Italy); Patel, Jital A. [Department of Chemistry, University of Oxford, Inorganic Chemistry Laboratory, South Parks Road, Oxford OX1 3QR (United Kingdom); Spisni, Alberto, E-mail: alberto.spisni@unipr.it [Department of Experimental Medicine, University of Parma, Via Volturno, 39, 43100 Parma (Italy); Smith, Lorna J., E-mail: lorna.smith@chem.ox.ac.uk [Department of Chemistry, University of Oxford, Inorganic Chemistry Laboratory, South Parks Road, Oxford OX1 3QR (United Kingdom)

    2009-12-25

    {sup 15}N and {sup 1}HN chemical shift data and {sup 15}N relaxation studies have been used to characterise the binding of N-phenyl-naphthylamine (NPN) to mouse major urinary protein (MUP). NPN binds in the {beta}-barrel cavity of MUP, hydrogen bonding to Tyr120 and making extensive non-bonded contacts with hydrophobic side chains. In contrast to the natural pheromone 2-sec-butyl-4,5-dihydrothiazole, NPN binding gives no change to the overall mobility of the protein backbone of MUP. Comparison with 11 different ligands that bind to MUP shows a range of binding modes involving 16 different residues in the {beta}-barrel cavity. These finding justify why MUP is able to adapt to allow for many successful binding partners.

  5. Application of accelerated simulation method on NPN bipolar transistors of different technology

    International Nuclear Information System (INIS)

    Fei Wuxiong; Zheng Yuzhan; Wang Yiyuan; Chen Rui; Li Maoshun; Lan Bo; Cui Jiangwei; Zhao Yun; Lu Wu; Ren Diyuan; Wang Zhikuan; Yang Yonghui

    2010-01-01

    With different radiation methods, ionizing radiation response of NPN bipolar transistors of six different processes was investigated. The results show that the enhanced low dose rate sensitivity obviously exists in NPN bipolar transistors of the six kinds of processes. According to the experiment, the damage of decreasing temperature in step during irradiation is obviously greater than the result of irradiated at high dose rate. This irradiation method can perfectly simulate and conservatively evaluate low dose rate damage, which is of great significance to radiation effects research of bipolar devices. Finally, the mechanisms of the experimental phenomena were analyzed. (authors)

  6. Effect of cooking temperatures on protein hydrolysates and sensory quality in crucian carp (Carassius auratus) soup.

    Science.gov (United States)

    Zhang, Jinjie; Yao, Yanjia; Ye, Xingqian; Fang, Zhongxiang; Chen, Jianchu; Wu, Dan; Liu, Donghong; Hu, Yaqin

    2013-06-01

    Cooking methods have a significant impact on flavour compounds in fish soup. The effects of cooking temperatures (55, 65, 75, 85, 95, and 100 °C) on sensory properties and protein hydrolysates were studied in crucian carp (Carassius auratus) soup. The results showed that the soup prepared at 85 °C had the best sensory quality in color, flavour, amour, and soup pattern. Cooking temperature had significant influence on the hydrolysis of proteins in the soup showed by SDS-PAGE result. The contents of water soluble nitrogen (WSN) and non-protein nitrogen (NPN) increased with the cooking temperature, but the highest contents of total peptides and total free amino acids (FAA) were obtained at the cooking temperature of 85 °C. The highest contents of umami-taste active amino acid and branched-chain amino acids were also observed in the 85 °C sample. In conclusion, a cooking temperature of 85 °C was preferred for more excellent flavor and higher nutritional value of crucian carp soup.

  7. PROTEIN FRACTIONS AND IN VITRO FERMENTATION OF PROTEIN FEEDS FOR RUMINANTS

    Directory of Open Access Journals (Sweden)

    Angel L. Guevara-Mesa

    2011-05-01

    Full Text Available The objective of this study was to evaluate 20 protein feeds grouped in forages, vegetal by- products and animal by-products used for ruminant diets. Protein fractions (PF: A, non-protein nitrogen (NPN; B1, buffer-soluble protein; B2, buffer-insoluble, NDF-soluble protein; B3, NDF-insoluble, ADF-soluble protein; and C, ADF-insoluble protein, were determined for each ingredient.  Protein composition was correlated with total gas production in vitro (GP, gas production rate (S, lag time (L, DM disappearance (DMDIV and residual protein (RPIV. The completely randomised designed was analysed using mixed proc. and Tukey contrasts. Forages contained 18.29, 7.86, 66.00, 2.96, 4.89% of fractions A, B1, B2, B3 and C, respectively. Vegetable by-products contained 22.55, 4.55, 59.51, 8.84, 4.55% of each fraction, in the same order. Animal by-products contained 19.13, 4.52, 70.24, 3.74, 2.37% of each fraction, in the same order. Vetch, wheat bran and poultry litter had the greatest Vmax in each group. Vmax was correlated (P≤0.01 with total protein (r = -0.45, ADF (r = 0.27 and DMDIV (r = 0.61. In conclusion, there were differences in protein composition and kinetics of in vitro gas production among ingredients.

  8. Production and profitability of a beef herd on transitional ...

    African Journals Online (AJOL)

    In summer Treatment 1 (T1) consisted of a supplement containing 50 g phosphate (P)/kg and 150 g crude protein (CP)/kg. T2 and T3 both consisted of supplements containing 60 g P/kg and 0 g CP/kg. In winter, T1 consisted of a supplement containing 367 g CP/kg, 77.5% non-protein nitrogen (NPN) and metabolizable ...

  9. The role of Sema3–Npn-1 signaling during diaphragm innervation and muscle development

    Science.gov (United States)

    Huettl, Rosa-Eva; Hanuschick, Philipp; Amend, Anna-Lena; Alberton, Paolo; Aszodi, Attila; Huber, Andrea B.

    2016-01-01

    ABSTRACT Correct innervation of the main respiratory muscle in mammals, namely the thoracic diaphragm, is a crucial pre-requisite for the functionality of this muscle and the viability of the entire organism. Systemic impairment of Sema3A–Npn-1 (Npn-1 is also known as NRP1) signaling causes excessive branching of phrenic nerves in the diaphragm and into the central tendon region, where the majority of misguided axons innervate ectopic musculature. To elucidate whether these ectopic muscles are a result of misguidance of myoblast precursors due to the loss of Sema3A–Npn-1 signaling, we conditionally ablated Npn-1 in somatic motor neurons, which led to a similar phenotype of phrenic nerve defasciculation and, intriguingly, also formation of innervated ectopic muscles. We therefore hypothesize that ectopic myocyte fusion is caused by additional factors released by misprojecting growth cones. Slit2 and its Robo receptors are expressed by phrenic motor axons and migrating myoblasts, respectively, during innervation of the diaphragm. In vitro analyses revealed a chemoattractant effect of Slit2 on primary diaphragm myoblasts. Thus, we postulate that factors released by motor neuron growth cones have an influence on the migration properties of myoblasts during establishment of the diaphragm. PMID:27466379

  10. Synthesis of microbial nitrogen compounds in the rumen and their digestion in the small intestine

    International Nuclear Information System (INIS)

    Smith, R.H.; Salter, D.N.; McAllan, A.B.; Williams, A.P.

    1976-01-01

    Pathways and efficiency of NPN utilization were studied after introducing isonitrogenous feeds containing urea labelled with 15 N with or without groundnut protein into the rumen of the young steer. The 15 N abundance in rumen ammonia decreased from 1 h after the dose whereas that in suspended bacteria (only a small part of the total population but regarded, with reservation, as representative) increased to a peak value at 3-5 h. Patterns of incorporation into different nitrogen constituents of the bacteria indicated that part of the 15 N first moved rapidly into a labile pool, which included amide nitrogen, and then moved from this pool into other amino acids. Different amino acids were labelled to different extents (lowest for proline and arginine, highest for aspartic acid and alanine), presumably as different amounts of pre-formed amino acids were used in protein synthesis. Differences largely disappeared when the diet with urea as the only nitrogen source was given. Estimates of microbial 15 N recovery at the duodenum confirmed earlier findings that overall incorporation was least when the latter diet was given, and no improvement was seen when the urea was given in three doses over 4 h instead of in a single dose. Lactosyl, like glucosyl, ureide was degraded fairly slowly in the rumen and is being studied as a possible NPN source likely to yield simultaneous ammonia and energy for microbial growth. Studies on the origin and composition of nitrogen compounds entering the duodenum showed that the RNA of rumen bacteria (labelled with 32 P) contributed 82-109% of the RNA entering the duodenum of the steer. It was also shown that protecting dietary casein with formaldehyde reduced its degradability in the rumen to such an extent that a deficiency of fermentable nitrogen in that organ ensued. In other experiments with two calves receiving flaked maize and hay, net digestibility of nitrogen compounds between duodenum and ileum was about 60%. True digestibility

  11. A comparative study on electrical characteristics of 1-kV pnp and npn SiC bipolar junction transistors

    Science.gov (United States)

    Okuda, Takafumi; Kimoto, Tsunenobu; Suda, Jun

    2018-04-01

    We investigate the electrical characteristics of 1-kV pnp SiC bipolar junction transistors (BJTs) and compare them with those of npn SiC BJTs. The base resistance, current gain, and blocking capability are characterized. It is found that the base resistance of pnp SiC BJTs is two orders of magnitude lower than that of npn SiC BJTs. However, the obtained current gains are low below unity in pnp SiC BJTs, whereas npn SiC BJTs exhibit a current gain of 14 without surface passivation. The reason for the poor current gain of pnp SiC BJTs is discussed.

  12. The USA-NPN Information Management System: A tool in support of phenological assessments

    Science.gov (United States)

    Rosemartin, A.; Vazquez, R.; Wilson, B. E.; Denny, E. G.

    2009-12-01

    The USA National Phenology Network (USA-NPN) serves science and society by promoting a broad understanding of plant and animal phenology and the relationships among phenological patterns and all aspects of environmental change. Data management and information sharing are central to the USA-NPN mission. The USA-NPN develops, implements, and maintains a comprehensive Information Management System (IMS) to serve the needs of the network, including the collection, storage and dissemination of phenology data, access to phenology-related information, tools for data interpretation, and communication among partners of the USA-NPN. The IMS includes components for data storage, such as the National Phenology Database (NPD), and several online user interfaces to accommodate data entry, data download, data visualization and catalog searches for phenology-related information. The IMS is governed by a set of standards to ensure security, privacy, data access, and data quality. The National Phenology Database is designed to efficiently accommodate large quantities of phenology data, to be flexible to the changing needs of the network, and to provide for quality control. The database stores phenology data from multiple sources (e.g., partner organizations, researchers and citizen observers), and provides for integration with legacy datasets. Several services will be created to provide access to the data, including reports, visualization interfaces, and web services. These services will provide integrated access to phenology and related information for scientists, decision-makers and general audiences. Phenological assessments at any scale will rely on secure and flexible information management systems for the organization and analysis of phenology data. The USA-NPN’s IMS can serve phenology assessments directly, through data management and indirectly as a model for large-scale integrated data management.

  13. Npn-1 contributes to axon-axon interactions that differentially control sensory and motor innervation of the limb.

    Directory of Open Access Journals (Sweden)

    Rosa-Eva Huettl

    2011-02-01

    Full Text Available The initiation, execution, and completion of complex locomotor behaviors are depending on precisely integrated neural circuitries consisting of motor pathways that activate muscles in the extremities and sensory afferents that deliver feedback to motoneurons. These projections form in tight temporal and spatial vicinities during development, yet the molecular mechanisms and cues coordinating these processes are not well understood. Using cell-type specific ablation of the axon guidance receptor Neuropilin-1 (Npn-1 in spinal motoneurons or in sensory neurons in the dorsal root ganglia (DRG, we have explored the contribution of this signaling pathway to correct innervation of the limb. We show that Npn-1 controls the fasciculation of both projections and mediates inter-axonal communication. Removal of Npn-1 from sensory neurons results in defasciculation of sensory axons and, surprisingly, also of motor axons. In addition, the tight coupling between these two heterotypic axonal populations is lifted with sensory fibers now leading the spinal nerve projection. These findings are corroborated by partial genetic elimination of sensory neurons, which causes defasciculation of motor projections to the limb. Deletion of Npn-1 from motoneurons leads to severe defasciculation of motor axons in the distal limb and dorsal-ventral pathfinding errors, while outgrowth and fasciculation of sensory trajectories into the limb remain unaffected. Genetic elimination of motoneurons, however, revealed that sensory axons need only minimal scaffolding by motor axons to establish their projections in the distal limb. Thus, motor and sensory axons are mutually dependent on each other for the generation of their trajectories and interact in part through Npn-1-mediated fasciculation before and within the plexus region of the limbs.

  14. Total Protein Content Determination of Microalgal Biomass by Elemental Nitrogen Analysis and a Dedicated Nitrogen-to-Protein Conversion Factor

    Energy Technology Data Exchange (ETDEWEB)

    Laurens, Lieve M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Olstad-Thompson, Jessica L [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Templeton, David W [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-02

    Accurately determining protein content is important in the valorization of algal biomass in food, feed, and fuel markets, where these values are used for component balance calculations. Conversion of elemental nitrogen to protein is a well-accepted and widely practiced method, but depends on developing an applicable nitrogen-to-protein conversion factor. The methodology reported here covers the quantitative assessment of the total nitrogen content of algal biomass and a description of the methodology that underpins the accurate de novo calculation of a dedicated nitrogen-to-protein conversion factor.

  15. [Determination of total protein content in soya-bean milk via visual moving reaction boundary titration].

    Science.gov (United States)

    Guo, Chengye; Wang, Houyu; Zhang, Lei; Fan, Liuyin; Cao, Chengxi

    2013-11-01

    A visual, rapid and accurate moving reaction boundary titration (MRBT) method was used for the determination of the total protein in soya-bean milk. During the process, moving reaction boundary (MRB) was formed by hydroxyl ions in the catholyte and soya-bean milk proteins immobilized in polyacrylamide gel (PAG), and an acid-base indicator was used to denote the boundary motion. The velocity of MRB has a relationship with protein concentration, which was used to obtain a standard curve. By paired t-test, there was no significant difference of the protein content between MRBT and Kjeldahl method at 95% confidence interval. The procedure of MRBT method required about 10 min, and it had linearity in the range of 2.0-14.0 g/L, low limit of detection (0.05 g/L), good precision (RSD of intra-day < 1.90% and inter-day < 4.39%), and high recoveries (97.41%-99.91%). In addition, non-protein nitrogen (NPN) such as melamine added into the soya-bean milk had weak influence on MRBT results.

  16. Effect of non-protein nitrogen and fodder legumes on the intake, digestibility and growth parameters of buffaloes

    International Nuclear Information System (INIS)

    Premaratne, S.

    1990-01-01

    Two in vivo digestibility studies and three nylon bag studies were conducted using four rumen fistulated male buffaloes to investigate the role of supplements of tree legumes and non-protein nitrogen on the feed intake, rumen function and growth of buffaloes given a basal diet of rice straw. Straw dry matter (DM) intake and digestibility were increased by urea treatment compared with urea supplementation. Inclusion of legume tree leaves in the diet increased the in vivo DM digestibility of both untreated and treated straw, but the increment was much higher for untreated straw. A supplementation of legumes also increased the in vivo nitrogen (N) digestibility of the diet of buffaloes. A trend towards an increase in straw intake with legume supplementation was also observed. Of the tree fodder legumes tested, Erythrina lithosperma had the highest potential for providing protein. Inclusion of legumes in the diet increased the DM and N degradation rates of feedstuff. In a growth trial of grazing female buffalo calves, the inclusion of fodder legumes increased the weight gain when compared with grazing alone. (author). 6 refs, 5 tabs

  17. Nitrogen control of photosynthetic protein synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, G.W.

    1986-09-01

    Plant growth is severely affected by impaired photosynthesis resulting from nitrogen deficiency. The molecular aspects of this effect are being studied in the green alga Chlamydomonas grown in continuous culture systems. Photosynthetic membranes of nitrogen-limited cells are dramatically depleted in chlorophylls, xanthophylls and proteins of the light-harvesting complexes. In contrast, enzymes of the reductive pentose phosphate cycle and electron transport chain complexes are reduced only 40 to 65% on a per cell basis comparison with nitrogen-sufficient cultures. From analyses of mRNA levels by in vitro translation and hybridization analyses with cloned DNA sequences for photosynthetic proteins, we have found there are rather minor effects of nitrogen deficiency on nuclear or chloroplast gene transcription. Maturation of a transcript of the nuclear-encoded small subunit of ribulose 1,5-bisphosphate carboxylase is inhibited in nitrogen-deficient cells and causes accumulation of large amounts of mRNA precursors. Most of the effects of nitrogen deficiency on photosynthetic proteins appear to result from posttranscriptional regulatory processes: light-harvesting protein synthesis may be sustained but their import into chloroplasts or translocation to photosynthetic membranes is impaired. Nitrogen-deficient cells lack violaxanthin, a pigment that is essential for the structure, function and biogenesis of the major antenna complexes. The absence of this pigment may be a causative factor for the deficiency of light harvesting complexes. Finally, the accumulation of massive amounts of starch and triglycerides in nitrogen-limited cells indicate there are some genes whose maximal expression is dependent upon nitrogen-limiting conditions. 10 refs.

  18. Nutritional geometry: gorillas prioritize non-protein energy while consuming surplus protein.

    Science.gov (United States)

    Rothman, Jessica M; Raubenheimer, David; Chapman, Colin A

    2011-12-23

    It is widely assumed that terrestrial food webs are built on a nitrogen-limited base and consequently herbivores must compensate through selection of high-protein foods and efficient nitrogen retention. Like many folivorous primates, gorillas' diet selection supports this assumption, as they apparently prefer protein-rich foods. Our study of mountain gorillas (Gorilla beringei) in Uganda revealed that, in some periods, carbohydrate-rich fruits displace a large portion of protein-rich leaves in their diet. We show that non-protein energy (NPE) intake was invariant throughout the year, whereas protein intake was substantially higher when leaves were the major portion of the diet. This pattern of macronutrient intake suggests that gorillas prioritize NPE and, to achieve this when leaves are the major dietary item, they over-eat protein. The concentrations of protein consumed in relation to energy when leaves were the major portion of the diet were close to the maximum recommended for humans and similar to high-protein human weight-loss diets. By contrast, the concentrations of protein in relation to energy when gorillas ate fruit-dominated diets were similar to those recommended for humans. Our results question the generality of nitrogen limitation in terrestrial herbivores and provide a fascinating contrast with human macronutrient intake.

  19. Nutritional geometry: gorillas prioritize non-protein energy while consuming surplus protein

    Science.gov (United States)

    Rothman, Jessica M.; Raubenheimer, David; Chapman, Colin A.

    2011-01-01

    It is widely assumed that terrestrial food webs are built on a nitrogen-limited base and consequently herbivores must compensate through selection of high-protein foods and efficient nitrogen retention. Like many folivorous primates, gorillas' diet selection supports this assumption, as they apparently prefer protein-rich foods. Our study of mountain gorillas (Gorilla beringei) in Uganda revealed that, in some periods, carbohydrate-rich fruits displace a large portion of protein-rich leaves in their diet. We show that non-protein energy (NPE) intake was invariant throughout the year, whereas protein intake was substantially higher when leaves were the major portion of the diet. This pattern of macronutrient intake suggests that gorillas prioritize NPE and, to achieve this when leaves are the major dietary item, they over-eat protein. The concentrations of protein consumed in relation to energy when leaves were the major portion of the diet were close to the maximum recommended for humans and similar to high-protein human weight-loss diets. By contrast, the concentrations of protein in relation to energy when gorillas ate fruit-dominated diets were similar to those recommended for humans. Our results question the generality of nitrogen limitation in terrestrial herbivores and provide a fascinating contrast with human macronutrient intake. PMID:21632622

  20. Digestibility and nitrogen balance of diets containing non conventional vegetable proteins fed to pigs of genetic strains suitable for outdoor systems

    OpenAIRE

    L. Sardi; M. Simioli; R. Paganelli; G. Martelli; L. Rizzi

    2010-01-01

    The study was carried out to evaluate on growing pigs kept in metabolism crates, either belonging to a “traditional” cross-breed (Duroc x Large White – DLW) or a local breed (Cinta Senese – CS), the digestibility and the nitrogen balance of non-conventional vegetable protein sources (field beans, pea and sunflower cake) when compared to soybean meal. The four diets were formulated so as to supply the same crude protein amount. CS pigs showed lower apparent digestibilit...

  1. Urea utilization in growing lambs. 7

    International Nuclear Information System (INIS)

    Ulbrich, M.

    1989-01-01

    The utilization quota of NPN and pure feed protein for body protein synthesis was calculated on the basis of N balance experiments with 15 N-labelled urea with the help of model concepts of a 3-pool model and its mathematical usage. In lambs weighing 13 kg the efficiency of amino acid and nucleic acid synthesis in the non-amino acid N pool was 64%. This results in a total utilization quota for NPN and pure protein in the ration of 40% and 60%, resp. Lambs weighing 27 kg showed an efficiency in amino acid and nucleic acid synthesis in the non-AA N pool of 77% and in the AA N pool of 60%. The total utilization quota of NPN was 47% and that of pure protein 56%. The pure protein in the ration was thus about twice as well utilized for total protein synthesis and for protein syntesis for crude protein retention as the NPN compounds in the ration. (author)

  2. Fast and selective determination of total protein in milk powder via titration of moving reaction boundary electrophoresis.

    Science.gov (United States)

    Guo, Cheng-ye; Wang, Hou-yu; Liu, Xiao-ping; Fan, Liu-yin; Zhang, Lei; Cao, Cheng-xi

    2013-05-01

    In this paper, moving reaction boundary titration (MRBT) was developed for rapid and accurate quantification of total protein in infant milk powder, from the concept of moving reaction boundary (MRB) electrophoresis. In the method, the MRB was formed by the hydroxide ions and the acidic residues of milk proteins immobilized via cross-linked polyacrylamide gel (PAG), an acid-base indicator was used to denote the boundary motion. As a proof of concept, we chose five brands of infant milk powders to study the feasibility of MRBT method. The calibration curve of MRB velocity versus logarithmic total protein content of infant milk powder sample was established based on the visual signal of MRB motion as a function of logarithmic milk protein content. Weak influence of nonprotein nitrogen (NPN) reagents (e.g., melamine and urea) on MRBT method was observed, due to the fact that MRB was formed with hydroxide ions and the acidic residues of captured milk proteins, rather than the alkaline residues or the NPN reagents added. The total protein contents in infant milk powder samples detected via the MRBT method were in good agreement with those achieved by the classic Kjeldahl method. In addition, the developed method had much faster measuring speed compared with the Kjeldahl method. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Nitrogen and protein contents in some aquatic plant species

    Directory of Open Access Journals (Sweden)

    Krystyna Bytniewska

    2015-01-01

    Full Text Available Nitrogen and protein contents in higher aquatic plants deriving from a natural habitat were determined. The following plants were examined: Spirodela polyrrhiza (L. Schleid., Elodea canadensis Rich., Riccia fluitans L. Total nitrogen and nitrogen of respective fractions were determined by the Kjeldahl method. Nitrogen compounds were fractionated according to Thimann et al. Protein was extracted after Fletcher and Osborne and fractionated after Osborne. It was found, that total protein content in the plants under examination constitutes 18 to 25%o of dry matter. Albumins and glutelins are the most abundant protein fractions.

  4. Evaluation of temperature-enhanced gain degradation of verticle npn and lateral pnp bipolar transistors

    International Nuclear Information System (INIS)

    Witczak, S.C.; Lacoe, R.C.; Galloway, K.F.

    1997-01-01

    The effect of dose rate on radiation-induced gain degradation is compared for verticle npn and lateral pnp bipolar transistors. High dose rate irradiations at elevated temperatures are more effective at simulating low dose rate degradation in the lateral pnp transistors

  5. Degradação in vitro da fibra em detergente neutro de forragem tropical de baixa qualidade em função da suplementação com proteína verdadeira e/ou nitrogênio não-proteico In vitro degradation of neutral detergent fiber of low-quality tropical forage according to supplementation with true protein and (or non-protein nitrogen

    Directory of Open Access Journals (Sweden)

    Edenio Detmann

    2011-06-01

    forragem de baixa qualidade.The objective was to evaluate in vitro degradation of neutral detergent fiber (NDF of low quality tropical forage according to supplementation with nitrogenous compounds at different true protein:non-protein nitrogen (NPN ratios. A sample of signal grass harvested at dry season was used as basal forage. Casein and the mixture urea:ammonium sulfate (U:AS, 9:1 were used as true protein and NPN source, respectively. The basal supplement for the other was defined by adding casein the incubation medium, in order to raise crude protein (CP level of the basal forage up to 8%, on dry matter basis. The other supplements were defined from the fractional replacement (0, 1/3, 2/3 and 1 of casein CP by U:AS protein equivalents. A control treatment (forage without supplementation was also evaluated. The treatments were evaluated by in vitro simulated ruminal environment, following the incubation times: 0, 3, 6, 9, 12, 24, 36, 48, 72, and 96 hours. The procedure was repeated three times, totaling three evaluations by incubation time for each treatment. Incubation residues were evaluated for NDF contents and interpreted through a non-linear logistic model. Protein supplementation increased 56.8 to 96.0% the degradation rate of potentially degradable NDF (kpdNDF in relation to control and decreased discret lag around 4.5 to 7.4 hours. The exclusive supplementation with urea increased by 15.9% the kpdNDF estimates compared to exclusive supplementation with casein. It was observed maximum kpdNDF and microbial growth at 2/3 CP of U:AS:1/3 CP of casein. Supplements which provide 1/3 of CP protein from true proteinand 2/3 from non-protein nitrogen can optimize the degradation of NDF of low-quality forage.

  6. Nitrogen-to-Protein Conversion Factors for Three Edible Insects

    NARCIS (Netherlands)

    Janssen, Renske H.; Vincken, Jean Paul; Broek, van den Lambertus A.M.; Fogliano, Vincenzo; Lakemond, Catriona M.M.

    2017-01-01

    Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor

  7. Protein Losses and Urea Nitrogen Underestimate Total Nitrogen Losses in Peritoneal Dialysis and Hemodialysis Patients.

    Science.gov (United States)

    Salame, Clara; Eaton, Simon; Grimble, George; Davenport, Andrew

    2018-04-28

    Muscle wasting is associated with increased mortality and is commonly reported in dialysis patients. Hemodialysis (HD) and peritoneal dialysis (PD) treatments lead to protein losses in effluent dialysate. We wished to determine whether changes in current dialysis practice had increased therapy-associated nitrogen losses. Cross-sectional cohort study. Measurement of total protein, urea and total nitrogen in effluent dialysate from 24-hour collections from PD patients, and during haemodiafiltration (HDF) and haemodialysis (HD) sessions. One hundred eight adult dialysis patients. Peritoneal dialysis, high-flux haemodialysis and haemodiafiltration. Total nitrogen and protein losses. Dialysate protein losses were measured in 68 PD and 40 HD patients. Sessional losses of urea (13.9 [9.2-21.1] vs. 4.8 [2.8-7.8] g); protein (8.6 [7.2-11.1] vs. 6.7 [3.9-11.1] g); and nitrogen (11.5 [8.7-17.7] vs. 4.9 [2.6-9.5] g) were all greater for HD than PD, P losses were lower with HD 25.9 (21.5-33.4) versus 46.6 (27-77.6) g/week, but nitrogen losses were similar. We found no difference between high-flux HD and HDF: urea (13.5 [8.8-20.6] vs. 15.3 [10.5-25.5] g); protein (8.8 [7.3-12.2] vs. 7.6 [5.8-9.0] g); and total nitrogen (11.6 [8.3-17.3] vs. 10.8 [8.9-22.5] g). Urea nitrogen (UN) only accounted for 45.1 (38.3-51.0)% PD and 63.0 (55.3-62.4)% HD of total nitrogen losses. Although sessional losses of protein and UN were greater with HD, weekly losses were similar between modalities. We found no differences between HD and HDF. However, total nitrogen losses were much greater than the combination of protein and UN, suggesting greater nutritional losses with dialysis than previously reported. Copyright © 2018 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  8. Comparison of Nitrogen Bioaccessibility from Salmon and Whey Protein Hydrolysates using a Human Gastrointestinal Model (TIM-1

    Directory of Open Access Journals (Sweden)

    Bomi Framroze

    2014-05-01

    Full Text Available Background: The TIM-1 system is a computer-controlled multi-compartmental dynamic model that closely simulates in vivo gastrointestinal tract digestion in humans. During digestion, the compounds released from meal matrix by gastric and intestinal secretions (enzymes are progressively absorbed through semipermeable membranes depending on their molecular weight. These absorbed (dialysed compounds are considered as bioaccessible, which means that they can be theoretically absorbed by the small intestine in the body. Methods: Salmon protein hydrolysate (SPH, whey protein hydrolysates extensively (WPHHigh or weakly (WPH-Low hydrolysed, non-hydrolysed whey protein isolate (WPI and mixtures of WPI:SPH (90:10, 80:20 were digested in TIM-1 using the conditions for a fast gastrointestinal transit that simulate the digestion of a liquid meal in human adults. During digestion (2 hours, samples were collected in intestinal compartments (duodenum, jejunum, and ileum and in both jejunal and ileal dialysates to determine their nitrogen content. All the products were compared in terms of kinetics of nitrogen absorption through the semipermeable membranes (bioaccessible nitrogen and nitrogen distribution throughout the intestinal compartments at the end of the 2 hour digestion. Results: After a 2 h-digestion in TIM-1, SPH was the protein substrate from which the highest amount of nitrogen (67.0% becomes available for the small intestine absorption. WPH-High had the second highest amount (56.0% of bioaccessible nitrogen while this amount decreased to 38.5–42.2% for the other protein substrates. The high nitrogen bioaccessibility of SPH is consistent with its richness in low molecular weight peptides (50% < 1000 Da. Conclusions: The results of this study indicate that SPH provides a higher proportion of bioaccessible nitrogen to a healthy adult compared to all forms of whey proteins, including extensively hydrolysed whey protein hydrolysate. The substitution of

  9. Influence of pre-cure freezing of Iberian ham on proteolytic changes throughout the ripening process.

    Science.gov (United States)

    Pérez-Palacios, Trinidad; Ruiz, Jorge; Barat, Jose Manuel; Aristoy, María Concepción; Antequera, Teresa

    2010-05-01

    This work aimed to investigate the effect of pre-cure freezing Iberian hams on proteolysis phenomena throughout the ripening process. Non-protein nitrogen (NPN), peptide nitrogen (PN) and amino acid nitrogen (AN) as well as amino acid and dipeptide evolution followed the same trend in both refrigerated (R) and pre-cure frozen (F) Iberian hams during processing. At the different stages of ripening, there were no differences in the content of NPN and AN while F dry-cured hams had higher levels of PN than R hams at the final step. This seemed to be more related to the salt content (lower in F than in R hams) than to the pre-cure freezing treatment. Most amino acids and dipeptides detected showed higher concentrations in F than in R Iberian hams at the green stage, being rather similar at the intermediate phases. At the final stage, the effects of pre-cure freezing of Iberian hams were not well defined, higher levels of some amino acids and dipeptides were found in R than in F Iberian hams whereas other amino acids were lower in R than in F hams. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  10. Magnetic-field-controlled negative differential conductance in scanning tunneling spectroscopy of graphene npn junction resonators

    Science.gov (United States)

    Li, Si-Yu; Liu, Haiwen; Qiao, Jia-Bin; Jiang, Hua; He, Lin

    2018-03-01

    Negative differential conductance (NDC), characterized by the decreasing current with increasing voltage, has attracted continuous attention for its various novel applications. The NDC typically exists in a certain range of bias voltages for a selected system and controlling the regions of NDC in curves of current versus voltage (I -V ) is experimentally challenging. Here, we demonstrate a magnetic-field-controlled NDC in scanning tunneling spectroscopy of graphene npn junction resonators. The magnetic field not only can switch on and off the NDC, but also can continuously tune the regions of the NDC in the I -V curves. In the graphene npn junction resonators, magnetic fields generate sharp and pronounced Landau-level peaks with the help of the Klein tunneling of massless Dirac fermions. A tip of scanning tunneling microscope induces a relatively shift of the Landau levels in graphene beneath the tip. Tunneling between the misaligned Landau levels results in the magnetic-field-controlled NDC.

  11. Analysis of protein content in grain by proton activation

    International Nuclear Information System (INIS)

    Dohan, D.A.; Standing, K.G.

    1976-01-01

    The total protein content of grain is an important measure of its nutritional value. More than one million protein analyses are carried out each year in Canada alone. The traditional method of measurement has been the Kjeldahl chemical technique, which measures total nitrogen. A new method of protein analysis which also measures total nitrogen has been developed. A beam of 16 MeV protons strikes a sample of grain and produces radioactive 14 0 nuclei through the reaction 14 N(p,n) 14 0. The effective sample thickness is determined by the proton range. The 14 0 decay (tausub(1/2)=71sec) is detected off-line by its characteristic 2.31 MeV γ-ray. The total number of protons hitting the sample is measured by integrating the beam current. The ratio of the number of γ-rays counted to the total number of protons striking the sample determines the abundance of nitrogen. The measurement is unambiguous, since no other reaction can produce 14 0 at 16 MeV proton energy. A mechanized system for sample handling has been constructed. Samples are carried into the irradiation area on a conveyor belt, then back through a shielding wall into a counting area. The laboratory PDP 15/40 computer controls the entire operation. At present the system is being tested at a rate of about two samples per minute. (author)

  12. Effect of UHT processing and storage conditions on physico-chemical characteristics of buffalo skim milk

    International Nuclear Information System (INIS)

    Hussain, I.

    2011-01-01

    The obtained results indicated that physico-chemical and nutritional changes in UHT processed buffalo skimmed milk were more pronounced at 45 deg. C than 25 deg. C and 10 deg. C. Duration of storage adversely affected the chemical and nutritional quality of processed milk. A slight decrease in pH, total ash and lactose contents, was observed, whereas acidity was increased on the mentioned storage conditions. Total nitrogen and casein nitrogen contents gradually decreased during storage, whereas non-casein nitrogen (NCN) and non-protein nitrogen (NPN) increased to a great extent in samples stored at higher temperatures. A significant increase in hydroxyl methyl furfural (HMF) values occurred in UHT processed buffalo skim milk at 25 deg. C and 45 deg. C after of 90 days storage. Storage at high temperature (45 deg. C) caused undesirable effects on sensory properties, general quality characteristics and acceptability of UHT buffalo skimmed milk. (author)

  13. Biological nitrogen fixation in non-legume plants.

    Science.gov (United States)

    Santi, Carole; Bogusz, Didier; Franche, Claudine

    2013-05-01

    Nitrogen is an essential nutrient in plant growth. The ability of a plant to supply all or part of its requirements from biological nitrogen fixation (BNF) thanks to interactions with endosymbiotic, associative and endophytic symbionts, confers a great competitive advantage over non-nitrogen-fixing plants. Because BNF in legumes is well documented, this review focuses on BNF in non-legume plants. Despite the phylogenic and ecological diversity among diazotrophic bacteria and their hosts, tightly regulated communication is always necessary between the microorganisms and the host plant to achieve a successful interaction. Ongoing research efforts to improve knowledge of the molecular mechanisms underlying these original relationships and some common strategies leading to a successful relationship between the nitrogen-fixing microorganisms and their hosts are presented. Understanding the molecular mechanism of BNF outside the legume-rhizobium symbiosis could have important agronomic implications and enable the use of N-fertilizers to be reduced or even avoided. Indeed, in the short term, improved understanding could lead to more sustainable exploitation of the biodiversity of nitrogen-fixing organisms and, in the longer term, to the transfer of endosymbiotic nitrogen-fixation capacities to major non-legume crops.

  14. Post-translational Introduction of D-Alanine into Ribosomally Synthesized Peptides by the Dehydroalanine Reductase NpnJ.

    Science.gov (United States)

    Yang, Xiao; van der Donk, Wilfred A

    2015-10-07

    Ribosomally synthesized peptides are generally limited to L-amino acid building blocks. Given the advantageous properties of peptides containing D-amino acids such as stabilization of certain turns and against proteolytic degradation, methods to introduce D-stereocenters are valuable. Here we report the first in vitro reconstitution and characterization of a dehydrogenase that carries out the asymmetric reduction of dehydroalanine. NpnJA reduces dehydroalanine to D-Ala using NAPDH as cosubstrate. The enzyme displays high substrate tolerance allowing introduction of D-Ala into a range of non-native substrates. In addition to the in vitro reactions, we describe five examples of using Escherichia coli as biosynthetic host for D-alanine introduction into ribosomal peptides. A deuterium-label-based coupled-enzyme assay was used to rapidly determine the stereochemistry of the newly installed alanine.

  15. Correlation Between Protein Intake and Nitrogen Balance of Surgical Patients in Anesthesiology and Intensive Care Installation, Sanglah General Hospital, Denpasar, Bali, Indonesia

    Directory of Open Access Journals (Sweden)

    Made Wiryana

    2016-06-01

    Full Text Available Background: A cell injury from surgical stress in a trauma or a non-trauma case will induce a hyper metabolic response in which the protein degradation increases, the somatic protein synthesis decreases and the amino acid catabolism increases. Thus, the pyper metabolic response contributes to nitrogen loss in urine. This response, without an adequate nutrition, will lead an iatrogenic malnutrition and deterioration. A balance nitrogen formula through urinary urea nitrogen is one of many nutrition evaluation methods. This method aids in evaluating the daily nutrition status and it can be the baseline data for daily intake. Objective: To find a correlation between the protein intake and the nitrogen balance of the surgical patients in anesthesiology and intensive care installation, Sanglah General Hospital, Denpasar, Bali. Methods: Fifty-one surgical patients with trauma and non-trauma cases were observed for their protein intake for 2-3 days continuously. Moreover, they were evaluated for their nitrogen balance based on the urinary urea nitrogen per 24 hours for 2-3 days. For statistical analysis, we utilized Shapiro-Francia, Shapiro-Wilk, Spearman Frank correlation, two-sample t test, and multivariate regression analysis in Strata SE 12.1. Results: The correlation between the protein intake and the nitrogen balance on the first day was ra=0.50 (p<0.05, on the second day ra=0.70 (p<0,05, and on the third day ra=0.740 (p<0,05. Conclusions: There is a correlation between the protein intake and the nitrogen balance of surgical patients in Anesthesiology and Intensive Care Installation Sanglah General Hospital Denpasar. 

  16. Liquid nitrogen dewar for protein crystal growth

    Science.gov (United States)

    2001-01-01

    Gaseous Nitrogen Dewar apparatus developed by Dr. Alex McPherson of the University of California, Irvine for use aboard Mir and the International Space Station allows large quantities of protein samples to be crystallized in orbit. The specimens are contained either in plastic tubing (heat-sealed at each end). Biological samples are prepared with a precipitating agent in either a batch or liquid-liquid diffusion configuration. The samples are then flash-frozen in liquid nitrogen before crystallization can start. On orbit, the Dewar is placed in a quiet area of the station and the nitrogen slowly boils off (it is taken up by the environmental control system), allowing the proteins to thaw to begin crystallization. The Dewar is returned to Earth after one to four months on orbit, depending on Shuttle flight opportunities. The tubes then are analyzed for crystal presence and quality

  17. Sample preparation techniques for the determination of natural 15N/14N variations in amino acids by gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS).

    Science.gov (United States)

    Hofmann, D; Gehre, M; Jung, K

    2003-09-01

    In order to identify natural nitrogen isotope variations of biologically important amino acids four derivatization reactions (t-butylmethylsilylation, esterification with subsequent trifluoroacetylation, acetylation and pivaloylation) were tested with standard mixtures of 17 proteinogenic amino acids and plant (moss) samples using GC-C-IRMS. The possible fractionation of the nitrogen isotopes, caused for instance by the formation of multiple reaction products, was investigated. For biological samples, the esterification of the amino acids with subsequent trifluoroacetylation is recommended for nitrogen isotope ratio analysis. A sample preparation technique is described for the isotope ratio mass spectrometric analysis of amino acids from the non-protein (NPN) fraction of terrestrial moss. 14N/15N ratios from moss (Scleropodium spec.) samples from different anthropogenically polluted areas were studied with respect to ecotoxicologal bioindication.

  18. PROTEOSE INTOXICATIONS AND INJURY OF BODY PROTEIN

    Science.gov (United States)

    Cooke, J. V.; Whipple, G. H.

    1918-01-01

    Sterile abscess formation in the dog is accompanied by a large increase in output of urinary nitrogen and also by a small but definite increase in the blood non-protein nitrogen. All this nitrogenous material of course is derived from body protein injury and autolysis. Septic inflammation in the dog (pleurisy, pneumonia, peritonitis, etc.) likewise shows a distinct rise in the blood non-protein nitrogen. This rise is not often so great as that frequently observed in the intoxication of intestinal obstruction. Many acute infections in man (septicemia, peritonitis, pneumonia, etc.) show a definite rise in the non-protein nitrogen and urea nitrogen of the blood; some cases show a very great rise above normal (over 100 mg. of non-protein nitrogen per 100 cc. of blood). There may be no anatomical change in the kidney beyond the familiar picture of cloudy swelling. This does not exclude the possibility of some transient functional derangement of the kidney epithelium. Certain obscure intoxications in man may show a considerable rise in the non-protein nitrogen of the blood, indicating a large amount of protein disintegration. These findings must be taken into account in any clinical analysis and interpretation of high non-protein nitrogen of the blood in pathological conditions. PMID:19868253

  19. Soluble Non-ammonia Nitrogen in Ruminal and Omasal Digesta of Korean Native Steers Supplemented with Soluble Proteins

    Directory of Open Access Journals (Sweden)

    C. W. Choi

    2012-09-01

    Full Text Available An experiment was conducted to study the effect of soluble protein supplements on concentration of soluble non-ammonia nitrogen (SNAN in the liquid phase of ruminal (RD and omasal digesta (OD of Korean native steers, and to investigate diurnal pattern in SNAN concentration in RD and OD. Three ruminally cannulated Korean native steers in a 3×3 Latin square design consumed a basal diet of rice straw and corn-based concentrate (control, and that supplemented (kg/d DM basis with intact casein (0.24; IC or acid hydrolyzed casein (0.46; AHC. Ruminal digesta was sampled using a vacuum pump, whereas OD was collected using an omasal sampling system at 2.0 h intervals after a morning feeding. The SNAN fractions (free amino acid (AA, peptide and soluble protein in RD and OD were assessed using the ninhydrin assay. Concentrations of free AA and total SNAN in RD were significantly (p<0.05 lower than those in OD. Although free AA concentration was relatively high, mean peptide was quantitatively the most important fraction of total SNAN in both RD and OD, indicating that degradation of peptide to AA rather than hydrolysis of soluble protein to peptide or deamination may be the most limiting step in rumen proteolysis of Korean native steers. Diurnal variation in peptide concentration in OD for the soluble protein supplemented diets during the feeding cycle peaked 2 h post-feeding and decreased thereafter whereas that for the control was relatively constant during the entire feeding cycle. Diurnal variation in peptide concentration was rather similar between RD and OD.

  20. Enhanced low dose rate sensitivity (ELDRS) in a voltage comparator which only utilizes complementary vertical NPN and PNP transistors

    International Nuclear Information System (INIS)

    Krieg, J.F.; Titus, J.L.; Emily, D.; Gehlhausen, M.; Swonger, J.; Platteter, D.

    1999-01-01

    For the first time, enhanced low dose rate sensitivity (ELDRS) is reported in a vertical bipolar process. A radiation hardness assurance (RHA) test method was successfully demonstrated on a linear circuit, the HS139RH quad comparator, and its discrete transistor elements. This circuit only uses vertical NPN and PNP transistors. Radiation tests on the HS139RH were performed at 25 C using dose rates of 50 rd(Si)/s, 100 mrd(Si)/s and 10 mrd(Si)/s, and at 100 C using a dose rate of 10 rd(Si)/s. Tests at dose rates of 50 rd(Si)/s at 25 C and 10 rd(Si)/s at 100 C were performed on discrete vertical NPN and PNP transistor elements which comprise the HS139RH. Transistor and circuit responses were evaluated. The die's passivation overcoat layers were varied to examine the effect of removing a nitride layer and thinning a deposited SiO 2 (silox) layer

  1. Fiber-bound nitrogen in gorilla diets: implications for estimating dietary protein intake of primates.

    Science.gov (United States)

    Rothman, Jessica M; Chapman, Colin A; Pell, Alice N

    2008-07-01

    Protein is essential for living organisms, but digestibility of crude protein is poorly understood and difficult to predict. Nitrogen is used to estimate protein content because nitrogen is a component of the amino acids that comprise protein, but a substantial portion of the nitrogen in plants may be bound to fiber in an indigestible form. To estimate the amount of crude protein that is unavailable in the diets of mountain gorillas (Gorilla beringei) in Bwindi Impenetrable National Park, Uganda, foods routinely eaten were analyzed to determine the amount of nitrogen bound to the acid-detergent fiber residue. The amount of fiber-bound nitrogen varied among plant parts: herbaceous leaves 14.5+/-8.9% (reported as a percentage of crude protein on a dry matter (DM) basis), tree leaves (16.1+/-6.7% DM), pith/herbaceous peel (26.2+/-8.9% DM), fruit (34.7+/-17.8% DM), bark (43.8+/-15.6% DM), and decaying wood (85.2+/-14.6% DM). When crude protein and available protein intake of adult gorillas was estimated over a year, 15.1% of the dietary crude protein was indigestible. These results indicate that the proportion of fiber-bound protein in primate diets should be considered when estimating protein intake, food selection, and food/habitat quality.

  2. Effect of gamma irradiation on the total nitrogen and protein content in body during different stages of silkworm development

    International Nuclear Information System (INIS)

    Petkov, N.; Malinova, K.; Binkh, N.T.

    1996-01-01

    The aim was to determine the effect of gamma irradiation of eggs of silk moth in B 2 stage in doses of 1.00, 2.00 and 3.00 Gy on the changes of total nitrogen and protein content during different stages of Bombyx mori L. development. Highest levels of total nitrogen and protein were found in silk gland 14.032-14.355 mg%, followed by pupae - 7.448-8.092 and 46.550-48.906 mg%, moths after egg laying - 6.650-7.825 and 41.563-48.906 mg% and silkworm hemolymph - 6.920-6.980 and 43.250-43.625 mg%, respectively. The irradiation of eggs with 2.00 and 3,00 Gy gamma rays stimulated the increase of total nitrogen and protein content in silk gland by 6.66-7.3% compared to non-irradiated eggs of the same breed. 14 refs., 3 tabs. (author)

  3. Mare’s milk: composition and protein fraction in comparison with different milk species

    Directory of Open Access Journals (Sweden)

    Krešimir Kuterovac

    2011-06-01

    Full Text Available The usage of the mare’s milk as functional food especial for children intolerant to cow’s milk, with neurodermitis, allergies and similar disorders desiring to improve the quality of life is fiercely debated for last decades but there were no scientific studies to suggest such use of mare’s milk based on scientific research. The objectives of this study were to determine similarities of mare’s milk in comparison with milk of ruminants (cattle, sheep and goat and human milk in terms of milk composition and protein fraction as whey proteins, caseins and micelles size. All differences were discussed regarding usage of mare’s milk in human diet and compared to milk which is usually used in human nutrition. Regarding composition, the mare’s milk is similar to human milk in of crude protein, salt and lactose content, but it has significantly lower content of fat. Fractions of main proteins are similar between human and mare’s milk, except nitrogen casein (casein N which has twice lower content in human than in mare’s milk. Content of casein N from all ruminants’ milk differ much more. Just for true whey N and non-protein nitrogen (NPN similar content as human and mare’s milk has also goat milk. The casein content is the lowest in human milk; this content is three times greater in mare’s milk and six to seven times greater in goat’s and cow’s milk, while in sheep’s milk it is more than 10 times grater. In many components and fractions mare’s milk is more similar to human milk than milk of ruminants. A detail comparison of protein fraction shows quite large differences between milk of different species. More study and clinical research are needed that can recommend usage of mare’s milk in human diet as functional food on scientific bases.

  4. Non-protein nitrogen utilization and microbial synthesis in the rumen

    International Nuclear Information System (INIS)

    Abou Akkada, A.R.; El-Shazly, K.

    1976-01-01

    The distinction between bacterial and protozoal proteins in the rumen has been a difficult task. The use of diaminopimelic acid (DAP) as a marker for bacterial protein and 2-aminoethanephosphonic acid (AEP) for protozoal protein has been examined in the present studies in sheep fed on a semi-purified diet. The microbial protein predicted from DAP and AEP determination was similar to that obtained by the precipitation of proteins. From rates of VFA determination by the in vitro zero-time rate technique, and from measurements of rumen volume using Cr-EDTA colour determination at 550 nm, the total VFA production in 24 h could be calculated, and the ATP generated (mol/day) was calculated using Baldwin and co-workers' transformation value of 2.44. The yield of microbial cells (g/mol ATP) was found to be 28.15, similar to that suggested by Hobson and Summers and Gunzalus and Schuster. Using a sheep double-fistulated in the duodenum proximal to the pyloric sphincter, and blocking the path of the abomasal fluid by inserting an inflated baloon in the second fistula, the abomasal fluid could be collected for 12 h. The total microbial-N as predicted from DAP and AEP was approximately similar to the total non-ammonia-N in the abomasal digesta. It could be concluded that DAP and AEP determination could be used within reasonable limits to differentiate between bacterial and protozoal proteins. A good agreement was found between rates of outflow of the rumen digesta and microbial growth (percentage hourly) as measured by different techniques. The agreement between values of microbial growth rates and rates of outflow of digesta from the rumen with the differences between production and absorption of VFA is an indication of the validity of the techniques employed in the present studies. (author)

  5. Nitrogen Metabolism in Lactating Goats Fed with Diets Containing Different Protein Sources

    Directory of Open Access Journals (Sweden)

    A. B. Santos

    2014-05-01

    Full Text Available This study aimed to evaluate urea excretion, nitrogen balance and microbial protein synthesis in lactating goats fed with diets containing different protein sources in the concentrate (soybean meal, cottonseed meal, aerial part of cassava hay and leucaena hay. Four Alpine goats whose mean body weight was 42.6±6.1 kg at the beginning of the experiment, a mean lactation period of 94.0±9.0 days and a production of 1.7±0.4 kg of milk were distributed in a 4×4 Latin square with four periods of 15 days. Diets were formulated to be isonitrogenous, containing 103.0 g/kg of CP, 400 g/kg of Tifton 85 hay and 600 g/kg of concentrate. Diet containing cottonseed meal provided (p<0.05 increased excretion of urea and urea nitrogen in the urine (g/d and mg/kg of BW when compared with leucaena hay. The diets affected the concentrations of urea nitrogen in plasma (p<0.05 and excretion of urea nitrogen in milk, being that soybean meal and cottonseed meal showed (p<0.05 higher than the average aerial part of the cassava hay. The use of diets with cottonseed meal as protein source in the concentrate in feeding of lactating goats provides greater nitrogen excretion in urine and negative nitrogen balance, while the concentrate with leucaena hay as a source of protein, provides greater ruminal microbial protein synthesis.

  6. Nitrogen Balance and Protein Requirements for Critically Ill Older Patients

    Directory of Open Access Journals (Sweden)

    Roland N. Dickerson

    2016-04-01

    Full Text Available Critically ill older patients with sarcopenia experience greater morbidity and mortality than younger patients. It is anticipated that unabated protein catabolism would be detrimental for the critically ill older patient. Healthy older subjects experience a diminished response to protein supplementation when compared to their younger counterparts, but this anabolic resistance can be overcome by increasing protein intake. Preliminary evidence suggests that older patients may respond differently to protein intake than younger patients during critical illness as well. If sufficient protein intake is given, older patients can achieve a similar nitrogen accretion response as younger patients even during critical illness. However, there is concern among some clinicians that increasing protein intake in older patients during critical illness may lead to azotemia due to decreased renal functional reserve which may augment the propensity towards worsened renal function and worsened clinical outcomes. Current evidence regarding protein requirements, nitrogen balance, ureagenesis, and clinical outcomes during nutritional therapy for critically ill older patients is reviewed.

  7. Buckminsterfullerenes: a non-metal system for nitrogen fixation.

    Science.gov (United States)

    Nishibayashi, Yoshiaki; Saito, Makoto; Uemura, Sakae; Takekuma, Shin-Ichi; Takekuma, Hideko; Yoshida, Zen-Ichi

    2004-03-18

    In all nitrogen-fixation processes known so far--including the industrial Haber-Bosch process, biological fixation by nitrogenase enzymes and previously described homogeneous synthetic systems--the direct transformation of the stable, inert dinitrogen molecule (N2) into ammonia (NH3) relies on the powerful redox properties of metals. Here we show that nitrogen fixation can also be achieved by using a non-metallic buckminsterfullerene (C60) molecule, in the form of a water-soluble C60:gamma-cyclodextrin (1:2) complex, and light under nitrogen at atmospheric pressure. This metal-free system efficiently fixes nitrogen under mild conditions by making use of the redox properties of the fullerene derivative.

  8. Mineral, protein and nitrate contents in leaves of Pereskia aculeata subjected to nitrogen fertilization

    Directory of Open Access Journals (Sweden)

    Maria Regina de Miranda Souza

    2016-03-01

    Full Text Available Considering that nitrogen is directly related to leaf protein content, the nitrogen fertilization in Pereskia aculeata plants may affect the protein content and increase its nutritional potential. This study aimed at assessing the effect of nitrogen fertilization on mineral, protein and nitrate contents, as well as the yield of P. aculeata leaves. A randomized blocks design was used, with three replications and five treatments, consisting of increasing topdressing nitrogen doses (0-400 kg ha-1, in soil with organic matter content of 4.0 dag kg-1. Three harvests were performed for leaf analysis. No significant effect was observed for mineral and protein content or leaf fresh mass yield. The mean values for mineral composition were: 3.52 dag kg-1 of N, 0.47 dag kg-1 of P, 4.65 dag kg-1 of Ca, 0.71 dag kg-1 of Mg, 0.25 dag kg-1 of S, 36.64 mg kg-1 of Zn and 174.13 mg kg-1 of Fe. The mean content for protein was 21.86 % and the leaf fresh mass yield was 0.971 kg plant-1. K levels decreased from 50 kg ha-1 of N. Nitrate increased linearly with the nitrogen fertilization, reaching a maximum value of 78.2 mg kg-1 of fresh mass, well below the health risk threshold. It was concluded that a soil with high organic matter content does not require nitrogen fertilization. However, doses up to 400 kg ha-1 of nitrogen ensure adequate leaf yield and protein and mineral contents within the desired range for the species, being a food rich in proteins, iron and calcium.

  9. Herbicides effect on the nitrogen fertilizer assimilation by sensitive plants

    International Nuclear Information System (INIS)

    Ladonin, V.F.; Samojlov, L.N.

    1976-01-01

    It has been established in studying the effect of herbicides on pea plants that the penetration of the preparations into the tissues of leaves and stems results in a slight increase of the rate of formation of dry substance in the leaves of the treated plants within 24 hours after treatment as compared with control, whereas in the last period of the analysis the herbicides strongly inhibit the formation of dry substance in leaves. The applied herbicide doses have resulted in drastic changes of the distribution of the plant-assimilated nitrogen between the protein and non-protein fractions in the leaves and stems of pea. When affected by the studied herbicides, the fertilizer nitrogen supply to the pea plants changes and the rate of the fertilizer nitrogen assimilation by the plants varies noticeably. The regularities of the fertilizer nitrogen inclusion in the protein and non-protein nitrogen compounds of the above-ground pea organs have been studied

  10. Nitrogen efficiency of dairy cattle : from protein evaluation to ammonia emission

    NARCIS (Netherlands)

    Duinkerken, van G.

    2011-01-01

    Diet optimization contributes considerably to increased nitrogen efficiency of dairy cattle, resulting in reduced nitrogen losses. This thesis focuses on three themes: the potential advances in protein evaluation systems for ruminants, the relationship between dairy cow diet and ammonia emission

  11. Computing wheat nitrogen requirements from grain yield and protein maps

    Science.gov (United States)

    Optical protein sensors and mass-flow yield monitors provide the opportunity to continuously measure grain quality and quantity during harvesting. This chapter illustrates how yield monitor and grain protein measurements may provide useful postharvest information for evaluating water or nitrogen (N)...

  12. Assimilation of 15N-labelled urea nitrogen and ammonium nitrate nitrogen by plants in case of root and non-root fertilization

    International Nuclear Information System (INIS)

    Muravin, Eh.A.; Kozhemyachko, V.A.; Vernichenko, I.V.

    1974-01-01

    Assimilation of 15 N labeled urea and ammonium nitrate in root and foliar application by spring wheat and barley has been studied during 1970-1973 period in a series of vegetative experiments at the Department of Agrochemistry, Timiryazev Agricultural Academy, and at D.N. Pryanishnikov Experimental Agrochemical Station. Additional fertilizer nitrogen applied at later ontogenesis stages (flowering and milky ripeness) is utilized mostly for protein synthesis in developing grains, thus leading to a significant increase in the relative grain protein content. A transfer of a part of nitrogen from the main ortion of fertilizer at later stages of nitrition results, at the same time, in a lower yield. Nitrogen utilization degree of urea and ammonium nitrate, when introduced before sowing or at the flowering stage is similar but in the latter case, however, additional assimilation of soil nitrogen is lower. The assimilation rate of nitrogen in root application is the lower the later the fertilizer is applied. When ammonium nitrate is additionally applied as nutrition to barley at the milky ripeness stage, ammonia and nitrate nitrogen are assimilated at the same rate and to the same extent but ammonia nitrogen is more rapidly used for protein synthesis and the rate of its transfer to the developing grains is higher. The rate of nitrogen assimilation at plant is much higher in foliar than in root application. Wheat utilizes more urea nitrogen at the flowering stage when root application is used but at the milky ripeness stage foliar application is more effective

  13. Evaluation of some feedstuffs with special emphasis on the effect of nitrate and other non-protein nitrogen fractions on ruminal microbial metabolism

    International Nuclear Information System (INIS)

    Nikolic, J.A.

    1988-01-01

    Green herbage grown under widely different conditions was examined for nitrate content. The mean value was 0.14% (range 0.01-0.32%) NO 3 -N in the dry matter (DM). It was concluded that the cut green fodder would induce high levels of blood methaemoglobin when fed to ruminants in mixed diets. Nevertheless, experiments in vitro indicated that relatively small amounts of dietary nitrate induced considerable microbial nitrate reducing activity in rumen contents. Moreover, nitrate reduction to ammonia was accompanied by alterations in microbial sulphur and energy metabolism. A technique for determining organic matter digestibility (OMD) in vitro was standardized and used to evaluate the potential nutritive value of some fruit wastes. Studies on apple pomace silage indicated that added urea did not significantly increase the silage protein content but remained as a potential source of non-protein nitrogen for rumen microorganisms. Apple pomace ensiled alone or preferably with other ingredients was acceptable to sheep and cattle, particularly as a supplement to their winter rations. (author). 27 refs, 2 figs, 5 tabs

  14. Effect of 50 MeV Li3+ ion irradiation on electrical characteristics of high speed NPN power transistor

    International Nuclear Information System (INIS)

    Dinesh, C.M.; Ramani; Radhakrishna, M.C.; Dutt, R.N.; Khan, S.A.; Kanjilal, D.

    2008-01-01

    Silicon NPN overlay RF power high speed commercial bipolar junction transistors (BJTs) find applications in military, space and communication equipments. Here we report the effect of 50 MeV Li 3+ ion irradiation in the fluence range 1 x 10 11 -1.8 x 10 12 ions cm -2 on NPN power transistor. The range (R), electronic energy loss (S e ), nuclear energy loss (S n ), total ionizing dose (TID) and total displacement damage (D d ) in the silicon target are calculated from TRIM Monte Carlo Code. Output resistance is 3.568 x 10 4 Ω for unirradiated device and it increases to 6 x 10 7 Ω as the fluence is increased from 1 x 10 11 to 1.8 x 10 12 ions cm -2 . The capacitance of the emitter-base junction of the transistor decreases and dielectric loss of the emitter-base junction increases with increase in ion fluence. The built in voltage of the unirradiated sample is 0.5 V and it shifts to 0.4 V after irradiation at fluence of 1.8 x 10 12 ions cm -2 and the corresponding doping density reduced to 5.758 x 10 16 cm -3 . The charge carrier removal rate varies linearly with the increase in ion fluence

  15. Neutron Radiation Effect On 2N2222 And NTE 123 NPN Silicon Bipolar Junction Transistors

    International Nuclear Information System (INIS)

    Oo, Myo Min; Rashid, N K A Md; Hasbullah, N F; Karim, J Abdul; Zin, M R Mohamed

    2013-01-01

    This paper examines neutron radiation with PTS (Pneumatic Transfer System) effect on silicon NPN bipolar junction transistors (2N2222 and NTE 123) and analysis of the transistors in terms of electrical characterization such as current gain after neutron radiation. The key parameters are measured with Keithley 4200SCS. Experiment results show that the current gain degradation of the transistors is very sensitive to neutron radiation. The neutron radiation can cause displacement damage in the bulk layer of the transistor structure. The current degradation is believed to be governed by increasing recombination current between the base and emitter depletion region

  16. Assimilation of /sup 15/N-labelled urea nitrogen and ammonium nitrate nitrogen by plants in case of root and non-root fertilization

    Energy Technology Data Exchange (ETDEWEB)

    Muravin, E A; Kozhemyachko, V A; Vernichenko, I V

    1974-01-01

    Assimilation of /sup 15/N labeled urea and ammonium nitrate in root and foliar application by spring wheat and barley has been studied during 1970-1973 period in a series of vegetative experiments at the Department of Agrochemistry, Timiryazev Agricultural Academy, and at D.N. Pryanishnikov Experimental Agrochemical Station. Additional fertilizer nitrogen applied at later ontogenesis stages (flowering and milky ripeness) is utilized mostly for protein synthesis in developing grains, thus leading to a significant increase in the relative grain protein content. A transfer of a part of nitrogen from the main portion of fertilizer at later stages of nitrition results, at the same time, in a lower yield. Nitrogen utilization degree of urea and ammonium nitrate, when introduced before sowing or at the flowering stage is similar but in the latter case, however, additional assimilation of soil nitrogen is lower. The assimilation rate of nitrogen in root application is the lower the later the fertilizer is applied. When ammonium nitrate is additionally applied as nutrition to barley at the milky ripeness stage, ammonia and nitrate nitrogen are assimilated at the same rate and to the same extent but ammonia nitrogen is more rapidly used for protein synthesis and the rate of its transfer to the developing grains is higher. The rate of nitrogen assimilation at plant is much higher in foliar than in root application. Wheat utilizes more urea nitrogen at the flowering stage when root application is used but at the milky ripeness stage foliar application is more effective.

  17. The effects of nitrogen deficiencies on the lipid and protein contents ...

    African Journals Online (AJOL)

    Nitrogen deficiencies were studied in Spirulina platensis (Cyanophyceae) with the aim of determining the effects of the 50 and 100% deficient nitrogen on the lipid and protein contents of the cell under laboratory conditions. S. platensis cultures were grown in Spirulina medium and kept at the constant room temperature of ...

  18. Effect of the Ratio of Non-fibrous Carbohydrates to Neutral Detergent Fiber and Protein Structure on Intake, Digestibility, Rumen Fermentation, and Nitrogen Metabolism in Lambs.

    Science.gov (United States)

    Ma, T; Tu, Y; Zhang, N F; Deng, K D; Diao, Q Y

    2015-10-01

    This study aimed to investigate the effect of the ratio of non-fibrous carbohydrates to neutral detergent fibre (NFC/NDF) and undegraded dietary protein (UDP) on rumen fermentation and nitrogen metabolism in lambs. Four Dorper×thin-tailed Han crossbred lambs, averaging 62.3±1.9 kg of body weight and 10 mo of age, were randomly assigned to four dietary treatments of combinations of two levels of NFC/NDF (1.0 and 1.7) and two levels of UDP (35% and 50% of crude protein [CP]). Duodenal nutrient flows were measured with dual markers of Yb and Co, and microbial N (MN) synthesis was estimated using (15)N. High UDP decreased organic matter (OM) intake (p = 0.002) and CP intake (p = 0.005). Ruminal pH (p<0.001), ammonia nitrogen (NH3-N; p = 0.008), and total volatile fatty acids (p<0.001) were affected by dietary NFC/NDF. The ruminal concentration of NH3-N was also affected by UDP (p<0.001). The duodenal flow of total MN (p = 0.007) was greater for lambs fed the high NFC/NDF diet. The amount of metabolisable N increased with increasing dietary NFC:NDF (p = 0.02) or UDP (p = 0.04). In conclusion, the diets with high NFC/NDF (1.7) and UDP (50% of CP) improved metabolisable N supply to lambs.

  19. Effect of the Ratio of Non-fibrous Carbohydrates to Neutral Detergent Fiber and Protein Structure on Intake, Digestibility, Rumen Fermentation, and Nitrogen Metabolism in Lambs

    Directory of Open Access Journals (Sweden)

    T. Ma

    2015-10-01

    Full Text Available This study aimed to investigate the effect of the ratio of non-fibrous carbohydrates to neutral detergent fibre (NFC/NDF and undegraded dietary protein (UDP on rumen fermentation and nitrogen metabolism in lambs. Four Dorper×thin-tailed Han crossbred lambs, averaging 62.3±1.9 kg of body weight and 10 mo of age, were randomly assigned to four dietary treatments of combinations of two levels of NFC/NDF (1.0 and 1.7 and two levels of UDP (35% and 50% of crude protein [CP]. Duodenal nutrient flows were measured with dual markers of Yb and Co, and microbial N (MN synthesis was estimated using 15N. High UDP decreased organic matter (OM intake (p = 0.002 and CP intake (p = 0.005. Ruminal pH (p<0.001, ammonia nitrogen (NH3-N; p = 0.008, and total volatile fatty acids (p<0.001 were affected by dietary NFC/NDF. The ruminal concentration of NH3-N was also affected by UDP (p<0.001. The duodenal flow of total MN (p = 0.007 was greater for lambs fed the high NFC/NDF diet. The amount of metabolisable N increased with increasing dietary NFC:NDF (p = 0.02 or UDP (p = 0.04. In conclusion, the diets with high NFC/NDF (1.7 and UDP (50% of CP improved metabolisable N supply to lambs.

  20. SHI induced damage in electrical properties of silicon NPN BJTs

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, M. Vinay, E-mail: vkm288@gmail.com; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)

    2016-05-23

    The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.

  1. Nitrogen excretion in rats on a protein-free diet and during starvation

    DEFF Research Database (Denmark)

    Chwalibog, André; Sawosz, Ewa; Niemiec, Tomasz

    2008-01-01

    Nitrogen balances (six days) were determined in male Wistar rats during feeding a diet with sufficient protein or a nearly protein-free diet (n = 2 x 24), and then during three days of starvation (n = 2 x 12). The objective was to evaluate the effect of protein withdrawal on minimum nitrogen...... excretion in urine (UN), corresponding to endogenous UN, during feeding and subsequent starvation periods. The rats fed the protein free-diet had almost the same excretion of urinary N during feeding and starvation (165 and 157 mg/kg W(0.75)), while it was 444 mg/kg W(0.75) in rats previously fed...... with protein, demonstrating a major influence of protein content in a diet on N excretion during starvation. Consequently, the impact of former protein supply on N losses during starvation ought to be considered when evaluating minimum N requirement necessary to sustain life....

  2. Nitrogen-to-Protein Conversion Factors for Three Edible Insects: Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens.

    Science.gov (United States)

    Janssen, Renske H; Vincken, Jean-Paul; van den Broek, Lambertus A M; Fogliano, Vincenzo; Lakemond, Catriona M M

    2017-03-22

    Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor overestimates the protein content, due to the presence of nonprotein nitrogen in insects. In this paper, a specific Kp of 4.76 ± 0.09 was calculated for larvae from Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens, using amino acid analysis. After protein extraction and purification, a Kp factor of 5.60 ± 0.39 was found for the larvae of three insect species studied. We propose to adopt these Kp values for determining protein content of insects to avoid overestimation of the protein content.

  3. Comparative analysis of vitamin C, crude protein, elemental nitrogen ...

    African Journals Online (AJOL)

    Yomi

    2011-12-21

    Dec 21, 2011 ... greens (Brassica napus L.) and kale (Brassica oleracea var. acephala) ... Nitrogen is essential for protein production, for proper growth of ... Brassica crops. ..... the effect of trace element-amended fertilizers on their Co, Se, and.

  4. Effects of water deficit and nitrogen levels on grain yield and oil and protein contents of maize

    Directory of Open Access Journals (Sweden)

    Kazem Ghassemi-Golezani

    2015-02-01

    Full Text Available This research was conducted in 2014, to evaluate the effects of water deficit and nitrogen fertilizer on grain yield, oil and protein contents of maize (cv. double Cross 303. The experiment was arranged as split-plot based on Randomized Complete Block design (RCB with three replications. Irrigation treatments (irrigation after 60, 90, 120 and 150 mm evaporation and nitrogen levels (0, 46 and 92 kg N/ha were located in the main and sub plots, respectively. Mean grain yield per unit area decreased with decreasing water availability, but it was improved with increasing nitrogen fertilizer. Grain oil percentage significantly decreased, but protein percentage slightly increased as a result of water deficit. In general, oil and protein yields significantly decreased under moderate and severe water stress, mainly because of decreasing grain yield under these conditions. Nitrogen application decreased oil percentage, but increased protein percentage significantly. Nevertheless, nitrogen fertilizer enhanced oil and protein yields per unit area, with no significant difference between nitrogen rates. These results were positively related with grain yield per unit area in maize.

  5. Effect of nitrogen and Nitragin application on soybean yield and protein content

    Directory of Open Access Journals (Sweden)

    Đukić Vojin

    2010-01-01

    Full Text Available A three-year experiment was conducted to study the effect of different doses of nitrogen fertilizer applied under previous crop and seed inoculation with a microbial preparation NS Nitragin on soybean yield and protein content in grain. The experiment was set up in four replications at Rimski Šančevi experiment field of Institute of Field and Vegetable Crops, Novi Sad. Presowing seed inoculation contributed to a statistically significant increase in yield and protein content in all three research years, while the highest nitrogen dose had a positive impact on soybean yield only in 2007 and on protein content in 2006 and 2007. .

  6. Nitrogen cycling in summer active perennial grass systems in South Australia: Non-symbiotic nitrogen fixation

    NARCIS (Netherlands)

    Gupta, V.V.S.R.; Kroker, S.J.; Hicks, M.; Davoren, W.; Descheemaeker, K.K.E.; Llewellyn, R.

    2014-01-01

    Non-symbiotic nitrogen (N2) fixation by diazotrophic bacteria is a potential source for biological N inputs in non-leguminous crops and pastures. Perennial grasses generally add larger quantities of above- and belowground plant residues to soil, and so can support higher levels of soil biological

  7. Spatiotemporal patterns of non-point source nitrogen loss in an agricultural catchment

    Directory of Open Access Journals (Sweden)

    Jian-feng Xu

    2016-04-01

    Full Text Available Non-point source nitrogen loss poses a risk to sustainable aquatic ecosystems. However, non-point sources, as well as impaired river segments with high nitrogen concentrations, are difficult to monitor and regulate because of their diffusive nature, budget constraints, and resource deficiencies. For the purpose of catchment management, the Bayesian maximum entropy approach and spatial regression models have been used to explore the spatiotemporal patterns of non-point source nitrogen loss. In this study, a total of 18 sampling sites were selected along the river network in the Hujiashan Catchment. Over the time period of 2008–2012, water samples were collected 116 times at each site and analyzed for non-point source nitrogen loss. The morphometric variables and soil drainage of different land cover types were studied and considered potential factors affecting nitrogen loss. The results revealed that, compared with the approach using the Euclidean distance, the Bayesian maximum entropy approach using the river distance led to an appreciable 10.1% reduction in the estimation error, and more than 53.3% and 44.7% of the river network in the dry and wet seasons, respectively, had a probability of non-point source nitrogen impairment. The proportion of the impaired river segments exhibited an overall decreasing trend in the study catchment from 2008 to 2012, and the reduction in the wet seasons was greater than that in the dry seasons. High nitrogen concentrations were primarily found in the downstream reaches and river segments close to the residential lands. Croplands and residential lands were the dominant factors affecting non-point source nitrogen loss, and explained up to 70.7% of total nitrogen in the dry seasons and 54.7% in the wet seasons. A thorough understanding of the location of impaired river segments and the dominant factors affecting total nitrogen concentration would have considerable importance for catchment management.

  8. The Crc protein inhibits the production of polyhydroxyalkanoates in Pseudomonas putida under balanced carbon/nitrogen growth conditions.

    Science.gov (United States)

    La Rosa, Ruggero; de la Peña, Fernando; Prieto, María Axiliadora; Rojo, Fernando

    2014-01-01

    Pseudomonas putida synthesizes polyhydroxyalkanoates (PHAs) as storage compounds. PHA synthesis is more active when the carbon source is in excess and the nitrogen source is limiting, but can also occur at a lower rate under balanced carbon/nitrogen ratios. This work shows that PHA synthesis is controlled by the Crc global regulator, a protein that optimizes carbon metabolism by inhibiting the expression of genes involved in the use of non-preferred carbon sources. Crc acts post-transcriptionally. The mRNAs of target genes contain characteristic catabolite activity (CA) motifs near the ribosome binding site. Sequences resembling CA motifs can be predicted for the phaC1 gene, which codes for a PHA polymerase, and for phaI and phaF, which encode proteins associated to PHA granules. Our results show that Crc inhibits the translation of phaC1 mRNA, but not that of phaI or phaF, reducing the amount of PHA accumulated in the cell. Crc inhibited PHA synthesis during exponential growth in media containing a balanced carbon/nitrogen ratio. No inhibition was seen when the carbon/nitrogen ratio was imbalanced. This extends the role of Crc beyond that of controlling the hierarchical utilization of carbon sources and provides a link between PHA synthesis and the global regulatory networks controlling carbon flow. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  9. Ileal and faecal protein digestibility measurement in humans and other non-ruminants - a comparative species view

    NARCIS (Netherlands)

    Hendriks, W.H.; Baal, van J.; Bosch, G.

    2012-01-01

    A comparative non-ruminant species view of the contribution of the large intestinal metabolism to inaccuracies in nitrogen and amino acid absorption measurements is provided to assess potential implications for the determination of crude protein/amino acid digestibility in adult humans consuming

  10. Nitrogen-to-Protein Conversion Factors for Crop Residues and Animal Manure Common in China.

    Science.gov (United States)

    Chen, Xueli; Zhao, Guanglu; Zhang, Yang; Han, Lujia; Xiao, Weihua

    2017-10-25

    Accurately determining protein content is essential in exploiting biomass as feed and fuel. A survey of biomass samples in China indicated protein contents from 2.65 to 3.98% for crop residues and from 6.07 to 10.24% for animal manure of dry basis. Conversion factors based on amino acid nitrogen (k A ) ranged from 5.42 to 6.00 for the former and from 4.78 to 5.36 for the latter, indicating that the traditional factor of 6.25 is not suitable for biomass samples. On the other hand, conversion factors from Kjeldahl nitrogen (k P ) ranged from 3.97 to 4.57 and from 2.76 to 4.31 for crop residues and animal manure, respectively. Of note, conversion factors were strongly affected by amino acid composition and levels of nonprotein nitrogen. Thus, k P values of 4.23 for crop residues, 4.11 for livestock manure, and 3.11 for poultry manure are recommended to better estimate protein content from total nitrogen.

  11. Protein intake, nitrogen balance and nutritional status in patients with Parkinson's disease; time for a change?

    Science.gov (United States)

    Zilli Canedo Silva, Maryanne; Carol Fritzen, Natali; de Oliveira, Marlon; Paes da Silva, Michel; Rasmussen Petterle, Ricardo; Teive, Hélio Afonso; de Mesquita Barros Almeida Leite, Christiane; Rabito, Estela Iraci; Madalozzo Schieferdecker, Maria Eliana; Carvalho, Mauricio

    2015-06-01

    To evaluate protein intake, nitrogen balance and nutritional status of clinically stable patients with Parkinson's disease (PD). A cross-sectional study of PD patients Hoehn-Yahr scale stage 1-3 and subjects with no neurologic disease (controls) matched for age and gender. All participants underwent a diet history interview, anthropometric measurements, bioelectrical impedance and food record over three non-consecutive days, including a weekend. A 24-hour urine collection and fasting venous blood sampling were collected from the participants for evaluation of creatinine clearance, creatinine height index and the nitrogen balance. The mean age of PD patients was 58.9 ± 12.8 year compared to 54.7 ± 12.6 year of the controls, P = 0.34. One third of PD group had symptoms of dysphagia and ingested less water and fibers when compared to controls. Calf circumference was small in PD group (35.5 ± 2.8 vs. 38.4 ± 3.5 cm, P = 0.012). Intake of nitrogen was significantly lower and nitrogen balance was negative in PD patients (-1.8 ± 3.9 vs. 1.1 ± 4.2 controls, P = 0.06). The antioxidants folate and vitamin E were consumed in small amounts in both groups, although significantly less in PD patients (P = 0.04 and 0.03, respectively). Daily intakes of protein of approximately 1.1 g/kg by clinically stable PD patients may not be enough to ensure a neutral calorie-nitrogen balance and muscle tissue conservation. Larger studies are necessary to provide a more comprehensive picture of PD patients' metabolic status. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  12. Exploring Chemical and Thermal Non-equilibrium in Nitrogen Arcs

    International Nuclear Information System (INIS)

    Ghorui, S; Das, A K

    2012-01-01

    Plasma torches operating with nitrogen are of special importance as they can operate with usual tungsten based refractory electrodes and offer radical rich non-oxidizing high temperature environment for plasma chemistry. Strong gradients in temperature as well as species densities and huge convective fluxes lead to varying degrees of chemical non-equilibrium in associated regions. An axi-symmetric two-temperature chemical non-equilibrium model of a nitrogen plasma torch has been developed to understand the effects of thermal and chemical non-equilibrium in arcs. A 2-D finite volume CFD code in association with a non-equilibrium property routine enabled extraction of steady state self-consistent distributions of various plasma quantities inside the torch under various thermal and chemical non-equilibrium conditions. Chemical non-equilibrium has been incorporated through computation of diffusive and convective fluxes in each finite volume cell in every iteration and associating corresponding thermodynamic and transport properties through the scheme of 'chemical non-equilibrium parameter' introduced by Ghorui et. al. Recombination coefficient data from Nahar et. al. and radiation data from Krey and Morris have been used in the simulation. Results are presented for distributions of temperature, pressure, velocity, current density, electric potential, species densities and chemical non-equilibrium effects. Obtained results are compared with similar results under LTE.

  13. Nitrogen 15 abundance in protein fractions of beans fertilized with (15NH4)2SO4

    International Nuclear Information System (INIS)

    Chaud, Saula Goulart; Oliveira, Admar Costa de; Trivelin, Paulo Cesar Ocheuze

    2002-01-01

    Studies evaluating the protein nutritive value of beans labelled with 15 N, using nitrogen balance and the quantitation of faecal and urinary endogenous nitrogen, determined by isotopic dilution, have been extensively used. The objective of this research was to verify if the isotopic labelling of raw, freeze dried beans (Phaseolus vulgaris L., cultivar Pirata 1) with 1.394 atoms % 15 N, resulted in the same abundance of the whole flour and of the protein fractions extracted from the beans with 0.5 mol L -1 NaCl. The isotopic abundance found in the whole bean flour, in the protein extract, in the globulin and albumin fractions were respectively: 1.394 +- 0.011; 1.403 +- 0.012; 1.399 +- 0.007 and 1.399 +- 0.028 atoms % of 15 N, presenting no difference (P > 0.05). However, a difference was found (P < 0.05) between the above mentioned abundances and the isotopic abundance found in the nitrogen of the proteins in the extraction residue, which was 0.969 +- 0.084. Since the abundances did not differ, the protein nutritive indexes, such as digestibility and biological value, determined from the nitrogen balance and corrected for isotopic dilution, would not be affected by extracting the proteins from the beans with 0.5 mol L 1 NaCl. If working with the nitrogen balance of the residual proteins after extraction and even with the whole flours, these indexes could present incorrect values, since the isotopic labelling of the residual proteins was less than that of the protein fractions. (author)

  14. Effect of Nitrogen Fertilizer on Variations in Composition in Protein and Non-Protein Compounds in the Aerial Parts of Dactylis Glomerata L; Influence de la Fertilisation Azotee sur les Variations de la Composition en Composes Proteiques et Non Proteiques des Parties Aeriennes de Dactylis Glomerata L.

    Energy Technology Data Exchange (ETDEWEB)

    Lefebvre, J. M. [Institut National de la Recherche Agronomique, Station d' Agronomie, Dijon (France)

    1968-07-01

    A knowledge of the effects of nitrogen fertilizer on plant quality would appear to be of prime importance in the study of plant-animal relations. Th e author examined, at a test facility in the east-central part of France, variations in the composition of the aerial parts of ''Floreal'' cocksfoot treated with nitrogen fertilizer at different supply rates. Enrichment in soluble organic nitrogen, amino acids, amides, simple peptides and protein compounds is fairly proportional to the nitrogen dose supplied at different vegetative cycles. Free mineral nitrogen, consisting almost exclusively of nitrates, shows elevated values, particularly during the first vegetative cycles which take place at a time when low temperatures are not favourable to a rapid reduction. The values found increase with the amounts of nitrogen supplied to the plants. If the fertilizer is applied to the grass 15 days after ablation of the aerial parts and not immediately, as in common farming practice, a complete modification of the various phenomena accompanying protein synthesis will be noted. In this case nitrate production is very swift and metabolization into soluble organic compounds and condensates is extensive. As a result, temporarily large accumulations of nitrates are not observed in the summer and autumn vegetative cycles. In addition, and of great importance for the nutritional quality of the harvested produce, the gross protein contents are much higher (around 50%) at the end of the cycle for an equal quantity of nitrogen supplied during fertilization. Soluble organic nitrogen compounds, amino acids and amides, are also found in greater quantities. (author) [French] La connaissance des repercussions de la fertilisation azotee sur la qualite vegetale semble primordiale dans l'etude des liaisons plante-animal. L'auteur a examine sur un dispositif experimental situe dans le Centre-Est de la France les variations de la composition des parties aeriennes d'un Dactyle Floreal soumis a des

  15. Characteristics of voltage regulators with serial NPN transistor in the fields of medium and high energy photons

    International Nuclear Information System (INIS)

    Vukic, V.; Osmokrovic, P.

    2007-01-01

    Variation of collector - emitter dropout voltage on serial transistors of voltage regulators LM2990T-5 and LT1086CT5 were used as the parameter for detection of examined devices' radiation hardness in X and ? radiation fields. Biased voltage regulators with serial super-β transistor in the medium dose rate X radiation field had significantly different response from devices with conventional serial NPN transistor. Although unbiased components suffered greater damage in most cases, complete device failure happened only among the biased components with serial super-β transistor in Bremsstrahlung field. Mechanisms of transistors degradation in ionizing radiation fields were analysed [sr

  16. Effect of dietary protein to energy ratio on growth and nitrogenous ...

    African Journals Online (AJOL)

    The effect of dietary protein to energy ratio (P:E) on the growth of dusky kob Argyrosomus japonicus was investigated as a first step towards formulating a practical diet for this potential mariculture species in South Africa. The effects of dietary protein and lipid on growth, feed conversion ratio (FCR) and nitrogenous waste ...

  17. Comparative changes in monthly blood urea nitrogen, total protein ...

    African Journals Online (AJOL)

    The objective of this study was to determine the comparative changes in the monthly blood urea nitrogen (BUN) concentration, total protein (TP) concentration in blood serum and the body condition score of Nguni cows and heifers raised on sweetveld. Twenty-four clinically healthy animals in different parities, namely Parity ...

  18. EFFECTS OF PROTEIN-XANTHOPHYLL (PX CONCENTRATE OF ALFALFA ADDITIVE TO CRUDE PROTEIN-REDUCED DIETS ON NITROGEN EXCRETION, GROWTH PERFORMANCE AND MEAT QUALITY OF PIGS

    Directory of Open Access Journals (Sweden)

    Eugeniusz GRELA

    2009-06-01

    Full Text Available The infl uence of protein-xanthophyll (PX concentrate of alfalfa supplement to crude protein-reduced diets was examined in relation to nitrogen excretion, performance parameters and pig meat quality. The investigations included 60 growers (PL x PLW x Duroc crossbreeds assigned to 3 groups. The conclusion is that there is a large potential to decrease nitrogen emission to the environment by 10% lowering of dietary crude protein intake along with reduced animal growth rate and elevated mixture utilization. Inclusion of a protein-xanthophyll concentrate (PX of alfalfa to the diet is likely to diminish disadvantageous productive parameters arising from limiting of total crude protein level in relation to the requirements of pigs feeding norms [1993]. At the same time, it improves feed nitrogen utilization and reduces noxious odour emissions from a piggery. The components of a protein-xanthophyll concentrate (PX contribute to increased liver and kidney weight.

  19. Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1.

    Science.gov (United States)

    Noindorf, Lilian; Bonatto, Ana C; Monteiro, Rose A; Souza, Emanuel M; Rigo, Liu U; Pedrosa, Fabio O; Steffens, Maria B R; Chubatsu, Leda S

    2011-01-11

    The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK), encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

  20. Rumen bypass nutrients: Manipulation and implications

    International Nuclear Information System (INIS)

    Leng, R.A.; Nolan, J.V.; Preston, T.R.

    1983-01-01

    The feeds available for ruminants in developing countries are either agro-industrial by-products or specially grown forage crops. Many of these feeds are low in protein and require supplementation with non-protein N (NPN) to maintain efficient rumen function and digestibility. The principles for utilizing high energy, low protein feeds by ruminants are discussed in relation to the supply of NPN, the establishment of efficient rumen function, maximizing feed intake by means of supplements, and increasing total energy and protein intake by using supplements which bypass the rumen. To illustrate it the application of these principles to feeding systems based on molasses, chopped whole sugar cane and derinded sugar cane is discussed. The implications of the principles in increasing the feeding value of straw are also discussed. (author)

  1. Protein as chemical cue: non-nutritional growth enhancement by exogenous protein in Pseudomonas putida KT2440.

    Directory of Open Access Journals (Sweden)

    Hiren Joshi

    Full Text Available Research pertaining to microbe-microbe and microbe-plant interactions has been largely limited to small molecules like quorum sensing chemicals. However, a few recent reports have indicated the role of complex molecules like proteins and polysaccharides in microbial communication. Here we demonstrate that exogenous proteins present in culture media can considerably accelerate the growth of Pseudomonas putida KT2440, even when such proteins are not internalized by the cells. The growth enhancement is observed when the exogenous protein is not used as a source of carbon or nitrogen. The data show non-specific nature of the protein inducing growth; growth enhancement was observed irrespective of the protein type. It is shown that growth enhancement is mediated via increased siderophore secretion in response to the exogenous protein, leading to better iron uptake. We highlight the ecological significance of the observation and hypothesize that exogenous proteins serve as chemical cues in the case of P.putida and are perceived as indicator of the presence of competitors in the environment. It is argued that enhanced siderophore secretion in response to exogenous protein helps P.putida establish numerical superiority over competitors by way of enhanced iron assimilation and quicker utilization of aromatic substrates.

  2. Non-Saccharomyces Yeasts Nitrogen Source Preferences: Impact on Sequential Fermentation and Wine Volatile Compounds Profile

    Directory of Open Access Journals (Sweden)

    Antoine Gobert

    2017-11-01

    Full Text Available Nitrogen sources in the must are important for yeast metabolism, growth, and performance, and wine volatile compounds profile. Yeast assimilable nitrogen (YAN deficiencies in grape must are one of the main causes of stuck and sluggish fermentation. The nitrogen requirement of Saccharomyces cerevisiae metabolism has been described in detail. However, the YAN preferences of non-Saccharomyces yeasts remain unknown despite their increasingly widespread use in winemaking. Furthermore, the impact of nitrogen consumption by non-Saccharomyces yeasts on YAN availability, alcoholic performance and volatile compounds production by S. cerevisiae in sequential fermentation has been little studied. With a view to improving the use of non-Saccharomyces yeasts in winemaking, we studied the use of amino acids and ammonium by three strains of non-Saccharomyces yeasts (Starmerella bacillaris, Metschnikowia pulcherrima, and Pichia membranifaciens in grape juice. We first determined which nitrogen sources were preferentially used by these yeasts in pure cultures at 28 and 20°C (because few data are available. We then carried out sequential fermentations at 20°C with S. cerevisiae, to assess the impact of the non-Saccharomyces yeasts on the availability of assimilable nitrogen for S. cerevisiae. Finally, 22 volatile compounds were quantified in sequential fermentation and their levels compared with those in pure cultures of S. cerevisiae. We report here, for the first time, that non-Saccharomyces yeasts have specific amino-acid consumption profiles. Histidine, methionine, threonine, and tyrosine were not consumed by S. bacillaris, aspartic acid was assimilated very slowly by M. pulcherrima, and glutamine was not assimilated by P. membranifaciens. By contrast, cysteine appeared to be a preferred nitrogen source for all non-Saccharomyces yeasts. In sequential fermentation, these specific profiles of amino-acid consumption by non-Saccharomyces yeasts may account for

  3. Non-Saccharomyces Yeasts Nitrogen Source Preferences: Impact on Sequential Fermentation and Wine Volatile Compounds Profile

    Science.gov (United States)

    Gobert, Antoine; Tourdot-Maréchal, Raphaëlle; Morge, Christophe; Sparrow, Céline; Liu, Youzhong; Quintanilla-Casas, Beatriz; Vichi, Stefania; Alexandre, Hervé

    2017-01-01

    Nitrogen sources in the must are important for yeast metabolism, growth, and performance, and wine volatile compounds profile. Yeast assimilable nitrogen (YAN) deficiencies in grape must are one of the main causes of stuck and sluggish fermentation. The nitrogen requirement of Saccharomyces cerevisiae metabolism has been described in detail. However, the YAN preferences of non-Saccharomyces yeasts remain unknown despite their increasingly widespread use in winemaking. Furthermore, the impact of nitrogen consumption by non-Saccharomyces yeasts on YAN availability, alcoholic performance and volatile compounds production by S. cerevisiae in sequential fermentation has been little studied. With a view to improving the use of non-Saccharomyces yeasts in winemaking, we studied the use of amino acids and ammonium by three strains of non-Saccharomyces yeasts (Starmerella bacillaris, Metschnikowia pulcherrima, and Pichia membranifaciens) in grape juice. We first determined which nitrogen sources were preferentially used by these yeasts in pure cultures at 28 and 20°C (because few data are available). We then carried out sequential fermentations at 20°C with S. cerevisiae, to assess the impact of the non-Saccharomyces yeasts on the availability of assimilable nitrogen for S. cerevisiae. Finally, 22 volatile compounds were quantified in sequential fermentation and their levels compared with those in pure cultures of S. cerevisiae. We report here, for the first time, that non-Saccharomyces yeasts have specific amino-acid consumption profiles. Histidine, methionine, threonine, and tyrosine were not consumed by S. bacillaris, aspartic acid was assimilated very slowly by M. pulcherrima, and glutamine was not assimilated by P. membranifaciens. By contrast, cysteine appeared to be a preferred nitrogen source for all non-Saccharomyces yeasts. In sequential fermentation, these specific profiles of amino-acid consumption by non-Saccharomyces yeasts may account for some of the

  4. Kinetics of dietary nitrogen utilization in cattle and buffaloes fed diets containing NPN salts, using15N as an isotopic tracer

    International Nuclear Information System (INIS)

    Dhiman, T.R.; Arora, S.P.

    1990-01-01

    Nitrogen kinetics was compared in cow and buffalo calves (4 groups). Groups 1 and 3 were fed basal diet supplemented with urea (test diet 1) and group 2 and 4 were fed basal diet supplemented with urea plus ammonium sulphate (test diet 2). Dietary nitrogen metabolized to ammonia in the rumen was 50, 46, 40 and 37% in groups 1 through 4 respectively. Of the total dietary nitrogen, 67-70% was apparently digested in reticulorumen, of which 27, 34, 40 and 48% was used as amino acids and peptides, and the remainder 73, 66, 60 and 52% was degraded to ammonia in groups 1 through 4 respectively. On an average, 65% of the ammonia produced was irreversibly lost and 35% was recycled. Of the ruminal ammonia produced 21% was recycled within nitrogen pools. Higher incorporation of ruminal 15 NH 3 into suspended bacterial-N was observed in test diet 2 as compared to that in test diet 1. Per cent plasma urea-N and urinary-N derived from ruminal ammonia decreased in test diet 2 as compared to that in test diet 1. Better utilization of nitrogen from urea plus ammonium sulphate diets was thus ascribed to additional sulphur availability from ammonium sulphate and proper N : S ratio. (author). 5 tabs., 9 refs

  5. Failure of carnitine in improving hepatic nitrogen content in alcoholic and non-alcoholic malnourished rats

    Directory of Open Access Journals (Sweden)

    Luciana P. Rodrigues

    2010-01-01

    Full Text Available AIMS: To investigate the effect of carnitine supplementation on alcoholic malnourished rats' hepatic nitrogen content. METHODS: Malnourished rats, on 50% protein-calorie restriction with free access to water (malnutrition group and malnourished rats under the same conditions with free access to a 20% alcohol/water solution (alcohol group were studied. After the undernourishment period (4 weeks with or without alcohol, both groups were randomly divided into two subgroups, one of them nutritionally recovered for 28 days with free access to a normal diet and water (recovery groups and the other re-fed with free access to diet and water plus carnitine (0.1 g/g body weight/day by gavage (carnitine groups. No alcohol intake was allowed during the recovery period. RESULTS: The results showed: i no difference between the alcohol/no alcohol groups, with or without carnitine, regarding body weight gain, diet consumption, urinary nitrogen excretion, plasma free fatty acids, lysine, methionine, and glycine. ii Liver nitrogen content was highest in the carnitine recovery non-alcoholic group (from 1.7 to 3.3 g/100 g, P.05 was highest in the alcoholic animals. CONCLUSION: Carnitine supplementation did not induce better nutritional recovery.

  6. Non-Protein Coding RNAs

    CERN Document Server

    Walter, Nils G; Batey, Robert T

    2009-01-01

    This book assembles chapters from experts in the Biophysics of RNA to provide a broadly accessible snapshot of the current status of this rapidly expanding field. The 2006 Nobel Prize in Physiology or Medicine was awarded to the discoverers of RNA interference, highlighting just one example of a large number of non-protein coding RNAs. Because non-protein coding RNAs outnumber protein coding genes in mammals and other higher eukaryotes, it is now thought that the complexity of organisms is correlated with the fraction of their genome that encodes non-protein coding RNAs. Essential biological processes as diverse as cell differentiation, suppression of infecting viruses and parasitic transposons, higher-level organization of eukaryotic chromosomes, and gene expression itself are found to largely be directed by non-protein coding RNAs. The biophysical study of these RNAs employs X-ray crystallography, NMR, ensemble and single molecule fluorescence spectroscopy, optical tweezers, cryo-electron microscopy, and ot...

  7. Seed protein and nitrogen fixation in chickpea mutant variety Hyprosola

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, H E; Gibson, A H; Oram, R N [CSIRO, Division of Plant Industry, Canberra ACT (Australia); Shaikh, M A.Q. [Bangladesh Institute of Nuclear Agriculture, Mymensingh (Bangladesh)

    1989-01-01

    Full text: 'Hyprosola' is a high yielding, high protein mutant cultivar obtained after gamma irradiation from the variety 'Faridpur-1'. The mutant yields 45 % more protein per unit area. The essential amino acid index is unchanged. It is likely that the high nutritional value in 'Hyprosola' seed protein arises from an increase in the albumin:globulin ratio. Nitrogen fixation rates of the mutant during the first 7 weeks of growth were found to be similar to 'Faridpur-1'. Under field conditions, the mutant may be able to nodulate more rapidly and more extensively than the parent variety. (author)

  8. A nitrogen response pathway regulates virulence functions in Fusarium oxysporum via the protein kinase TOR and the bZIP protein MeaB.

    Science.gov (United States)

    López-Berges, Manuel S; Rispail, Nicolas; Prados-Rosales, Rafael C; Di Pietro, Antonio

    2010-07-01

    During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine sulfoximine or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR, respectively. Deletion of the bZIP protein MeaB also resulted in nitrogen source-independent activation of virulence mechanisms. Activation of these functions did not require the global nitrogen regulator AreA, suggesting that MeaB-mediated repression of virulence functions does not act through inhibition of AreA. Tomato plants (Solanum lycopersicum) supplied with ammonium rather than nitrate showed a significant reduction in vascular wilt symptoms when infected with the wild type but not with the DeltameaB strain. Nitrogen source also affected invasive growth in the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. We propose that a conserved nitrogen-responsive pathway might operate via TOR and MeaB to control virulence in plant pathogenic fungi.

  9. Electrical characterization of commercial NPN bipolar junction transistors under neutron and gamma irradiation

    Directory of Open Access Journals (Sweden)

    OO Myo Min

    2014-01-01

    Full Text Available Electronics components such as bipolar junction transistors, diodes, etc. which are used in deep space mission are required to be tolerant to extensive exposure to energetic neutrons and ionizing radiation. This paper examines neutron radiation with pneumatic transfer system of TRIGA Mark-II reactor at the Malaysian Nuclear Agency. The effects of the gamma radiation from Co-60 on silicon NPN bipolar junction transistors is also be examined. Analyses on irradiated transistors were performed in terms of the electrical characteristics such as current gain, collector current and base current. Experimental results showed that the current gain on the devices degraded significantly after neutron and gamma radiations. Neutron radiation can cause displacement damage in the bulk layer of the transistor structure and gamma radiation can induce ionizing damage in the oxide layer of emitter-base depletion layer. The current gain degradation is believed to be governed by the increasing recombination current in the base-emitter depletion region.

  10. Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1

    Directory of Open Access Journals (Sweden)

    Steffens Maria BR

    2011-01-01

    Full Text Available Abstract Background The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK, encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. Results In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Conclusions Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

  11. Anaerobic Nitrogen Fixers on Mars

    Science.gov (United States)

    Lewis, B. G.

    2000-07-01

    The conversion of atmospheric nitrogen gas to the protein of living systems is an amazing process of nature. The first step in the process is biological nitrogen fixation, the transformation of N2 to NH3. The phenomenon is crucial for feeding the billions of our species on Earth. On Mars, the same process may allow us to discover how life can adapt to a hostile environment, and render it habitable. Hostile environments also exist on Earth. For example, nothing grows in coal refuse piles due to the oxidation of pyrite and marcasite to sulfuric acid. Yet, when the acidity is neutralized, alfalfa and soybean plants develop root nodules typical of symbiotic nitrogen fixation with Rhizobium species possibly living in the pyritic material. When split open, these nodules exhibited the pinkish color of leghemoglobin, a protein in the nodule protecting the active nitrogen-fixing enzyme nitrogenase against the toxic effects of oxygen. Although we have not yet obtained direct evidence of nitrogenase activity in these nodules (reduction of acetylene to ethylene, for example), these findings suggested the possibility that nitrogen fixation was taking place in this hostile, non-soil material. This immediately raises the possibility that freeliving anaerobic bacteria which fix atmospheric nitrogen on Earth, could do the same on Mars.

  12. The effects of calcium regulation of endosperm reserve protein ...

    African Journals Online (AJOL)

    The effects of steep liquor calcium ion on sorghum endosperm reserve protein mobilization were evaluated using two improved Nigeria sorghum cultivars (ICSV 400 and KSV 8). The key protein modification factors evaluated were free amino nitrogen (FAN), total non protein nitrogen (TNPN) and soluble protein of cold water ...

  13. Non-equilibrium nitrogen DC-arc plasma treatment of TiO2 nanopowder.

    Science.gov (United States)

    Suzuki, Yoshikazu; Gonzalez-Aguilar, José; Traisnel, Noel; Berger, Marie-Hélène; Repoux, Monique; Fulcheri, Laurent

    2009-01-01

    Non-equilibrium nitrogen DC-arc plasma treatment of a commercial TiO2 anatase nanopowder was examined to obtain nitrogen-doped TiO2. By using a non-thermal discharge at low current (150 mA) and high voltage (1200 V) using pure N2 gas, light yellowish-gray TiO2 powder was successfully obtained within a short period of 5-10 min. XPS and TEM-EELS studies confirmed the existence of doped nitrogen. Due to the relatively mild conditions (plasma power of 180 W), metastable anatase structure and fine crystallite size of TiO2 (ca. 10 nm) were maintained after the plasma treatment. The in-flight powder treatment system used in this study is promising for various type of powder treatment.

  14. Alignment of non-covalent interactions at protein-protein interfaces.

    Directory of Open Access Journals (Sweden)

    Hongbo Zhu

    Full Text Available BACKGROUND: The study and comparison of protein-protein interfaces is essential for the understanding of the mechanisms of interaction between proteins. While there are many methods for comparing protein structures and protein binding sites, so far no methods have been reported for comparing the geometry of non-covalent interactions occurring at protein-protein interfaces. METHODOLOGY/PRINCIPAL FINDINGS: Here we present a method for aligning non-covalent interactions between different protein-protein interfaces. The method aligns the vector representations of van der Waals interactions and hydrogen bonds based on their geometry. The method has been applied to a dataset which comprises a variety of protein-protein interfaces. The alignments are consistent to a large extent with the results obtained using two other complementary approaches. In addition, we apply the method to three examples of protein mimicry. The method successfully aligns respective interfaces and allows for recognizing conserved interface regions. CONCLUSIONS/SIGNIFICANCE: The Galinter method has been validated in the comparison of interfaces in which homologous subunits are involved, including cases of mimicry. The method is also applicable to comparing interfaces involving non-peptidic compounds. Galinter assists users in identifying local interface regions with similar patterns of non-covalent interactions. This is particularly relevant to the investigation of the molecular basis of interaction mimicry.

  15. Effects of the source of energy and minerals on microbial protein synthesis in rumen using 35S as indicator. Part of a coordinated programme on tracer techniques in studies on the use of non-protein nitrogen in ruminants

    International Nuclear Information System (INIS)

    Durant, M.

    1976-05-01

    Part I. The effect of the nature of carbohydrates and minerals on microbial growth in vitro was studied in vitro to intensify rumen microbial protein synthesis from non-protein nitrogen, using phosphorus incorporation (PR). The nature of starch greatly influences urea utilization. Among the tropical tubers studied, yam Cayenesis and canna Edulis give lower urea utilization than cassava and yam Dumetorum. However, this can be improved by processing. The effects are greatest when the proportion of urea to processed cereal is ca. 4-5%. S-addition as sulfate improves urea utilization with both natural and purified diets. Part II. Results from the Jouy and Ghent laboratories were analyzed statistically, to check the accuracy of the 32 P method for estimating microbial growth, using protein-free substrates. The linear relationship between PR and every other variable was studied. Two multivariate analyses, principal components and multiple regression, were applied. Net NH 3 utilization was predicted using the equations for substrates with proteins likely to be degraded. This method appears more accurate than using the N/P ratio in microflora. Equations should only be used under the specific experiments described

  16. Fast turn-off of high voltage 4H–SiC npn BJTs from the saturation on-state regime

    International Nuclear Information System (INIS)

    Ivanov, P A; Levinshtein, M E; Palmour, J W; Agarwal, A K; Zhang, J

    2010-01-01

    Fast turn-off of high-voltage (breakdown voltage ≥ 3 kV) 4H–SiC npn bipolar junction transistors driven in a deeply saturated regime has been reported. In the conventional turn-off mode (base current break), the turn-off delay and current fall times are 80 ns and 100 ns, respectively. It is shown that these times can be made as short as 20 and 4 ns, respectively, if a reverse base current pulse of appropriate amplitude is applied to sweep out minority carriers from the base. The experimental values of delay and turn-off times well coincide with those calculated in terms of the charge control model

  17. Nitrogen balance, microbial protein synthesis and blood metabolites in fattening of male Bali cattle fed ration with different protein levels in smallholder farms

    Directory of Open Access Journals (Sweden)

    P. K. Tahuk

    2018-03-01

    Full Text Available Research was aimed to determine nitrogen balance, microbial protein synthesis, and blood metabolites of male Bali cattle fattening fed ration with different protein level in smallholder farms North Central Timor, Province of East Timor Tenggara, Indonesia. The cattle used were 18 heads aged 2 to 2.5 years with initial body weight of 229.86±12.46 kg. The cattle were randomly divided into three treatment groups. The T0 group was given feed the same as traditional fattening cattle practices by farmers,T1 group fed ration containing 12% crude protein (CP and 72% total digestible nutrients (TDN, andT2 group fedration containing 15% CP and 72%TDN. Cattle were fed individually for 90 days and drinkingwater ad libitum. The data were analyzedby analysis of variance.Results of research indicated the nitrogen balance, and blood urea nitrogen between T1 and T2 were relatively similar, but those were higher (P<0.05 than T0 . In contrast, microbial proteins synthesis, and blood glucose at 0, 4, and 6 hours before and after feeding were relatively similar between the groups. Blood glucose of T2 at 2 hours after intake were higher (P <0.05 than T0, but was not different with T1 . It can be concluded, that the fattening maleBali cattle fed ration containing 12% CP and 72% TDNimprovedthe nitrogen balance and blood metabolites, butit was no positive effect on the microbial proteins and N synthesis.

  18. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    Energy Technology Data Exchange (ETDEWEB)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C., E-mail: kdas@engr.uga.edu [College of Engineering, The University of Georgia, Athens, GA (United States); Forsberg, Lennart S.; Azadi, Parastoo [Complex Carbohydrate Research Center, The University of Georgia, Athens, GA (United States)

    2015-06-23

    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

  19. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    International Nuclear Information System (INIS)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C.; Forsberg, Lennart S.; Azadi, Parastoo

    2015-01-01

    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

  20. Plant Proteins and Synthetic Amino Acids in the Nutrition of Non-Ruminants

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, D. [Department of Applied Biochemistry and Nutrition, University Of Nottingham, Nottingham (United Kingdom)

    1968-07-01

    It is to be emphasized that in formulating diets for farm animals other than ruminants it is important to meet the requirements for individual essential amino acids and not merely to give regard to over-ail protein quality. The protein component serves to meet the needs for essential amino acids and also supplies material to synthesize those amino acids that are individually dispensable. In arranging for efficient formulation it is important to have available amino acid requirement standards to meet a particular production objective and data on the quantity of amino acids supplied by the various ingredients available. In considering the amino acid content of ingredients it is important to pay due regard to the problems of availability. Efforts to define amino acid requirements for the pig and chick have given somewhat variable results: it is possible to account for some of this variability. It is recognized that under certain circumstances non-amino nitrogen can be utilized by such species as the chick and the pig. The mechanisms involved are briefly considered. Some experimental work has shown that non-amino nitrogen can support growth, but it is difficult to establish a situation in which the non-essential amino acid levels are sufficiently low to take advantage of this fact. Extensive use of synthetic essential amino acids could change this situation. The case for the use of synthetic amino acids in the diets of farm animals is essentially an economic one. It is no longer necessary to demonstrate that free dietary amino acids can meet the needs of the animal. The only question is whether the needs of the animal are more effectively met by the addition of amino acids or more intact protein. The place of alternative protein sources to such attractive commodities as fish meal or soyabean meal must be considered in terms of amino acid supply. Whilst synthetic methionine and lysine are available there is a developing case for the use of such products as sunflower

  1. A Nitrogen Response Pathway Regulates Virulence Functions in Fusarium oxysporum via the Protein Kinase TOR and the bZIP Protein MeaB[C][W

    Science.gov (United States)

    López-Berges, Manuel S.; Rispail, Nicolas; Prados-Rosales, Rafael C.; Di Pietro, Antonio

    2010-01-01

    During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine sulfoximine or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR, respectively. Deletion of the bZIP protein MeaB also resulted in nitrogen source–independent activation of virulence mechanisms. Activation of these functions did not require the global nitrogen regulator AreA, suggesting that MeaB-mediated repression of virulence functions does not act through inhibition of AreA. Tomato plants (Solanum lycopersicum) supplied with ammonium rather than nitrate showed a significant reduction in vascular wilt symptoms when infected with the wild type but not with the ΔmeaB strain. Nitrogen source also affected invasive growth in the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. We propose that a conserved nitrogen-responsive pathway might operate via TOR and MeaB to control virulence in plant pathogenic fungi. PMID:20639450

  2. Nitrogen 15 abundance in protein fractions of beans fertilized with ({sup 15}NH{sub 4}){sub 2}SO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Chaud, Saula Goulart; Oliveira, Admar Costa de [Universidade Estadual de Campinas, SP (Brazil). Faculdade de Estudos Agricolas. Dept. de Planejamento Alimentar e Nutricao; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis]. E-mail: admarco@fea.unicamp.br

    2002-12-01

    Studies evaluating the protein nutritive value of beans labelled with 15 N, using nitrogen balance and the quantitation of faecal and urinary endogenous nitrogen, determined by isotopic dilution, have been extensively used. The objective of this research was to verify if the isotopic labelling of raw, freeze dried beans (Phaseolus vulgaris L., cultivar Pirata 1) with 1.394 atoms % 15 N, resulted in the same abundance of the whole flour and of the protein fractions extracted from the beans with 0.5 mol L{sup -1} NaCl. The isotopic abundance found in the whole bean flour, in the protein extract, in the globulin and albumin fractions were respectively: 1.394 +- 0.011; 1.403 +- 0.012; 1.399 +- 0.007 and 1.399 +- 0.028 atoms % of 15 N, presenting no difference (P > 0.05). However, a difference was found (P < 0.05) between the above mentioned abundances and the isotopic abundance found in the nitrogen of the proteins in the extraction residue, which was 0.969 +- 0.084. Since the abundances did not differ, the protein nutritive indexes, such as digestibility and biological value, determined from the nitrogen balance and corrected for isotopic dilution, would not be affected by extracting the proteins from the beans with 0.5 mol L 1 NaCl. If working with the nitrogen balance of the residual proteins after extraction and even with the whole flours, these indexes could present incorrect values, since the isotopic labelling of the residual proteins was less than that of the protein fractions. (author)

  3. Dual purpose wheat production with different levels of nitrogen topdressing

    Directory of Open Access Journals (Sweden)

    Éderson Luis Henz

    2016-04-01

    Full Text Available Currently, the practice of Crop-Livestock Integration is stimulated as a way of increasing the generation of foreign exchange for Brazil. Integrated systems improve land use efficiency as well as preserve, recover and increment or soil fertility. The aim of this research was to evaluate how different doses of nitrogen fertilization can affect production and quality of dual purpose wheat submitted to grazing. The experimental designed was randomized block with five treatments (0, 75, 150, 225 and 300 Kg N ha-1, like ammonium nitrate and four repetitions. The forage yield, the percentage crude protein (P=.0001 and acid detergent insoluble protein (P=.0054 had a linear increased because of the nitrogen addition doses. The crude protein percentage changed the estimate of all soluble carbohydrates (P=.0001 and non-fibrous carbohydrates (P=.0186, but did not influence the, nitrogen detergent fiber corrected with ash and proteins percentage contributing for content cell. The crops production (P=.0001 and the number of kernels per ear (P=.0001 showed significantly difference because of the nitrogen additions dose, increasing the number of fertile flowers. The nitrogen topdressing alters forage production, the chemical composition and the production of dual purpose wheat grains subjected to grazing.

  4. Nitrogen balance and milk composition of dairy cows fed urea and soybean meal and two protein levels using sugar cane based diets

    Directory of Open Access Journals (Sweden)

    Luís Henrique Andreucci Conti

    2014-12-01

    Full Text Available The aim of the study was to evaluate the effect of feeding two levels of crude protein (CP (low: 142 g CP/kg DM; and high: 156 g CP/kg DM and two nitrogen sources (soybean meal and urea to dairy cows using sugar cane as forage on microbial protein synthesis, the composition of the milk nitrogen fraction, nitrogen (N balance and blood parameters. Twelve Holstein cows with an average milk yield of 22.0 ± 2.3 kg/day, and with 235 ± 40 days in milk were included in this study. The animals were grouped into three balanced and contemporary 4x4 Latin squares for an experimental period of 21 days. On the 15th day of each period, milk and urine samples were collected for microbial protein synthesis determination. Total excretion of urine (L/day, milk urea nitrogen (MUN and blood urea were higher for the diets with high CP, regardless of the nitrogen source. Nitrogen efficiency was higher for cows fed diets with low CP. Cows in the final third of lactation can be fed diets with reduced CP levels, regardless of the nitrogen source, soybean meal or urea, without influencing the synthesis of microbial protein or the composition of the nitrogen fraction of milk.

  5. Project in determination of crystal structure of nitrogen fixation proteins from azospirilum brasiliense and herbaspirilum seropedicae by synchrotron x-ray diffraction

    International Nuclear Information System (INIS)

    Barbosa, Valma M.; Leggs, Luciana A.; Delboni, Luis F.; Chubatsu, LedaS.; Souza, Emanuel M.; Machado, Hidevaldo B.; Yates, Geoffrey M.; Pedrosa, Fabio O.

    1996-01-01

    Full text. Biological nitrogen fixation is essential for maintaining the nitrogen cycle on earth and of high importance for Brazilian agriculture. The nitrogenase enzyme system, which provides the biochemical machinery for nitrogen fixation, consists of two component metalloproteins, the molybdenumiron (Mo Fe) protein and the iron (Fe) protein. Nitrogen fixation is a very energy-intensive process, requiring around 16 moles of ATP for each mol of N 2 fixed (reduced). As a consequence, synthesis and activity of nitrogenase is tighty regulated at two levels: general and specific. The general level regulation is mediated by the ntr (nitrogen regulation) system. Two gene products are involved: the ntrB gene product (NtrB) is responsible for the activation of the ntrC gene product (NtrC) by phosphorylating a conserved Asp54, which activates the expression of the nifA gene. The nif specific control system is mediated by the NifA protein, which binds to a DNA specific sequence (UAS, Upstream Activator Sequence) and activates nif promoter transcriptions by RNA polymerase- α54 , following ATP hydrolysis. The aim of this project is to solve the crystal structure of dinitrogenase reductase (iron protein) and dinitrogenase (molybdenum-iron protein) from Azospirilim brasiliense and the regulatory proteins NifA from Herbaspirillum seropedicae and NtrC Azospirillum brasiliense. The three dimensional structure of the proteins involved in this project will allow a better understanding of the mechanism of biological nitrogen fixation. To this end, the data collection will probably be done at the LNLS facilities which will be available in the near future. (author)

  6. Project in determination of crystal structure of nitrogen fixation proteins from azospirilum brasiliense and herbaspirilum seropedicae by synchrotron x-ray diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Barbosa, Valma M.; Leggs, Luciana A.; Delboni, Luis F.; Chubatsu, LedaS.; Souza, Emanuel M.; Machado, Hidevaldo B.; Yates, Geoffrey M.; Pedrosa, Fabio O. [Parana Univ., Curitiba, PR (Brazil). Dept. de Bioquimica

    1996-12-31

    Full text. Biological nitrogen fixation is essential for maintaining the nitrogen cycle on earth and of high importance for Brazilian agriculture. The nitrogenase enzyme system, which provides the biochemical machinery for nitrogen fixation, consists of two component metalloproteins, the molybdenumiron (Mo Fe) protein and the iron (Fe) protein. Nitrogen fixation is a very energy-intensive process, requiring around 16 moles of ATP for each mol of N{sub 2} fixed (reduced). As a consequence, synthesis and activity of nitrogenase is tighty regulated at two levels: general and specific. The general level regulation is mediated by the ntr (nitrogen regulation) system. Two gene products are involved: the ntrB gene product (NtrB) is responsible for the activation of the ntrC gene product (NtrC) by phosphorylating a conserved Asp54, which activates the expression of the nifA gene. The nif specific control system is mediated by the NifA protein, which binds to a DNA specific sequence (UAS, Upstream Activator Sequence) and activates nif promoter transcriptions by RNA polymerase-{sup {alpha}54}, following ATP hydrolysis. The aim of this project is to solve the crystal structure of dinitrogenase reductase (iron protein) and dinitrogenase (molybdenum-iron protein) from Azospirilim brasiliense and the regulatory proteins NifA from Herbaspirillum seropedicae and NtrC Azospirillum brasiliense. The three dimensional structure of the proteins involved in this project will allow a better understanding of the mechanism of biological nitrogen fixation. To this end, the data collection will probably be done at the LNLS facilities which will be available in the near future. (author)

  7. Proximate composition of marine invertebrates from tropical coastal waters, with emphasis on the relationship between nitrogen and protein contents

    Directory of Open Access Journals (Sweden)

    Graciela S Diniz

    2014-05-01

    Full Text Available The chemical profiles of Desmapsamma anchorata, Hymeniacidon heliophila (Porifera, Bunodosoma caissarum, Renilla muelleri (Cnidaria, Aplysia brasiliana, Eledone massyae, Isognomon bicolor (Mollusca, Echinaster brasiliensis, Echinometra lucunter, Holothuria grisea, Lytechinus variegatus (Echinodermata, and Phallusia nigra (Chordata were determined. Hydrosoluble protein was the most abundant class of substances for all species, except for the ascidian Phallusia nigra, in which the carbohydrate content was higher. The percentages of hydrosoluble protein (dry weight, dw varied widely among the invertebrates, ranging from 5.88% (R. muelleri to 47.6% (Eledone massyae of the dw .The carbohydrate content fluctuated from 1.3% (R. muelleri to 18.4% (Aplysia brasiliana of the dw. For most of the species, lipid was the second most abundant class of substances, varying from 2.8% (R. muelleri to 25.3% (Echinaster brasiliensis of the dw. Wide variations were also found for the invertebrates nitrogen content, with the lowest value recorded in the cnidarian R. muelleri (2.02% of the dw and the highest in the molluscan E. massyae (12.7% of the dw. The phosphorus content of the dw varyed from 0.24% (R. muelleri to 1.16% (E. massyae. The amino acid composition varied largely among the species, but for most of the species glycine, arginine, glutamic acid, and aspartic acid were the most abundant amino acids, with histidine and tyrosine among the less abundant amino acids. The actual content of total protein in the samples was calculated by the sum of amino acid residues, establishing dw values that fluctuated from 11.1% (R. muelleri to 66.7% (E. massyae. The proteinaceous nitrogen content was high in all species, with an average value of 97.3% of the total nitrogen. From data of total amino acid residues and total nitrogen, specific nitrogen-to-protein conversion factors were calculated for each species. The nitrogen-to-protein conversion factors ranged from 5.10 to

  8. Effect of gamma radiation on the nitrogen metabolism of Paecilomyces Violacea

    International Nuclear Information System (INIS)

    Salama, A.H.; Nadia, M.; Elzawahry, Y.A.; Abo Elkhair, I.A.

    1989-01-01

    Quantitative variabilities could be noticed in the nitrogen utilization and mycelial content of mats arising from gamma irradiated and non-irradiated Inocula of P.Violacea. The two lowest doses, 0.1 and 0.25 KGy, showed an increase in nitrate uptake and nitrogen utilization more than control by 7.43 and 15.61% for nitrate uptake and 8.33 and 14.89 for nitrogen utilization respectively, while the higher doses (0.5 up to 3.0 KGy) were inhibitory to the above parameters and also to protein synthesis. The chemical changes in the composition of fungal mats reveal that the peptide-N was the highest in amount as compared with the other nitrogen fractions. The protein-N was second in rank of quantity followed by the amino-N, while the nitrate-N was the least in amount compared to other nitrogen fractions at all radiation treatments

  9. Binding of a fluorescence reporter and a ligand to an odorant-binding protein of the yellow fever mosquito, Aedes aegypti [v2; ref status: indexed, http://f1000r.es/4yp

    Directory of Open Access Journals (Sweden)

    Gabriel M. Leal

    2015-01-01

    Full Text Available Odorant-binding proteins (OBPs, also named pheromone-binding proteins when the odorant is a pheromone, are essential for insect olfaction. They solubilize odorants that reach the port of entry of the olfactory system, the pore tubules in antennae and other olfactory appendages. Then, OBPs transport these hydrophobic compounds through an aqueous sensillar lymph to receptors embedded on dendritic membranes of olfactory receptor neurons. Structures of OBPs from mosquito species have shed new light on the mechanism of transport, although there is considerable debate on how they deliver odorant to receptors. An OBP from the southern house mosquito, Culex quinquefasciatus, binds the hydrophobic moiety of a mosquito oviposition pheromone (MOP on the edge of its binding cavity. Likewise, it has been demonstrated that the orthologous protein from the malaria mosquito binds the insect repellent DEET on a similar edge of its binding pocket. A high school research project was aimed at testing whether the orthologous protein from the yellow fever mosquito, AaegOBP1, binds DEET and other insect repellents, and MOP was used as a positive control. Binding assays using the fluorescence reporter N-phenyl-1-naphtylamine (NPN were inconclusive. However, titration of NPN fluorescence emission in AaegOBP1 solution with MOP led to unexpected and intriguing results. Quenching was observed in the initial phase of titration, but addition of higher doses of MOP led to a stepwise increase in fluorescence emission coupled with a blue shift, which can be explained at least in part by formation of MOP micelles to house stray NPN molecules.

  10. Full protein alimentation and nitrogen equilibrium in a renal failure patient treated with continuous hemodiafiltration: a case report of 67 days of continuous hemodiafiltration.

    Science.gov (United States)

    Reynolds, H N; Borg, U; Frankenfield, D

    1992-01-01

    Standard care for patients with renal failure while in an intensive care unit involves traditional hemodialysis or peritoneal dialysis and protein restriction. We present a case of a patient with renal failure supported with continuous arteriovenous hemofiltration with dialysis (CAVH-D) who was given full protein alimentation. Total daily urea clearance was measured from the CAVH-D output. Protein load was 196 +/- 34 g/day while receiving total parenteral nutrition and 164 +/- 30 g/day while receiving enteral alimentation. Serum blood urea nitrogen was controlled between 40 and 75 mg/dL, except during septic episodes. Nitrogen balance was estimated based upon known alimentation protein load and measurable and estimated nitrogenous losses. The patient was potentially in nitrogen equilibrium during most of the dialysis period. The cumulative nitrogen balance was positive by 5.2 g after 67 days of dialysis. Volume of alimentation was 3.49 +/- 0.7 liters/day. With CAVH-D, the renal failure patient can receive full alimentation without volume or protein load limitations. Furthermore, nitrogen balances can be estimated easily while the patient is on CAVH-D.

  11. Beijerinckia derxii stimulates the viability of non-N2-fixing bacteria in nitrogen-free media

    Directory of Open Access Journals (Sweden)

    Barbosa Heloiza R.

    2000-01-01

    Full Text Available The interactions between the nitrogen-fixing microorganism Beijerinckia derxii with two non-diazotrophic bacteria, either Escherichia coli or a facultative sulphur-oxidizing chemolitotroph, were studied in mixed cultures. Direct and indirect contact between B. derxii and E. coli were tested. B. derxii increased CFU numbers and/or maintained the viability of the non-diazotrophic bacteria, but neither growth nor nitrogenase activity of the nitrogen-fixing bacterium were affected by either partner.

  12. Yellow berry, protein and agronomic characteristics in bread wheat under different conditions of nitrogen and irrigation in northwest mexico

    International Nuclear Information System (INIS)

    Felix, F.R.; Wong, B.R.; Chavez, P.I.T.; Alviles, A.; Salazar, S.M.; Martinez, M.E.R

    2014-01-01

    The aim of this research was to determine the effect of the amount of nitrogen fertilizer and number of irrigations on the YB disorder of wheat cultivar Tarachi, as well as its relationship with protein content, and the agronomic characteristics. The experiment was conducted in northwestern Mexico, during the fall-winter season, 2009-2010. Three levels of nitrogen (75, 150 or 250 kg ha-1) and three levels of irrigation (3, 4 or 5 irrigations) were studied. Increasing the nitrogen rate decreased the YB content, the thousand kernel weight and hectoliter weight; and increased the protein content and the number of grains per spike. The number of irrigations did not affect the number of grains per spike. However, increasing the number of irrigations increased the YB content, the thousand kernel weight and hectoliter weight; on the other hand, the protein content decreased. A negative correlation between protein content and percentage of YB was presented. It was concluded that the presence of the disorder YB in bread wheat, Tarachi, is due to a low nitrogen rate in the soil and an increase in number of irrigations. (author)

  13. Determination of nitrogen absorption and endogenous nitrogen secretion in the digestive tract of pigs fed with nitrogen-15-labelled dried whey

    International Nuclear Information System (INIS)

    Gebhardt, G.; Souffrant, W.; Koehler, R.; Zebrowska, T.

    1977-01-01

    Two fistulated pigs weighing between 15kg and 54kg were given experimental diets containing 15 N-labelled dried whey. The labelled experimental diets were given once only. Samples of the digesta were taken from the duodenum and terminal ileum at various intervals of time up to 48h after feeding the labelled protein feed. The digesta were separated into the four following fractions: Residue on centrifugation, proteins, peptides and free amino acids. The secretion of endogenous nitrogen in the duodenum was 12.5g/24h in pigs having a live weight of 50kg. The endogenous nitrogen was found to be relatively uniformly distributed among the four fractions. The rate of secretion of endogenous nitrogen showed a continuous decrease during 24h. The secretion of endogenous nitrogen in the terminal ileum was 54 to 60mg of nitrogen per kilogram live weight. After passage through the small intestine the greater part of the free amino acids in digesta was of exogenous origin. In the protein fraction most came from endogenous proteins. A true absorption of 17% of nitrogen was determined in the duodenum. The amount of nitrogen absorbed in the terminal part of the small intestine was, on average, 90% relative to the nitrogen intake. The true digestibility calculated with the amount of 15 N in food and faeces was 98%. (author)

  14. Chasing after Non-cyanobacterial Nitrogen Fixation in Marine Pelagic Environments

    Directory of Open Access Journals (Sweden)

    Pia H. Moisander

    2017-09-01

    Full Text Available Traditionally, cyanobacterial activity in oceanic photic layers was considered responsible for the marine pelagic dinitrogen (N2 fixation. Other potentially N2-fixing bacteria and archaea have also been detected in the pelagic water column, however, the activity and importance of these non-cyanobacterial diazotrophs (NCDs remain poorly constrained. In this perspective we summarize the N2 fixation rates from recently published studies on photic and aphotic layers that have been attributed to NCD activity via parallel molecular measurements, and discuss the status, challenges, and data gaps in estimating non-cyanobacterial N2 fixation NCNF in the ocean. Rates attributed to NCNF have generally been near the detection limit thus far (<1 nmol N L−1 d−1. Yet, if considering the large volume of the dark ocean, even low rates of NCNF could make a significant contribution to the new nitrogen input to the ocean. The synthesis here shows that nifH transcription data for NCDs have been reported in only a few studies where N2 fixation rates were detected in the absence of diazotrophic cyanobacteria. In addition, high apparent diversity and regional variability in the NCDs complicate investigations of these communities. Future studies should focus on further investigating impacts of environmental drivers including oxygen, dissolved organic matter, and dissolved inorganic nitrogen on NCNF. Describing the ecology of NCDs and accurately measuring NCNF rates, are critical for a future evaluation of the contribution of NCNF to the marine nitrogen budget.

  15. [Nitrogen non-point source pollution identification based on ArcSWAT in Changle River].

    Science.gov (United States)

    Deng, Ou-Ping; Sun, Si-Yang; Lü, Jun

    2013-04-01

    The ArcSWAT (Soil and Water Assessment Tool) model was adopted for Non-point source (NPS) nitrogen pollution modeling and nitrogen source apportionment for the Changle River watershed, a typical agricultural watershed in Southeast China. Water quality and hydrological parameters were monitored, and the watershed natural conditions (including soil, climate, land use, etc) and pollution sources information were also investigated and collected for SWAT database. The ArcSWAT model was established in the Changle River after the calibrating and validating procedures of the model parameters. Based on the validated SWAT model, the contributions of different nitrogen sources to river TN loading were quantified, and spatial-temporal distributions of NPS nitrogen export to rivers were addressed. The results showed that in the Changle River watershed, Nitrogen fertilizer, nitrogen air deposition and nitrogen soil pool were the prominent pollution sources, which contributed 35%, 32% and 25% to the river TN loading, respectively. There were spatial-temporal variations in the critical sources for NPS TN export to the river. Natural sources, such as soil nitrogen pool and atmospheric nitrogen deposition, should be targeted as the critical sources for river TN pollution during the rainy seasons. Chemical nitrogen fertilizer application should be targeted as the critical sources for river TN pollution during the crop growing season. Chemical nitrogen fertilizer application, soil nitrogen pool and atmospheric nitrogen deposition were the main sources for TN exported from the garden plot, forest and residential land, respectively. However, they were the main sources for TN exported both from the upland and paddy field. These results revealed that NPS pollution controlling rules should focus on the spatio-temporal distribution of NPS pollution sources.

  16. [Multiple time scales analysis of spatial differentiation characteristics of non-point source nitrogen loss within watershed].

    Science.gov (United States)

    Liu, Mei-bing; Chen, Xing-wei; Chen, Ying

    2015-07-01

    Identification of the critical source areas of non-point source pollution is an important means to control the non-point source pollution within the watershed. In order to further reveal the impact of multiple time scales on the spatial differentiation characteristics of non-point source nitrogen loss, a SWAT model of Shanmei Reservoir watershed was developed. Based on the simulation of total nitrogen (TN) loss intensity of all 38 subbasins, spatial distribution characteristics of nitrogen loss and critical source areas were analyzed at three time scales of yearly average, monthly average and rainstorms flood process, respectively. Furthermore, multiple linear correlation analysis was conducted to analyze the contribution of natural environment and anthropogenic disturbance on nitrogen loss. The results showed that there were significant spatial differences of TN loss in Shanmei Reservoir watershed at different time scales, and the spatial differentiation degree of nitrogen loss was in the order of monthly average > yearly average > rainstorms flood process. TN loss load mainly came from upland Taoxi subbasin, which was identified as the critical source area. At different time scales, land use types (such as farmland and forest) were always the dominant factor affecting the spatial distribution of nitrogen loss, while the effect of precipitation and runoff on the nitrogen loss was only taken in no fertilization month and several processes of storm flood at no fertilization date. This was mainly due to the significant spatial variation of land use and fertilization, as well as the low spatial variability of precipitation and runoff.

  17. Legume Shrubs Are More Nitrogen-Homeostatic than Non-legume Shrubs.

    Science.gov (United States)

    Guo, Yanpei; Yang, Xian; Schöb, Christian; Jiang, Youxu; Tang, Zhiyao

    2017-01-01

    Legumes are characterized as keeping stable nutrient supply under nutrient-limited conditions. However, few studies examined the legumes' stoichiometric advantages over other plants across various taxa in natural ecosystems. We explored differences in nitrogen (N) and phosphorus (P) stoichiometry of different tissue types (leaf, stem, and root) between N 2 -fixing legume shrubs and non-N 2 -fixing shrubs from 299 broadleaved deciduous shrubland sites in northern China. After excluding effects of taxonomy and environmental variables, these two functional groups differed considerably in nutrient regulation. N concentrations and N:P ratios were higher in legume shrubs than in non-N 2 -fixing shrubs. N concentrations were positively correlated between the plants and soil for non-N 2 -fixing shrubs, but not for legume shrubs, indicating a stronger stoichiometric homeostasis in legume shrubs than in non-N 2 -fixing shrubs. N concentrations were positively correlated among three tissue types for non-N 2 -fixing shrubs, but not between leaves and non-leaf tissues for legume shrubs, demonstrating that N concentrations were more dependent among tissues for non-N 2 -fixing shrubs than for legume shrubs. N and P concentrations were correlated within all tissues for both functional groups, but the regression slopes were flatter for legume shrubs than non-N 2 -fixing shrubs, implying that legume shrubs were more P limited than non-N 2 -fixing shrubs. These results address significant differences in stoichiometry between legume shrubs and non-N 2 -fixing shrubs, and indicate the influence of symbiotic nitrogen fixation (SNF) on plant stoichiometry. Overall, N 2 -fixing legume shrubs are higher and more stoichiometrically homeostatic in N concentrations. However, due to excess uptake of N, legumes may suffer from potential P limitation. With their N advantage, legume shrubs could be good nurse plants in restoration sites with degraded soil, but their P supply should be taken care

  18. Urea recycling contributes to nitrogen retention in calves fed milk replacer and low-protein solid feed.

    Science.gov (United States)

    Berends, Harma; van den Borne, Joost J G C; Røjen, Betina A; van Baal, Jürgen; Gerrits, Walter J J

    2014-07-01

    Urea recycling, with urea originating from catabolism of amino acids and hepatic detoxification of ammonia, is particularly relevant for ruminant animals, in which microbial protein contributes substantially to the metabolizable protein supply. However, the quantitative contribution of urea recycling to protein anabolism in calves during the transition from preruminants (milk-fed calves) to ruminants [solid feed (SF)-fed calves] is unknown. The aim of this study was to quantify urea recycling in milk-fed calves when provided with low-protein SF. Forty-eight calves [164 ± 1.6 kg body weight (BW)] were assigned to 1 of 4 SF levels [0, 9, 18, and 27 g of dry matter (DM) SF · kg BW(-0.75) · d⁻¹] provided in addition to an identical amount of milk replacer. Urea recycling was quantified after a 24-h intravenous infusion of [¹⁵N₂]urea by analyzing urea isotopomers in 68-h fecal and urinary collections. Real-time qPCR was used to measure gene expression levels of bovine urea transporter B (bUTB) and aquaglyceroporin-3 and aquaglyceroporin-7 in rumen wall tissues. For every incremental gram of DM SF intake (g DM · kg(0.75)), nitrogen intake increased by 0.70 g, and nitrogen retention increased by 0.55 g (P intake, but aquaglyceroporin-7 expression did not. We conclude that in addition to the increase in digested nitrogen, urea recycling contributes to the observed increase in nitrogen retention with increasing SF intake in milk-fed calves. Furthermore, ruminal bUTB and aquaglyceroporin-3 expression are upregulated with SF intake, which might be associated with urea recycling. © 2014 American Society for Nutrition.

  19. A comparative study of 30MeV boron4+ and 60MeV oxygen8+ ion irradiated Si NPN BJTs

    International Nuclear Information System (INIS)

    Kumar, M. Vinay; Krishnaveni, S.; Yashoda, T.; Dinesh, C. M.; Krishnakumar, K. S.; Jayashree, B.; Ramani

    2015-01-01

    The impact of 30MeV boron 4+ and 60MeV oxygen 8+ ion irradiation on electrical characteristics of 2N3773 Si NPN Bipolar junction transistors (BJTs) is reported in the present study. The transistors were decapped and irradiated at room temperature. Gummel characteristics, DC current gain and Capacitance-voltage (C-V) characteristics were studied before and after irradiation at different fluences. DC current gain has decreased significantly in both boron and oxygen ion irradiation. Also the value of capacitance decreased 3-4 times with increase in fluence. Both 30MeV boron ion and 60MeV oxygen ion induced similar extent of degradation in electrical characteristics of the transistor

  20. Base profile design for high-performance operation of bipolar transistors at liquid-nitrogen temperature

    International Nuclear Information System (INIS)

    Stork, J.M.C.; Harame, D.L.; Meyerson, B.S.; Nguyen, T.N.

    1989-01-01

    The base profile requirements of Si bipolar junction transistors (BJT's) high-performance operation at liquid-nitrogen temperature are examined. Measurements of thin epitaxial-base polysilicon-emitter n-p-n transistors with increasing base doping show the effects of bandgap narrowing, mobility changes, and carrier freezeout. At room temperature the collector current at low injection is proportional to the integrated base charge, independent of the impurity distribution. At temperatures below 150 Κ, however, minority injection is dominated by the peak base doping because of the greater effectiveness of bandgap narrowing. When the peak doping in the base approaches 10 19 cm -3 , the bandgap difference between emitter and base is sufficiently small that the current gain no longer monotonically decreases with lower temperature but instead shows a maximum as low as 180 Κ. The device design window appears limited at the low-current end by increased base-emitter leakage due to tunneling and by resistance control at the high-current end. Using the measured dc characteristics, circuit delay calculations are made to estimate the performance of an ECL ring oscillator at room and liquid-nitrogen temperatures. It is shown that if the base doping can be raised to 10 19 cm -3 while keeping the base thickness constant, the minimum delay at liquid nitrogen can approach the delay of optimized devices at room temperature

  1. Silicon heterojunction transistor

    International Nuclear Information System (INIS)

    Matsushita, T.; Oh-uchi, N.; Hayashi, H.; Yamoto, H.

    1979-01-01

    SIPOS (Semi-insulating polycrystalline silicon) which is used as a surface passivation layer for highly reliable silicon devices constitutes a good heterojunction for silicon. P- or B-doped SIPOS has been used as the emitter material of a heterojunction transistor with the base and collector of silicon. An npn SIPOS-Si heterojunction transistor showing 50 times the current gain of an npn silicon homojunction transistor has been realized by high-temperature treatments in nitrogen and low-temperature annealing in hydrogen or forming gas

  2. Plasma urea nitrogen and progesterone concentrations and follicular dynamics in ewes fed proteins of different degradability

    Directory of Open Access Journals (Sweden)

    Gustavo Bianchi Lazarin

    2012-07-01

    Full Text Available The effects of overfeeding with protein of different degradability on body condition, plasma urea nitrogen and progesterone concentrations, ovulation number and follicular dynamics were assessed in Santa Ines ewes. Twelve ewes were assigned to a randomized block design according to body weight and received overfeeding with soybean meal or with corn gluten meal or maintenance diet for 28 days before ovulation and during the next estrous cycle. Blood samples were taken on days 7, 14, 21, and 28 after the beginning of treatments for analysis of plasma urea nitrogen and on days 3, 6, 9, 12, and 15 into the estrous cycle for analysis of plasma urea nitrogen and progesterone. Follicular dynamics was monitored daily by ultrasound during one estrous cycle. Dry matter and crude protein intake, weight gain, plasma urea nitrogen concentration before ovulation, number of ovulations, diameter of the largest follicle of the 1st and of the 2nd waves and the growth rate of the largest follicle of the 1st wave were higher in the ewes that received overfeeding. The growth rate of the largest follicle of the 3rd wave was higher in the ewes fed maintenance diet. The back fat thickness, plasma urea nitrogen before ovulation and progesterone concentrations, diameter of the largest follicle of the 2nd wave and growth rate of the largest follicle of the 3rd wave were higher in ewes that received overfeeding with soybean meal. The growth rate of the largest follicle of the 1st wave was higher in ewes that received overfeeding with corn gluten meal. Overfeeding with protein-rich feeds may increase the ovulation number and with soybean meal, it may be effective in increasing plasma progesterone concentration in ewes.

  3. Seasonal changes in amino acids, protein and total nitrogen in needles of fertilized Scots pine trees.

    Science.gov (United States)

    Näsholm, T; Ericsson, A

    1990-09-01

    Seasonal changes in amino acids, protein and total nitrogen in needles of 30-year-old, fertilized Scots pine (Pinus sylvestris L.) trees growing in Northern Sweden were investigated over two years in field experiments. The studied plots had been fertilized annually for 17 years with (i) a high level of N, (ii) a medium level of N, or (iii) a medium level of N, P and K. Trees growing on unfertilized plots served as controls. In control trees, glutamine, glutamic acid, gamma-aminobutyric acid, aspartic acid and proline represented 50-70% of the total free amino acids determined. Arginine was present only in low concentrations in control trees throughout the year, but it was usually the most abundant amino acid in fertilized trees. Glutamine concentrations were high during the spring and summer in both years of study, whereas proline concentrations were high in the spring but otherwise low throughout the year. In the first year of study, glutamic acid concentrations were high during the spring and summer, whereas gamma-aminobutyric acid was present in high concentrations during the winter months. This pattern was less pronounced in the second year of investigation. The concentrations of most amino acids, except glutamic acid, increased in response to fertilization. Nitrogen fertilization increased the foliar concentration of arginine from trees to a maximum of 110 micromol g(dw) (-1). Trees fertilized with nitrogen, phosphorus and potassium had significantly lower arginine concentrations than trees fertilized with the same amount of nitrogen only. Protein concentrations were similar in all fertilized trees but higher than those in control trees. For all treatments, protein concentrations were high in winter and at a minimum in early spring. In summer, the protein concentration remained almost constant except for a temporary decrease which coincided with the expansion of new shoots. Apart from arginine, the amino acid composition of proteins was similar in all

  4. Dietary protein and urinary nitrogen in relation to 6-year changes in fat mass and fat-free mass

    DEFF Research Database (Denmark)

    Ankarfeldt, Mikkel Zøllner; Gottliebsen, K; Ängquist, L

    2015-01-01

    Background:In contrast to the physiological expectation, observational studies show that greater protein intake is associated with subsequent body weight (BW) gain. An increase in fat-free mass (FFM) due to anabolic effects of protein could explain this.Objective:To examine associations between...... protein intake and subsequent changes in fat mass (FM) and FFM in longitudinal, observational data.Design:A health examination, including measures of FM and FFM by bioelectrical impedance at baseline and follow-up six years later, was conducted. Diet history interviews (DHI) were performed, and 24-hour...... nitrogen. Estimated from DHI, FM increased 46 gram/year with every 1 E% protein substituted for fat (95%CI: 13, 79; P=0.006) and FFM increased 15 gram/year (1, 30; P=0.046). Results were similar in other substitution models. Estimated from urinary nitrogen, FM increased 53 gram/year with 1 E% protein...

  5. Rumen microbial protein synthesis and nitrogen efficiency as affected by tanniferous and non-tanniferous forage legumes incubated individually or together in Rumen Simulation Technique.

    Science.gov (United States)

    Grosse Brinkhaus, Anja; Bee, Giuseppe; Schwarm, Angela; Kreuzer, Michael; Dohme-Meier, Frigga; Zeitz, Johanna O

    2018-03-01

    A limited availability of microbial protein can impair productivity in ruminants. Ruminal nitrogen efficiency might be optimised by combining high-quality forage legumes such as red clover (RC), which has unfavourably high ruminal protein degradability, with tanniferous legumes like sainfoin (SF) and birdsfoot trefoil (BT). Silages from SF and from BT cultivars [Bull (BB) and Polom (BP)] were incubated singly or in combination with RC using the Rumen Simulation Technique (n = 6). The tanniferous legumes, when compared to RC, changed the total short-chain fatty acid profile by increasing propionate proportions at the expense of butyrate. Silage from SF contained the most condensed tannins (CTs) (136 g CT kg -1 dry matter) and clearly differed in various traits from the BT and RC silages. The apparent nutrient degradability (small with SF), microbial protein synthesis, and calculated content of potentially utilisable crude protein (large with SF) indicated that SF had the greatest efficiency in ruminal protein synthesis. The effects of combining SF with RC were mostly linear. The potential of sainfoin to improve protein supply, demonstrated either individually or in combination with a high-performance forage legume, indicates its potential usefulness in complementing protein-deficient ruminant diets and high-quality forages rich in rumen-degradable protein. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  6. Production and characterization of cowpea protein hydrolysate with optimum nitrogen solubility by enzymatic hydrolysis using pepsin.

    Science.gov (United States)

    Mune Mune, Martin Alain; Minka, Samuel René

    2017-06-01

    Cowpea is a source of low-cost and good nutritional quality protein for utilization in food formulations in replacement of animal proteins. Therefore it is necessary that cowpea protein exhibits good functionality, particularly protein solubility which affects the other functional properties. The objective of this study was to produce cowpea protein hydrolysate exhibiting optimum solubility by the adequate combination of hydrolysis parameters, namely time, solid/liquid ratio (SLR) and enzyme/substrate ratio (ESR), and to determine its functional properties and molecular characteristics. A Box-Behnken experimental design was used for the experiments, and a second-order polynomial to model the effects of hydrolysis time, SLR and ESR on the degree of hydrolysis and nitrogen solubility index. The optimum hydrolysis conditions of time 208.61 min, SLR 1/15 (w/w) and ESR 2.25% (w/w) yielded a nitrogen solubility of 75.71%. Protein breakdown and the peptide profile following enzymatic hydrolysis were evaluated by sodium dodecyl sulfate polyacrylamide gel electrophoresis and size exclusion chromatography. Cowpea protein hydrolysate showed higher oil absorption capacity, emulsifying activity and foaming ability compared with the concentrate. The solubility of cowpea protein hydrolysate was adequately optimized by response surface methodology, and the hydrolysate showed adequate functionality for use in food. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  7. PLASMA PROTEIN AND HEMOGLOBIN PRODUCTION : DELETION OF INDIVIDUAL AMINO ACIDS FROM GROWTH MIXTURE OF TEN ESSENTIAL AMINO ACIDS. SIGNIFICANT CHANGES IN URINARY NITROGEN.

    Science.gov (United States)

    Robscheit-Robbins, F S; Miller, L L; Whipple, G H

    1947-02-28

    Given healthy dogs fed abundant iron and protein-free or low protein diets with sustained anemia and hypoproteinemia, we can study the capacity of these animals to produce simultaneously new hemoglobin and plasma protein. Reserve stores of blood protein-building materials are measurably depleted and levels of 6 to 8 gm. per cent for hemoglobin and 4 to 5 gm. per cent for plasma protein can be maintained for weeks or months depending upon the intake of food proteins or amino acid mixtures. These dogs are very susceptible to infection and various poisons. Dogs tire of these diets and loss of appetite terminates many experiments. Under these conditions (double depletion) standard growth mixtures of essential amino acids are tested to show the response in blood protein output and urinary nitrogen balance. As a part of each tabulated experiment one of the essential amino acids is deleted from the complete growth mixture to compare such response with that of the whole mixture. Methionine, threonine, phenylalanine, and tryptophane when singly eliminated from the complete amino acid mixture do effect a sharp rise in urinary nitrogen. This loss of urinary nitrogen is corrected when the individual amino acid is replaced in the mixture. Histidine, lysine, and valine have a moderate influence upon urinary nitrogen balance toward nitrogen conservation. Leucine, isoleucine, and arginine have minimal or no effect upon urinary nitrogen balance when these individual amino acids are deleted from the complete growth mixture of amino acids during 3 to 4 week periods. Tryptophane and to a less extent phenylalanine and threonine when returned to the amino acid mixture are associated with a conspicuous preponderance of plasma protein output over the hemoglobin output (Table 4). Arginine, lysine, and histidine when returned to the amino acid mixture are associated with a large preponderance of hemoglobin output. Various amino acid mixtures under these conditions may give a positive

  8. North American experience with Low protein diet for Non-dialysis-dependent chronic kidney disease.

    Science.gov (United States)

    Kalantar-Zadeh, Kamyar; Moore, Linda W; Tortorici, Amanda R; Chou, Jason A; St-Jules, David E; Aoun, Arianna; Rojas-Bautista, Vanessa; Tschida, Annelle K; Rhee, Connie M; Shah, Anuja A; Crowley, Susan; Vassalotti, Joseph A; Kovesdy, Csaba P

    2016-07-19

    Whereas in many parts of the world a low protein diet (LPD, 0.6-0.8 g/kg/day) is routinely prescribed for the management of patients with non-dialysis-dependent chronic kidney disease (CKD), this practice is infrequent in North America. The historical underpinnings related to LPD in the USA including the non-conclusive results of the Modification of Diet in Renal Disease Study may have played a role. Overall trends to initiate dialysis earlier in the course of CKD in the US allowed less time for LPD prescription. The usual dietary intake in the US includes high dietary protein content, which is in sharp contradistinction to that of a LPD. The fear of engendering or worsening protein-energy wasting may be an important handicap as suggested by a pilot survey of US nephrologists; nevertheless, there is also potential interest and enthusiasm in gaining further insight regarding LPD's utility in both research and in practice. Racial/ethnic disparities in the US and patients' adherence are additional challenges. Adherence should be monitored by well-trained dietitians by means of both dietary assessment techniques and 24-h urine collections to estimate dietary protein intake using urinary urea nitrogen (UUN). While keto-analogues are not currently available in the USA, there are other oral nutritional supplements for the provision of high-biologic-value proteins along with dietary energy intake of 30-35 Cal/kg/day available. Different treatment strategies related to dietary intake may help circumvent the protein- energy wasting apprehension and offer novel conservative approaches for CKD management in North America.

  9. Nitrogen supply of crops by biological nitrogen fixation. 2

    International Nuclear Information System (INIS)

    Jensen, E.S.; Andersen, A.J.; Soerensen, H.; Thomsen, J.D.

    1985-02-01

    In the present work the contributions from combined N-sources and symbiotic nitrogen fixation to the nitrogen supply of field-grown peas and field beans were evaluated by means of 15 N fertilizer dilution. The effect of N-fertilizer, supplied at sowing and at different stages of plant development, on nitrogen fixation, yield and protein production in peas, was studied in pot experiments. (author)

  10. Gastrointestinal nitrogen turnover in sheep fed non-protein nitrogen and a phosphorus deficient diet

    International Nuclear Information System (INIS)

    Breves, G.; Hoeller, H.

    1987-01-01

    Sheep were fitted with rumen cannulas and re-entrant duodenal and T-shaped ileal cannulas and adapted to a semisynthetic phosphorus deficient diet providing approximately 0.96 g P/d and 14 g N/d, about half of which was in the form of urea-N. Phosphorus repletion was achieved by daily intraduodenal infusion of phosphate, bringing up the daily P supply to about 4.2 g. In P depletion, as well as in P repletion, a series of infusion periods of six days each were established with continuous intraruminal infusion of Cr-ethylenediaminetetra acetic acid as a fluid marker and 15 NH 4 Cl as a marker of microbial N. Gastrointestinal phosphorus and nitrogen balances were established and the net yield of microbial N in the rumen and the flow of microbial N into the duodenum were calculated. The following significant findings were obtained in P depleted sheep. The concentrations of P in plasma and in rumen fluid and the flow of P to the small intestines fell by 60 to 90%; the P balances became negative. The gastrointestinal balance and the flow of N before the large intestines were not affected, but N digestibility in the large intestines was reduced. The daily net yield of microbial N in the rumen was reduced by 27% and the daily flow of microbial N into the duodenum was reduced by 26%. (author)

  11. Nitrogen availability for nitrogen fixing cyanobacteria upon growth ...

    African Journals Online (AJOL)

    The filamentous cyanobacterium Nostoc PCC 7120 is able to convert dinitrogen to ammonia in the absence of combined nitrogen. The expression of 20% of coding sequences from all major metabolic categories was examined in nitrogen fixing and non-nitrogen fixing growth conditions. The expression data were correlated ...

  12. Defect-induced Catalysis toward the Oxygen Reduction Reaction in Single-walled Carbon Nanotube: Nitrogen doped and Non-nitrogen doped

    International Nuclear Information System (INIS)

    Lu, Di; Wu, Dan; Jin, Jian; Chen, Liwei

    2016-01-01

    Single-walled carbon nanotubes (SWNTs) are post-treated by argon (Ar) or ammonia (NH 3 ) plasma irradiation to introduce defects that are potentially related to catalysis towards the oxygen reduction reaction (ORR). Electrochemical characterization in alkali medium suggests that the plasma irradiated SWNTs demonstrate enhanced catalytic activity toward the ORR with a positively shifted threshold potential. Moreover the enhanced desired four-electron pathway catalytic activity, which exhibited as the positive shifted threshold potential, is independent of the nitrogen dopant. The nature of the defects is probed with Raman and X-ray photoelectron spectroscopy. The results indicate that the non-nitrogen doped defects of SWNTs contribute to the actual active site for the ORR.

  13. Dietary protein affects nitrogen excretion and ammonia emission from slurry of growing-finishing pigs.

    NARCIS (Netherlands)

    Canh, T.T.; Aarnink, A.J.A.; Schutte, J.B.; Sutton, A.L.; Langhout, D.J.; Verstegen, M.W.A.

    1998-01-01

    The effects of dietary protein on nitrogen excretion and ammonia emission from slurry of growing–finishing pigs were studied both in vitro and in a pig house. The three diets had similar contents of NE, minerals, vitamins and ileal digestible lysine, methionine cystine, threonine and tryptophan, but

  14. Dietary protein affects nitrogen excretion and ammonia emission from slurry of growing-finishing pigs

    NARCIS (Netherlands)

    Canh, T.T.; Aarnink, A.J.A.; Schutte, J.B.; Sutton, A.; Langhout, D.J.; Verstegen, M.W.A.

    1998-01-01

    The effects of dietary protein on nitrogen excretion and ammonia emission from slurry of growing-finishing pigs were studied both in vitro and in a pig house. The three diets had similar contents of NE, minerals, vitamins and ileal digestible lysine, methionine + cystine, threonine and tryptophan,

  15. Microbial protein synthesis and nitrogen metabolism in cows bred on tropical pasture and fed on cassava root and corn

    Directory of Open Access Journals (Sweden)

    Ádler Carvalho da Silva

    2014-05-01

    Full Text Available Current experiment evaluated the effect of replacement of full corn meal by dehydrated ground cassava roots at levels 0%, 25%, 50%, 75% and 100% in experimental supplements for lactating cows grazing on irrigated and fertilized tropical pastures. Ten Holstein cows were divided into two 5 x 5 Latin squares, with average initial 150 days of lactation, milk production 22±3.30 kg day-1 at the beginning of experiment and initial body weight of 603±65 kg. Cows were maintained on pasture consisting of elephant grass (Pennisetum purpureum, Schum cultivar Pioneiro, intercropped with Tifton 85 (Cynodon nlemfuensis, fertilized with 600 kg nitrogen per hectare year-1. There was no significant difference (p > 0.05 between the substitution levels of corn meal by ground and dehydrated cassava root in the concentrate on the synthesis of microbial protein with an estimated average of 1,288.49 g day-1 and efficiency in the synthesis of microbial protein per kilogram of TDN with estimated average of 91.30 g kg-1 TDN. Nitrogen equilibrium showed an estimated average of 218.79 g day-1 of retained nitrogen. The microbial protein synthesis and nitrogen balance were not affected by treatments.

  16. Effect of Borax and cysteamine compound on finishing sheep growth performance, nitrogen retention, serum biochemical indices and body protein motabolism

    International Nuclear Information System (INIS)

    Chang Xinyao' Xie Hongbing; Wei Gangcai; Wang Hong

    2009-01-01

    Experiment was conducted to investigate the effects of borax, cysteamine and the mixture of two compounds on growth performance, serum biochemical indices, protein turn-over and nitrogen aggradation of sheep by using isotope ( 15 N-Gly) technique, nitrogen balance trial and serum testing. The results showed that both borax and cysteamine could increase the growth performance of sheep, especially the cysteamine and its mixture with borax, which increased average daily feed intake (P 3 ) and levothyroxine (T 4 ) of mixture were higher than that of control group (P<0.05), and the concentrations of growth hormone (GH) and insulin-like growth factors (IGF-1) were also significantly higher than those of control group (P<0.01). There was no significant difference of insulin (INS) between experiment groups and control group (P<0.05). Both mixture and borax contributed to increasing nitrogen retention, net nitrogen utilization, digestibility and biological value. Both borax and cysteamine accelerated protein degradation rate, apparent amino acid utilization rate and net amino acid utilization rate as well as biological value, body protein and oxidation rate, but the former was greater than the later. (authors)

  17. Non-uniform tube representation of proteins

    DEFF Research Database (Denmark)

    Hansen, Mikael Sonne

    Treating the full protein structure is often neither computationally nor physically possible. Instead one is forced to consider various reduced models capturing the properties of interest. Previous work have used tubular neighborhoods of the C-alpha backbone. However, assigning a unique radius...... might not correctly capture volume exclusion - of crucial importance when trying to understand a proteins $3$d-structure. We propose a new reduced model treating the protein as a non-uniform tube with a radius reflecting the positions of atoms. The tube representation is well suited considering X......-ray crystallographic resolution ~ 3Å while a varying radius accounts for the different sizes of side chains. Such a non-uniform tube better capture the protein geometry and has numerous applications in structural/computational biology from the classification of protein structures to sequence-structure prediction....

  18. Potassium Bicarbonate Attenuates the Urinary Nitrogen Excretion That Accompanies an Increase in Dietary Protein and May Promote Calcium Absorption

    Science.gov (United States)

    Ceglia, Lisa; Harris, Susan S.; Abrams, Steven A.; Rasmussen, Helen M.; Dallal, Gerard E.; Dawson-Hughes, Bess

    2009-01-01

    Context: Protein is an essential component of muscle and bone. However, the acidic byproducts of protein metabolism may have a negative impact on the musculoskeletal system, particularly in older individuals with declining renal function. Objective: We sought to determine whether adding an alkaline salt, potassium bicarbonate (KHCO3), allows protein to have a more favorable net impact on intermediary indices of muscle and bone conservation than it does in the usual acidic environment. Design: We conducted a 41-d randomized, placebo-controlled, double-blind study of KHCO3 or placebo with a 16-d phase-in and two successive 10-d metabolic diets containing low (0.5 g/kg) or high (1.5 g/kg) protein in random order with a 5-d washout between diets. Setting: The study was conducted in a metabolic research unit. Participants: Nineteen healthy subjects ages 54–82 yr participated. Intervention: KHCO3 (up to 90 mmol/d) or placebo was administered for 41 d. Main Outcome Measures: We measured 24-h urinary nitrogen excretion, IGF-I, 24-h urinary calcium excretion, and fractional calcium absorption. Results: KHCO3 reduced the rise in urinary nitrogen excretion that accompanied an increase in protein intake (P = 0.015) and was associated with higher IGF-I levels on the low-protein diet (P = 0.027) with a similar trend on the high-protein diet (P = 0.050). KHCO3 was also associated with higher fractional calcium absorption on the low-protein diet (P = 0.041) with a similar trend on the high-protein diet (P = 0.064). Conclusions: In older adults, KHCO3 attenuates the protein-induced rise in urinary nitrogen excretion, and this may be mediated by IGF-I. KHCO3 may also promote calcium absorption independent of the dietary protein content. PMID:19050051

  19. InGaP/InGaAsN/GaAs NpN double-heterojunction bipolar transistor

    International Nuclear Information System (INIS)

    Chang, P. C.; Baca, A. G.; Li, N. Y.; Xie, X. M.; Hou, H. Q.; Armour, E.

    2000-01-01

    We have demonstrated a functional NpN double-heterojunction bipolar transistor (DHBT) using InGaAsN for the base layer. The InGaP/In 0.03 Ga 0.97 As 0.99 N 0.01 /GaAs DHBT has a low V ON of 0.81 V, which is 0.13 V lower than in a InGaP/GaAs heterojunction bipolar transistor (HBT). The lower turn-on voltage is attributed to the smaller band gap (1.20 eV) of metalorganic chemical vapor deposition-grown In 0.03 Ga 0.97 As 0.99 N 0.01 base layer. GaAs is used for the collector; thus the breakdown voltage (BV CEO ) is 10 V, consistent with the BV CEO of InGaP/GaAs HBTs of comparable collector thickness and doping level. To alleviate the current blocking phenomenon caused by the larger conduction band discontinuity between InGaAsN and GaAs, a graded InGaAs layer with δ doping is inserted at the base-collector junction. The improved device has a peak current gain of seven with ideal current-voltage characteristics. (c) 2000 American Institute of Physics

  20. Impact of fermentation on nitrogenous compounds of cocoa beans (Theobroma cacao L.) from various origins.

    Science.gov (United States)

    Hue, C; Gunata, Z; Breysse, A; Davrieux, F; Boulanger, R; Sauvage, F X

    2016-02-01

    Tangential filtration technique was used to separate and quantify three different fractions of nitrogenous compounds depending on their molecular size, during cocoa fermentation. On every phenotype and origin analyzed, protein profile of non-fermented samples was similar. During fermentation course, proteins get degraded with a concomitant increase in amino acids content. Peptides between 3 and 10 kDa were observed at low levels. A strong correlation between amino acids and ammonia nitrogen, a fermentation marker was found. Attention was drawn on each fraction, and enabled to point out other phenomenon occurring during fermentation. The migration of some nitrogenous compounds towards the bean shell during fermentation was demonstrated. Acetone treatment of cocoa powder prior to SDS-PAGE led to losses of nitrogenous compounds. This result gives clues on the tanning phenomenon carried out by polyphenols on nitrogenous compounds, phenomenon which increases during fermentation. Copyright © 2015. Published by Elsevier Ltd.

  1. Effect of dietary protein level on nitrogen utilization and ruminal influx of endogenous urea nitrogen in growing animals

    International Nuclear Information System (INIS)

    Bunting, L.D.

    1987-01-01

    Three experiments were conducted to evaluate the impact of ruminal influx of blood urea nitrogen (BUN) on intestinal protein supply and nitrogen (N) metabolism in growing animals at both excess and growth-limiting protein intake. In Experiment 1, wether lambs were given diets, either high or low in protein, containing 25% cottonseed hulls and 75% corn-soybean meal hourly in 24 equal portions. Single injections of 14 C- and 15 N-urea, and 15 N-ammonium sulfate (AS) were made into the BUN and ruminal ammonia N (RAN) pools, respectively, to measure rate of flux through, and transfer of N between these and the bacterial N pool. In Experiment 2, beef calves were given HP and LP diets containing 30% cottonseed hulls and 70% corn-soybean meal every 4 h in 6 equal portions. Single injections of 15 N-urea and 15 N-AS were made into the BUN and RAN pools, respectively, to measure rate of flux through, and transfer of N between these and the bacterial N pool. Abomasal N flow was 24% greater than intake in LP and 29% less than intake in HP. An inverse relationship may exist between level of N intake and rate of influx of BUN into the rumen. In Experiment 3 ruminal fluid samples were obtained. With HP, BUN-derived 15 N-ammonia appeared to rapidly equilibrate with RAN in the primary digesta mass. In contrast, with LP, there appeared to be an enrichment gradient for both RAN and bacterial N, declining from the rumen wall toward the center of the digesta mass, suggesting that bacteria at or near the rumen wall may preferentially utilized some BUN-derived ammonia N entering through the rumen wall

  2. Legume Shrubs Are More Nitrogen-Homeostatic than Non-legume Shrubs

    OpenAIRE

    Guo, Yanpei; Yang, Xian; Schöb, Christian; Jiang, Youxu; Tang, Zhiyao

    2017-01-01

    Legumes are characterized as keeping stable nutrient supply under nutrient-limited conditions. However, few studies examined the legumes' stoichiometric advantages over other plants across various taxa in natural ecosystems. We explored differences in nitrogen (N) and phosphorus (P) stoichiometry of different tissue types (leaf, stem, and root) between N2-fixing legume shrubs and non-N2-fixing shrubs from 299 broadleaved deciduous shrubland sites in northern China. After excluding effects of ...

  3. Cross sections and analyzing powers of 15N(p,n)15O at 200 MeV and 494 MeV

    International Nuclear Information System (INIS)

    Ciskowski, D.E.

    1989-11-01

    Differential cross sections and analyzing powers have been measured for the 15 N(p,n) 15 O(g.s.) reaction at bombarding energies of 200 MeV and 494 MeV. The 494 MeV data were obtained at the LAMPF Neutron Time-Of-Flight Facility on an 82 m flight path with a resolution of about 2.7 MeV. The 200 MeV data were obtained at IUCF on a 76m flight path with a resolution of about 1.1 MeV. At both energies, the measured analyzing power is small, the magnitude is less than .2 for momentum transfers of less than 1 fm -1 . In contrast, both Relativistic and standard DWIA calculations predict a maximum of A=-.7 near q=0.7 fm -1 . 53 refs., 44 figs

  4. Identification and characterization of finger millet OPAQUE2 transcription factor gene under different nitrogen inputs for understanding their role during accumulation of prolamin seed storage protein.

    Science.gov (United States)

    Gaur, Vikram Singh; Kumar, Lallan; Gupta, Supriya; Jaiswal, J P; Pandey, Dinesh; Kumar, Anil

    2018-03-01

    In this study, we report the isolation and characterization of the mRNA encoding OPAQUE2 (O2) like TF of finger millet (FM) ( Eleusine coracana) ( EcO2 ). Full-length EcO2 mRNA was isolated using conserved primers designed by aligning O2 mRNAs of different cereals followed by 3' and 5' RACE (Rapid Amplification of cDNA Ends). The assembled full-length EcO2 mRNA was found to contain an ORF of 1248-nt coding the 416 amino acids O2 protein. Domain analysis revealed the presence of the BLZ and bZIP-C domains which is a characteristic feature of O2 proteins. Phylogenetic analysis of EcO2 protein with other bZIP proteins identified using finger millet transcriptome data and O2 proteins of other cereals showed that EcO2 shared high sequence similarity with barley BLZ1 protein. Transcripts of EcO2 were detected in root, stem, leaves, and seed development stages. Furthermore, to investigate nitrogen responsiveness and the role of EcO2 in regulating seed storage protein gene expression, the expression profiles of EcO2 along with an α-prolamin gene were studied during the seed development stages of two FM genotypes (GE-3885 and GE-1437) differing in grain protein content (13.8 and 6.2%, respectively) grown under increasing nitrogen inputs. Compared to GE-1437, the EcO2 was relatively highly expressed during the S2 stage of seed development which further increased as nitrogen input was increased. The Ecα - prolamin gene was strongly induced in the high protein genotype (GE-3885) at all nitrogen inputs. These results indicate the presence of nitrogen responsiveness regulatory elements which might play an important role in accumulating protein in FM genotypes through modulating EcO2 expression by sensing plant nitrogen status.

  5. New concepts of microbial treatment processes for the nitrogen removal: effect of protein and amino acids degradation.

    Science.gov (United States)

    González-Martínez, Alejandro; Calderón, Kadiya; González-López, Jesús

    2016-05-01

    High concentrations of proteins and amino acids can be found in wastewater and wastewater stream produced in anaerobic digesters, having shown that amino acids could persist over different managements for nitrogen removal affecting the nitrogen removal processes. Nitrogen removal is completely necessary because of their implications and the significant adverse environmental impact of ammonium such as eutrophication and toxicity to aquatic life on the receiving bodies. In the last decade, the treatment of effluents with high ammonium concentration through anammox-based bioprocesses has been enhanced because these biotechnologies are cheaper and more environmentally friendly than conventional technologies. However, it has been shown that the presence of important amounts of proteins and amino acids in the effluents seriously affects the microbial autotrophic consortia leading to important losses in terms of ammonium oxidation efficiency. Particularly the presence of sulfur amino acids such as methionine and cysteine has been reported to drastically decrease the autotrophic denitrification processes as well as affect the microbial community structure promoting the decline of ammonium oxidizing bacteria in favor of other phylotypes. In this context we discuss that new biotechnological processes that improve the degradation of protein and amino acids must be considered as a priority to increase the performance of the autotrophic denitrification biotechnologies.

  6. Studies on nitrogen metabolism of soybean plants, (4)

    International Nuclear Information System (INIS)

    Kato, Yasumasa; Kitada, Subaru

    1979-01-01

    Nitrogen that came from cotyledons and nitrogen ( 15 N) pulse-fed at 5 different times during the growth of young soybean plants were studied for 33-days after germination. Cotyledons furnished nitrogen to primary leaves, stems, and roots for the first 8 days, but thereafter principally to 1 st and 2 nd trifoliate leaves. Redistribution of the cotyledon-derived nitrogen from primary leaves commenced from the 14 th day after germination when their total nitrogen was still increasing. At the end of the experiment, the cotyledon-derived nitrogen was distributed approximately uniformly among 6 expanded leaves, and very small amount was found in 3 immature leaves. It was shown that soybean leaves took up 15 N (via roots) throughout the entire period of their life, and from their near-mature stage onwards, uptake and redistribution of nitrogen were observed simultaneously. Thus, the nitrogen in mature leaves was partially being renewed constantly. Considering this fact, the nitrogen supplying capacity of soybean leaves was estimated to be about two times as large as that estimated conventionally from the net loss of nitrogen during their senescence. The turnover of leaf nitrogen was closely related to the turnover of leaf protein. Influx of nitrogen was invariably accompanied by the simultaneous synthesis of leaf protein, and conversely, efflux by the simultaneous breakdown of leaf protein. Sink removal (topping treatment) prevented the breakdown of leaf protein (as measured from the rate of release of label after the pulse feeding) as well as the export of nitrogen from the leaves. The nitrogen supplying function of soybean leaves was discussed in relation to the nitrogen and protein turnover of leaves. (Kaihara, S.)

  7. Metabolizable energy, nitrogen balance, and ileal digestibility of amino acids in quality protein maize for pigs

    Science.gov (United States)

    2014-01-01

    Background To compare the nutritional value and digestibility of five quality protein maize (QPM) hybrids to that of white and yellow maize, two experiments were carried out in growing pigs. In experiment 1, the energy metabolizability and the nitrogen balance of growing pigs fed one of five QPM hybrid diets were compared against those of pigs fed white or yellow maize. In experiment 2, the apparent and standardized ileal digestibility (AID and SID, respectively) of proteins and amino acids from the five QPM hybrids were compared against those obtained from pigs fed white and yellow maize. In both experiments, the comparisons were conducted using contrasts. Results The dry matter and nitrogen intakes were higher in the pigs fed the QPM hybrids (P digestibility (P digestible lysine than normal maize. PMID:25045520

  8. Nitrogen balance and milk composition of dairy cows fed urea and soybean meal and two protein levels using sugar cane based diets

    OpenAIRE

    Luís Henrique Andreucci Conti; Elmeson Ferreira de Jesus; Angélica Simone Cravo Pereira; Marcos André Arcari; Kleber da Cunha Peixoto Junior; Francisco Palma Rennó; Marcos Veiga dos Santos

    2014-01-01

    The aim of the study was to evaluate the effect of feeding two levels of crude protein (CP) (low: 142 g CP/kg DM; and high: 156 g CP/kg DM) and two nitrogen sources (soybean meal and urea) to dairy cows using sugar cane as forage on microbial protein synthesis, the composition of the milk nitrogen fraction, nitrogen (N) balance and blood parameters. Twelve Holstein cows with an average milk yield of 22.0 ± 2.3 kg/day, and with 235 ± 40 days in milk were included in this study. The animals wer...

  9. Competition and facilitation between unicellular nitrogen-fixing cyanobacteria and non-nitrogen-fixing phytoplankton species

    NARCIS (Netherlands)

    Agawin, N.S.; Rabouille, S.; Veldhuis, M.; Servatius, L.; Hol, S.; van Overzee, H.M.J.; Huisman, J.

    2007-01-01

    Abstract: Recent discoveries show that small unicellular nitrogen-fixing cyanobacteria are more widespread than previously thought and can make major contributions to the nitrogen budget of the oceans. We combined theory and experiments to investigate competition for nitrogen and light between these

  10. Methods of clinical chemistry and isotopic technique for investigation of the nitrogen metabolism in man using 15N

    International Nuclear Information System (INIS)

    Faust, H.; Bornhak, H.; Hirschberg, K.; Jung, K.; Junghans, P.; Krumbiegel, P.; Reinhardt, R.

    1981-03-01

    The present manual is a catalogue of methods representing theoretical and practical aspects of application of the stable isotope 15 N in medicine as well as a reference book for users of 15 N techniques in life sciences. Special emphasis is given to the planning of 15 N tracer experiments and their interpretation, sources of error and standard values of nitrogen compounds, information on sampling of medical materials, methods of separation and determination of proteins and non-protein nitrogen compounds in serum and urine, and details of the isotopic analysis of nitrogen by emission and mass spectrometry. (author)

  11. Endogenous Losses of Nitrogen and Protein Requirement for ...

    African Journals Online (AJOL)

    Four fistulated and four intact West African dwarf wether sheep, maintained on hay and concentrate supplements were used for a study of metabolic faecal nitrogen (MEN) and endogenous urinary nitrogen (EUN). The composition of the faecal losses was examined. The values obtained enabled calculation of nitrogen ...

  12. Host-derived viral transporter protein for nitrogen uptake in infected marine phytoplankton

    Science.gov (United States)

    Chambouvet, Aurélie; Milner, David S.; Attah, Victoria; Terrado, Ramón; Lovejoy, Connie; Moreau, Hervé; Derelle, Évelyne; Richards, Thomas A.

    2017-01-01

    Phytoplankton community structure is shaped by both bottom–up factors, such as nutrient availability, and top–down processes, such as predation. Here we show that marine viruses can blur these distinctions, being able to amend how host cells acquire nutrients from their environment while also predating and lysing their algal hosts. Viral genomes often encode genes derived from their host. These genes may allow the virus to manipulate host metabolism to improve viral fitness. We identify in the genome of a phytoplankton virus, which infects the small green alga Ostreococcus tauri, a host-derived ammonium transporter. This gene is transcribed during infection and when expressed in yeast mutants the viral protein is located to the plasma membrane and rescues growth when cultured with ammonium as the sole nitrogen source. We also show that viral infection alters the nature of nitrogen compound uptake of host cells, by both increasing substrate affinity and allowing the host to access diverse nitrogen sources. This is important because the availability of nitrogen often limits phytoplankton growth. Collectively, these data show that a virus can acquire genes encoding nutrient transporters from a host genome and that expression of the viral gene can alter the nutrient uptake behavior of host cells. These results have implications for understanding how viruses manipulate the physiology and ecology of phytoplankton, influence marine nutrient cycles, and act as vectors for horizontal gene transfer. PMID:28827361

  13. Impact of feeding reduced crude protein diets to lactating sows on nitrogen utilizatilon

    DEFF Research Database (Denmark)

    Huber, L; de Lange, C F M; Larsen, Uffe Krogh

    2015-01-01

    -fed; analyzed contents; HCP); 2) 15.7% CP (MHCP); 3) 14.3% CP (MLCP); 4) 13.2% CP (LCP); diet HCP was formulated using soybean meal and corn as the only Lys sources. The reduced CP diets contained CAA to meet requirements of the limiting AA. Sow and piglet BW were measured on d 1, 3, 7, 14, 18, and 21...... of lactation. Nitrogen retention was measured on sows between d 3 and 7 (early) and d 14 and 18 (peak) of lactation. Milk true protein output was calculated from estimated milk yield and analyzed true protein concentration. Sow BW change (overall mean: -4.2 ± 3.37 kg over the 21-d lactation period) and average...... daily DM intake (overall mean: 4.05 ± 0.18 and 6.12 ± 0.20 kg/d, early and peak lactation, respectively) did not differ between diets. Nitrogen intake decreased as dietary CP concentration decreased (114.3, 106.0, 107.4, and 99.0 ± 5.29 g/d and 169.5, 168.3, 161.2, and 145.1 ± 5.29 g/d for HCP, MHCP...

  14. The effects of dietary nitrogen to water-soluble carbohydrate ratio on isotopic fractionation and partitioning of nitrogen in non-lactating sheep.

    Science.gov (United States)

    Cheng, L; Nicol, A M; Dewhurst, R J; Edwards, G R

    2013-08-01

    The main objective of this study was to investigate the relationship between partitioning and isotopic fractionation of nitrogen (N) in sheep consuming diets with varying ratios of N to water-soluble carbohydrate (WSC). Six non-lactating sheep were offered a constant dry matter (DM) allowance with one of three ratios of dietary N/WSC, achieved by adding sucrose and urea to lucerne pellets. A replicated 3 dietary treatments (Low, Medium and High N/WSC) × 3 (collection periods) and a Latin square design was used, with two sheep assigned to each treatment in each period. Feed, faeces, urine, plasma, wool, muscle and liver samples were collected and analysed for ¹⁵N concentration. Nitrogen intake and outputs in faeces and urine were measured for each sheep using 6-day total collections. Blood urea N (BUN) and urinary excretion of purine derivative were also measured. Treatment effects were tested using general ANOVA; the relationships between measured variables were analysed by linear regression. BUN and N intake increased by 46% and 35%, respectively, when N/WSC increased 2.5-fold. However, no indication of change in microbial protein synthesis was detected. Results indicated effects of dietary treatments on urinary N/faecal N, faecal N/N intake and retained N/N intake. In addition, the linear relationships between plasma δ¹⁵N and urinary N/N intake and muscle δ¹⁵N and retained N/N intake based on individual measurements showed the potential of using N isotopic fractionation as an easy-to-use indicator of N partitioning when N supply exceeds that required to match energy supply in the diet.

  15. DIRProt: a computational approach for discriminating insecticide resistant proteins from non-resistant proteins.

    Science.gov (United States)

    Meher, Prabina Kumar; Sahu, Tanmaya Kumar; Banchariya, Anjali; Rao, Atmakuri Ramakrishna

    2017-03-24

    Insecticide resistance is a major challenge for the control program of insect pests in the fields of crop protection, human and animal health etc. Resistance to different insecticides is conferred by the proteins encoded from certain class of genes of the insects. To distinguish the insecticide resistant proteins from non-resistant proteins, no computational tool is available till date. Thus, development of such a computational tool will be helpful in predicting the insecticide resistant proteins, which can be targeted for developing appropriate insecticides. Five different sets of feature viz., amino acid composition (AAC), di-peptide composition (DPC), pseudo amino acid composition (PAAC), composition-transition-distribution (CTD) and auto-correlation function (ACF) were used to map the protein sequences into numeric feature vectors. The encoded numeric vectors were then used as input in support vector machine (SVM) for classification of insecticide resistant and non-resistant proteins. Higher accuracies were obtained under RBF kernel than that of other kernels. Further, accuracies were observed to be higher for DPC feature set as compared to others. The proposed approach achieved an overall accuracy of >90% in discriminating resistant from non-resistant proteins. Further, the two classes of resistant proteins i.e., detoxification-based and target-based were discriminated from non-resistant proteins with >95% accuracy. Besides, >95% accuracy was also observed for discrimination of proteins involved in detoxification- and target-based resistance mechanisms. The proposed approach not only outperformed Blastp, PSI-Blast and Delta-Blast algorithms, but also achieved >92% accuracy while assessed using an independent dataset of 75 insecticide resistant proteins. This paper presents the first computational approach for discriminating the insecticide resistant proteins from non-resistant proteins. Based on the proposed approach, an online prediction server DIRProt has

  16. Distribution of nitrogen fixation and nitrogenase-like sequences amongst microbial genomes

    Science.gov (United States)

    2012-01-01

    Background The metabolic capacity for nitrogen fixation is known to be present in several prokaryotic species scattered across taxonomic groups. Experimental detection of nitrogen fixation in microbes requires species-specific conditions, making it difficult to obtain a comprehensive census of this trait. The recent and rapid increase in the availability of microbial genome sequences affords novel opportunities to re-examine the occurrence and distribution of nitrogen fixation genes. The current practice for computational prediction of nitrogen fixation is to use the presence of the nifH and/or nifD genes. Results Based on a careful comparison of the repertoire of nitrogen fixation genes in known diazotroph species we propose a new criterion for computational prediction of nitrogen fixation: the presence of a minimum set of six genes coding for structural and biosynthetic components, namely NifHDK and NifENB. Using this criterion, we conducted a comprehensive search in fully sequenced genomes and identified 149 diazotrophic species, including 82 known diazotrophs and 67 species not known to fix nitrogen. The taxonomic distribution of nitrogen fixation in Archaea was limited to the Euryarchaeota phylum; within the Bacteria domain we predict that nitrogen fixation occurs in 13 different phyla. Of these, seven phyla had not hitherto been known to contain species capable of nitrogen fixation. Our analyses also identified protein sequences that are similar to nitrogenase in organisms that do not meet the minimum-gene-set criteria. The existence of nitrogenase-like proteins lacking conserved co-factor ligands in both diazotrophs and non-diazotrophs suggests their potential for performing other, as yet unidentified, metabolic functions. Conclusions Our predictions expand the known phylogenetic diversity of nitrogen fixation, and suggest that this trait may be much more common in nature than it is currently thought. The diverse phylogenetic distribution of nitrogenase

  17. Distribution of nitrogen fixation and nitrogenase-like sequences amongst microbial genomes

    Directory of Open Access Journals (Sweden)

    Dos Santos Patricia C

    2012-05-01

    Full Text Available Abstract Background The metabolic capacity for nitrogen fixation is known to be present in several prokaryotic species scattered across taxonomic groups. Experimental detection of nitrogen fixation in microbes requires species-specific conditions, making it difficult to obtain a comprehensive census of this trait. The recent and rapid increase in the availability of microbial genome sequences affords novel opportunities to re-examine the occurrence and distribution of nitrogen fixation genes. The current practice for computational prediction of nitrogen fixation is to use the presence of the nifH and/or nifD genes. Results Based on a careful comparison of the repertoire of nitrogen fixation genes in known diazotroph species we propose a new criterion for computational prediction of nitrogen fixation: the presence of a minimum set of six genes coding for structural and biosynthetic components, namely NifHDK and NifENB. Using this criterion, we conducted a comprehensive search in fully sequenced genomes and identified 149 diazotrophic species, including 82 known diazotrophs and 67 species not known to fix nitrogen. The taxonomic distribution of nitrogen fixation in Archaea was limited to the Euryarchaeota phylum; within the Bacteria domain we predict that nitrogen fixation occurs in 13 different phyla. Of these, seven phyla had not hitherto been known to contain species capable of nitrogen fixation. Our analyses also identified protein sequences that are similar to nitrogenase in organisms that do not meet the minimum-gene-set criteria. The existence of nitrogenase-like proteins lacking conserved co-factor ligands in both diazotrophs and non-diazotrophs suggests their potential for performing other, as yet unidentified, metabolic functions. Conclusions Our predictions expand the known phylogenetic diversity of nitrogen fixation, and suggest that this trait may be much more common in nature than it is currently thought. The diverse phylogenetic

  18. PipY, a Member of the Conserved COG0325 Family of PLP-Binding Proteins, Expands the Cyanobacterial Nitrogen Regulatory Network

    Directory of Open Access Journals (Sweden)

    José I. Labella

    2017-07-01

    Full Text Available Synechococcus elongatus PCC 7942 is a paradigmatic model organism for nitrogen regulation in cyanobacteria. Expression of genes involved in nitrogen assimilation is positively regulated by the 2-oxoglutarate receptor and global transcriptional regulator NtcA. Maximal activation requires the subsequent binding of the co-activator PipX. PII, a protein found in all three domains of life as an integrator of signals of the nitrogen and carbon balance, binds to PipX to counteract NtcA activity at low 2-oxoglutarate levels. PII-PipX complexes can also bind to the transcriptional regulator PlmA, whose regulon remains unknown. Here we expand the nitrogen regulatory network to PipY, encoded by the bicistronic operon pipXY in S. elongatus. Work with PipY, the cyanobacterial member of the widespread family of COG0325 proteins, confirms the conserved roles in vitamin B6 and amino/keto acid homeostasis and reveals new PLP-related phenotypes, including sensitivity to antibiotics targeting essential PLP-holoenzymes or synthetic lethality with cysK. In addition, the related phenotypes of pipY and pipX mutants are consistent with genetic interactions in the contexts of survival to PLP-targeting antibiotics and transcriptional regulation. We also showed that PipY overexpression increased the length of S. elongatus cells. Taken together, our results support a universal regulatory role for COG0325 proteins, paving the way to a better understanding of these proteins and of their connections with other biological processes.

  19. Decreased number of interneurons and increased seizures in neuropilin 2 deficient mice: implications for autism and epilepsy.

    Science.gov (United States)

    Gant, John C; Thibault, Oliver; Blalock, Eric M; Yang, Jun; Bachstetter, Adam; Kotick, James; Schauwecker, Paula E; Hauser, Kurt F; Smith, George M; Mervis, Ron; Li, YanFang; Barnes, Gregory N

    2009-04-01

    Clinically, perturbations in the semaphorin signaling system have been associated with autism and epilepsy. The semaphorins have been implicated in guidance, migration, differentiation, and synaptic plasticity of neurons. The semaphorin 3F (Sema3F) ligand and its receptor, neuropilin 2 (NPN2) are highly expressed within limbic areas. NPN2 signaling may intimately direct the apposition of presynaptic and postsynaptic locations, facilitating the development and maturity of hippocampal synaptic function. To further understand the role of NPN2 signaling in central nevous system (CNS) plasticity, structural and functional alterations were assessed in NPN2 deficient mice. In NPN2 deficient mice, we measured seizure susceptibility after kainic acid or pentylenetetrazol, neuronal excitability and synaptic throughput in slice preparations, principal and interneuron cell counts with immunocytochemical protocols, synaptosomal protein levels with immunoblots, and dendritic morphology with Golgi-staining. NPN2 deficient mice had shorter seizure latencies, increased vulnerability to seizure-related death, were more likely to develop spontaneous recurrent seizure activity after chemical challenge, and had an increased slope on input/output curves. Principal cell counts were unchanged, but GABA, parvalbumin, and neuropeptide Y interneuron cell counts were significantly reduced. Synaptosomal NPN2 protein levels and total number of GABAergic synapses were decreased in a gene dose-dependent fashion. CA1 pyramidal cells showed reduced dendritic length and complexity, as well as an increased number of dendritic spines. These data suggest the novel hypothesis that the Sema 3F signaling system's role in appropriate placement of subsets of hippocampal interneurons has critical downstream consequences for hippocampal function, resulting in a more seizure susceptible phenotype.

  20. Effect of Nitrogen, Phosphorus and Potassium on the Dynamics of Synthesis of Nucleic Acids and Proteins in the Different Phases of Wheat Development

    Energy Technology Data Exchange (ETDEWEB)

    Martinovic, B.; Grujic-Injac, B.; Jelenic, Dj. [Institute for the Application of Nuclear Energy in Agriculture, Veterinary Medicine and Forestry, Belgrade (Yugoslavia)

    1968-07-01

    The influence of different nitrogen, phosphorus and potassium levels on the dynamics of RNA synthesis and raw proteins, as well as the uptake of phosphorus in the different phases of wheat development, were studied by applying radioactive phosphorus {sup 32}P . The rate of the uptake of phosphorus is proportional to its concentration in the nutrient supply in all phases of wheat development, in spite of the fact that the uptake of phosphorus during vegetation decreases with the plant's maturity. The influence of nitrogen on the uptake of phosphorus is inversely proportional to the concentration of nitrogen in the nutrient, while the influence of potassium depends on the relation of the amounts of nitrogen and phosphorus. The increased levels of nitrogen and phosphorus are directly proportional to the increase of RNA synthesis, and conversely the decrease of these levels decreases the RNA synthesis. The RNA synthesis decreases with the wheat's maturity during vegetation and is considerably greater in the first phase than in the later phases of the plant's development. Nitrogen and phosphorus have the greatest influence on protein synthesis; potassium has far less influence. These investigations show that the synthesis of nucleic acids and the building up of phosphorus in the RNA-fraction is directly proportional to the concentration of nitrogen in the nutrient supply, even though the uptake of phosphorus by wheat is not proportional to the increased nitrogen levels. Investigations now being carried out provide further explanations concerning the mutual relationship of some forms of RNA of the cells and the amino acids in the synthesis of certain protein fractions of wheat under the influence of different levels of nitrogen, phosphorus and potassium. (author)

  1. Efficiency of Different Nitrogen Forms in Buckwheat (Fagopyrum esculentum Moench

    Directory of Open Access Journals (Sweden)

    Burhan Kara

    2016-06-01

    Full Text Available The research was carried out with aim to determination the efficient of nitrogen forms (ammonium sulfate, ammonium nitrate and urea on nitrogen use efficient for buckwheat in Isparta during 2014 and 2015 years. All the examined characteristics were determined higher values in applied nitrogen forms according to non-nitrogen parcel. In compared to nitrogen forms, the highest grain yield (1456 and 1325 kg ha-1, biological yield (4873 and 4512 kg ha-1, 1000 grain weight (24.9 and 24.8 g, agronomic efficient (24.96% and 24.25%, recycling efficient (0.24% and 0.22% and utilization efficient (0.25% and 0.18% were obtained from ammonium sulfate, the highest protein content (11.37% and 12.44% and agro-physiological efficient (0.27% and 0.24% from ammonium nitrate in both years. Among the nitrogen forms weren’t significant differently in physiological efficient in both years, recycling and utilization efficient in the first year. The mineral nutrient content varied according to nitrogen forms. Generally, ammonium sulfate was positive effect to yield and some quality parameters.

  2. Microbial Protein Production and Nitrogen Balance of Local Steer Fed Ammoniated Rice Straws Added

    Directory of Open Access Journals (Sweden)

    H Hindratiningrum

    2009-05-01

    Full Text Available The objective of the experiment was to investigate the kind of energy source feedstuffs on nutrient balance and microbial protein synthesis in local male beef cattle fed with ammoniated rice straws Twenty steers Peranakan Ongole (PO with average age 1-2 years old were used. They were divided 5 groups based on initial body weight as block. Therefore, Completely Randomised Block Design (CBRD was used for this experiment. Data were analysed by analysis variance and continued honestly significant different (HSD to test the differences between means. The result showed that the range MCP and eficiency MCP were 154,61 g/d until 226,54 g/d and 54,08 gMCP/kg DOMR until 62,64 gMCP/kg DOMR. The range of nitrogen balance were 72,28 gram until 111,67 gram. MCP and efficiency MCP were not affected (P>0,05 by the treatments but balance of nitrogen was affected (P<0,05. Diet containing fresh cassava waste as energy source (R2 was lower (P<0,05 than R1 and R4 while between R1,R3 and R4 was similar. This results indicate that feed source of energy (rice brand, wet cassava waste, dry cassava waste and corn can be used in steers with rice straw ensilage as forage. (Animal Production 11(2: 116-121 (2009 Key Words : Microbial protein production, nitrogen balance, rice straw, ensilage

  3. Effect of prolonged intravenous glucose and essential amino acid infusion on nitrogen balance, muscle protein degradation and ubiquitin-conjugating enzyme gene expression in calves

    Directory of Open Access Journals (Sweden)

    Scaife Jes R

    2008-02-01

    Full Text Available Abstract Background Intravenous infusions of glucose and amino acids increase both nitrogen balance and muscle accretion. We hypothesised that co-infusion of glucose (to stimulate insulin and essential amino acids (EAA would act additively to improve nitrogen balance by decreasing muscle protein degradation in association with alterations in muscle expression of components of the ubiquitin-proteasome proteolytic pathway. Methods We examined the effect of a 5 day intravenous infusions of saline, glucose, EAA and glucose + EAA, on urinary nitrogen excretion and muscle protein degradation. We carried out the study in 6 restrained calves since ruminants offer the advantage that muscle protein degradation can be assessed by excretion of 3 methyl-histidine and multiple muscle biopsies can be taken from the same animal. On the final day of infusion blood samples were taken for hormone and metabolite measurement and muscle biopsies for expression of ubiquitin, the 14-kDa E2 ubiquitin conjugating enzyme, and proteasome sub-units C2 and C8. Results On day 5 of glucose infusion, plasma glucose, insulin and IGF-1 concentrations were increased while urea nitrogen excretion and myofibrillar protein degradation was decreased. Co-infusion of glucose + EAA prevented the loss of urinary nitrogen observed with EAA infusions alone and enhanced the increase in plasma IGF-1 concentration but there was no synergistic effect of glucose + EAA on the decrease in myofibrillar protein degradation. Muscle mRNA expression of the ubiquitin conjugating enzyme, 14-kDa E2 and proteasome sub-unit C2 were significantly decreased, after glucose but not amino acid infusions, and there was no further response to the combined infusions of glucose + EAA. Conclusion Prolonged glucose infusion decreases myofibrillar protein degradation, prevents the excretion of infused EAA, and acts additively with EAA to increase plasma IGF-1 and improve net nitrogen balance. There was no evidence of

  4. Non-food applications of Jatropha protein

    OpenAIRE

    Lestari, D.

    2012-01-01

    The aim of this thesis is to explore how to gain more value per hectare Jatropha curcas by utilizing Jatropha protein for various applications. Specifically, this research investigated the extractability and functional properties of Jatropha protein for non-food/technical applications. Jatropha press cake and leaves are the potential sources of protein. Jatropha proteins can be extracted from Jatropha seed press cake or leaves, with or without detoxification to remove the toxic phorbol esters...

  5. Relationship of Nitrogen Use Efficiency with the Activities of Enzymes Involved in Nitrogen Uptake and Assimilation of Finger Millet Genotypes Grown under Different Nitrogen Inputs

    Directory of Open Access Journals (Sweden)

    Nidhi Gupta

    2012-01-01

    Full Text Available Nitrogen responsiveness of three-finger millet genotypes (differing in their seed coat colour PRM-1 (brown, PRM-701 (golden, and PRM-801 (white grown under different nitrogen doses was determined by analyzing the growth, yield parameters and activities of nitrate reductase (NR, glutamine synthetase (GS, glutamate synthase; GOGAT, and glutamate dehydrogenase (GDH at different developmental stages. High nitrogen use efficiency and nitrogen utilization efficiency were observed in PRM-1 genotype, whereas high nitrogen uptake efficiency was observed in PRM-801 genotype. At grain filling nitrogen uptake efficiency in PRM-1 negatively correlated with NR, GS, GOGAT activities whereas it was positively correlated in PRM-701 and PRM-801, however, GDH showed a negative correlation. Growth and yield parameters indicated that PRM-1 responds well at high nitrogen conditions while PRM-701 and PRM-801 respond well at normal and low nitrogen conditions respectively. The study indicates that PRM-1 is high nitrogen responsive and has high nitrogen use efficiency, whereas golden PRM-701 and white PRM-801 are low nitrogen responsive genotypes and have low nitrogen use efficiency. However, the crude grain protein content was higher in PRM-801 genotype followed by PRM-701 and PRM-1, indicating negative correlation of nitrogen use efficiency with source to sink relationship in terms of seed protein content.

  6. Utilization of alimentary protein and amino acids in satisfying the nitrogen requirements of monogastric mammals

    International Nuclear Information System (INIS)

    Pion, R.; Arnal, M.

    1976-01-01

    The nitrogenous matter in the food of monogastric animals consists mainly of proteins, which are rapidly hydrolized in the intestinal tract when they have left the gastric reservoir. The digestive tube has several roles: it provides for hydrolysis of the food proteins and for a supply of endogenous nitrogen; it enables a certain digestive function to be performed by the intestinal flora and permits the transport of amino acids into the blood, selecting those which are needed for protein synthesis. The digestion products appear mainly in the form of free amino acids in the portal blood. A large proportion of these amino acids is taken up by the liver, so that intense protein synthesis takes place in the latter, coupled with a decrease in catabolism leading to a rhythmic increase in the liver content of proteins and RNA. The labile proteins retained are mainly enzymes, which catabolize the amino acids, and the liver is the site of the catabolism of most of the excess amino acids except those with chain branching. Alimentary deficiencies do not markedly reduce protein synthesis in this organ, since the rate of re-utilization of the amino acids is increased and the liver thus plays a regulatory role. The utilization of amino acids in muscle also follows a certain rhythm, partly connected with feeding, and under hormonal control. The muscle is the seat of catabolism of a large part of the branched chain amino acids, and like the liver it contributes to the energy utilization of amino acids. The rate of utilization of certain essential amino acids can be measured by metabolic criteria, including determination of blood and muscle concentrations and excretion of 14 CO 2 labels in the exhaled air or of 35 S labels in urine. (author)

  7. Measurements of protein turnover in man with nitrogen-15

    International Nuclear Information System (INIS)

    Garlick, P.J.; Waterlow, J.C.

    1977-01-01

    Past and present methods of measuring total body protein turnover with 15 N-labelled compounds are reviewed, and a short assessment made of results achieved. Protein turnover in man was first measured by Sprinson and Rittenberg (1949) using 15 N glycine as tracer. The rate of turnover was calculated from the fraction of the dose excreted in urine in the days following a single oral dose of the isotope. In the following years a number of similar methods were devised but interest waned, perhaps because consistent changes in turnover rate under different conditions were not detected. A revival of interest came with the measurement of changes in protein turnover in malnourished and recovering children by Picou and Taylor-Roberts (1969). Nitrogen-15-glycine was infused and measurements were made of the abundance of 15 N in urinary urea, which reached a plateau in about 24 hours. Turnover rates were calculated from the proportion of the infused dose excreted in urea after the plateau had been reached. This method has also been used successfully on adults when the isotope has been given as three-hourly oral doses. In adults, however, plateau labelling in urea is not usually reached for two days. In our laboratory the use of urinary ammonia, which reaches a plateau more quickly than urea, has been examined. In addition, comparisons have been made between constant infusion and single dose of isotope. Halliday and McKeran (1975) infused 15 N-lysine and measured the 15 N abundance in the free lysine of plasma, which reached a plateau in about 12 hours. Turnover in the whole body and turnover of muscle proteins and of plasma albumin were estimated separately. These methods of measuring protein turnover with 15 N are described and results reviewed of the effects of food intake, nutritional status and age. (author)

  8. Aluminum surface modification by a non-mass-analyzed nitrogen ion beam

    Science.gov (United States)

    Ohira, Shigeo; Iwaki, Masaya

    Non-mass-analyzed nitrogen ion implantation into polycrystal and single crystal aluminum sheets has been carried out at an accelerating voltage of 90 kV and a dose of 1 × 10 18 N ions/cm 2 using a Zymet implanter model Z-100. The pressure during implantation rose to 10 -3 Pa due to the influence of N gas feeding into the ion source. The characteristics of the surface layers were investigated by means of Auger electron spectroscopy (AES), X-ray diffraction (XRD), transmission electron diffraction (TED), and microscopy (TEM). The AES depth profiling shows a rectangular-like distribution of N atoms and little migration of O atoms near the surface. The high dose N-implantation forms c-axis oriented aluminum nitride (AIN) crystallines, and especially irradiation of Al single crystals with N ions leads to the formation of a hcp AlN single crystal. It is concluded that the high dose N-implantation in Al can result in the formation of AlN at room temperature without any thermal annealing. Furthermore, non-mass-analyzed N-implantation at a pressure of 10 -3 Pa of the nitrogen atmosphere causes the formation of pure AlN single crystals in the Al surface layer and consequently it can be practically used for AlN production.

  9. Effects of varying ruminally undegradable protein supplementation on forage digestion, nitrogen metabolism, and urea kinetics in Nellore cattle fed low-quality tropical forage.

    Science.gov (United States)

    Batista, E D; Detmann, E; Titgemeyer, E C; Valadares Filho, S C; Valadares, R F D; Prates, L L; Rennó, L N; Paulino, M F

    2016-01-01

    Effects of supplemental RDP and RUP on nutrient digestion, N metabolism, urea kinetics, and muscle protein degradation were evaluated in Nellore heifers () consuming low-quality signal grass hay (5% CP and 80% NDF, DM basis). Five ruminally and abomasally cannulated Nellore heifers (248 ± 9 kg) were used in a 5 × 5 Latin square. Treatments were the control (no supplement) and RDP supplementation to meet 100% of the RDP requirement plus RUP provision to supply 0, 50, 100, or 150% of the RUP requirement. Supplemental RDP (casein plus NPN) was ruminally dosed twice daily, and RUP supply (casein) was continuously infused abomasally. Jugular infusion of [NN]-urea with measurement of enrichment in urine was used to evaluate urea kinetics. The ratio of urinary 3-methylhistidine to creatinine was used to estimate skeletal muscle protein degradation. Forage NDF intake (2.48 kg/d) was not affected ( ≥ 0.37) by supplementation, but supplementation did increase ruminal NDF digestion ( Urea entry rate and gastrointestinal entry rate of urea were increased by supplementation ( urea entry rate and tended ( = 0.07) to linearly increase gastrointestinal entry rate of urea. Urea use for anabolic purposes tended ( = 0.07) to be increased by supplementation, and RUP provision also tended ( = 0.08) to linearly increase the amount of urea used for anabolism. The fraction of recycled urea N incorporated into microbial N was greater ( urea from the renal tubule than did supplemented heifers. Overall, unsupplemented heifers had greater mobilization of AA from myofibrillar protein, which provided N for urea synthesis and subsequent recycling. Supplemental RUP, when RDP was supplied, not only increased N retention but also supported increased urea N recycling and increased ruminal microbial protein synthesis.

  10. Non-food applications of Jatropha protein

    NARCIS (Netherlands)

    Lestari, D.

    2012-01-01

    The aim of this thesis is to explore how to gain more value per hectare Jatropha curcas by utilizing Jatropha protein for various applications. Specifically, this research investigated the extractability and functional properties of Jatropha protein for non-food/technical applications. Jatropha

  11. Distinct domains within the NITROGEN LIMITATION ADAPTATION protein mediate its subcellular localization and function in the nitrate-dependent phosphate homeostasis pathway

    Science.gov (United States)

    The NITROGEN LIMITATION ADAPTATION (NLA) protein is a RING-type E3 ubiquitin ligase that plays an essential role in the regulation of nitrogen and phosphate homeostasis. NLA is localized to two distinct subcellular sites, the plasma membrane and nucleus, and contains four distinct domains: i) a RING...

  12. Optimization of carbon and nitrogen medium components for biomass production using non-Saccharomyces wine yeasts.

    Science.gov (United States)

    Schnierda, T; Bauer, F F; Divol, B; van Rensburg, E; Görgens, J F

    2014-05-01

    The impact of different nitrogen and carbon sources on biomass production of the non-Saccharomyces wine yeast species Lachancea thermotolerans, Metschnikowia pulcherrima and Issatchenkia orientalis was assessed. Using a molasses-based medium, yeast extract and corn steep liquor as well as ammonium sulphate and di-ammonium phosphate (DAP) as nitrogen sources were compared in shake-flask cultures. A medium with 20 g l⁻¹ sugar (diluted molasses) and 500 mg l⁻¹ total yeast assimilable nitrogen, from yeast extract, gave the highest biomass concentrations and yields. Invertase pretreatment was required for cultures of M. pulcherrima and I. orientalis, and respective biomass yields of 0.7 and 0.8 g g⁻¹ were achieved in aerobic bioreactor cultures. The absence of ethanol production suggested Crabtree-negative behaviour by these yeasts, whereas Crabtree-positive behaviour by L. thermotolerans resulted in ethanol and biomass concentrations of 5.5 and 11.1 g l⁻¹, respectively. Recent studies demonstrate that non-Saccharomyces yeasts confer positive attributes to the final composition of wine. However, optimal process conditions for their biomass production have not been described, thereby limiting commercial application. In this study, industrial media and methods of yeast cultivation were investigated to develop protocols for biomass production of non-Saccharomyces yeast starter cultures for the wine industry. © 2014 The Society for Applied Microbiology.

  13. Backbone dynamics of the EIAV-Tat protein from 15N relaxation studies

    International Nuclear Information System (INIS)

    Ejchart, A.; Herrmann, F.; Roesch, P.; Sticht, H.; Willbold, D.

    1994-01-01

    The work investigates the mobility of EIAV-Tat protein backbone by measuring the relaxation parameters of the 15 N nitrogens. High degree of the flexibility, non-typical of rigid, well structured proteins was shown

  14. Influence of Non-fibrous Carbohydrate and Degradable Intake protein and Ruminal Fermentation ,Nutrien Digestion and performance of Local Sheep

    Directory of Open Access Journals (Sweden)

    Efka AR

    2001-05-01

    Full Text Available The objective of current study was to evaluate the impact dietary non-fibrous carbohydrate ( NFC and ruminally degradable intake protein (DIP concentration have on ruminal fermentation , nutrient digestion and performance of local sheep. The animal had a mean of  liveweight 19.80 ±1.55 kg. four diets ,arranged in a 2x2 factorial ,were formulated to contain either 40 or 50 % NFC and 50 or 60 % of dietary crude protein as DIP .dietary DM contained 25 % Indonesian field grass and 75 % concentrate. Solvent –extracted or formaldehyd  2 % -treated soybean meal were used to alter DIP and corn or soybean hulls to alter NFC level. Percentage of  energy and NDF digestion was similar ( p<0,01 as DIP level decreased in the diets. The soybean hulls was fermentable and total VFA concentration in the rumen increased ( p<0.01, but N-NH3 concentration was decreased ( p<0.01 as DIP level decreased in the diets. Daily live weight gain ( 146.29±25.84 g and body composition ( fat, water , protein and mineral was similar ( p<0.05 among diets. The preponderance ruminal fermentation ,nutrient digestion and performance of local sheeps did not be improved by sincronization of energy and nitrogen release but may more likely be limited by either energy or nitrogen alone. (Animal Production 3(2: 53-61 (2001 Key Word : Carbohydrate, protein, rumen fermentation, nutrients digestion and performance

  15. Globular and disordered-the non-identical twins in protein-protein interactions

    DEFF Research Database (Denmark)

    Teilum, Kaare; Olsen, Johan Gotthardt; Kragelund, Birthe Brandt

    2015-01-01

    as a strong determinant for their function. This has fostered the notion that IDP's bind with low affinity but high specificity. Here we have analyzed available detailed thermodynamic data for protein-protein interactions to put to the test if the thermodynamic profiles of IDP interactions differ from those...... of other protein-protein interactions. We find that ordered proteins and the disordered ones act as non-identical twins operating by similar principles but where the disordered proteins complexes are on average less stable by 2.5 kcal mol(-1)....

  16. Transfer of biologically fixed nitrogen to the non-legume component of mixed pastures

    International Nuclear Information System (INIS)

    Haystead, A.

    1983-01-01

    Pasture ecosystems are extremely diverse, as are the management procedures imposed upon them by the pastoralist. In low input pasture enterprises in marginal areas, legume nitrogen fixation is frequently (but not invariably) crucial to continued productivity. Legumes usually do not dominate a pasture and their role in transferring fixed nitrogen to a non-legume, frequently graminaceous, species is important. Methods for measuring this transfer are critically assessed in terms of their usefulness in realistic pasture environments. Existing techniques all have serious disadvantages in this respect. Isotopic studies of individual processes within the transfer system are described and some new lines of investigation are proposed. The value of isotopic studies in improving pasture management is discussed. (author)

  17. Non-Canonical Roles of Dengue Virus Non-Structural Proteins

    Directory of Open Access Journals (Sweden)

    Julianna D. Zeidler

    2017-03-01

    Full Text Available The Flaviviridae family comprises a number of human pathogens, which, although sharing structural and functional features, cause diseases with very different outcomes. This can be explained by the plurality of functions exerted by the few proteins coded by viral genomes, with some of these functions shared among members of a same family, but others being unique for each virus species. These non-canonical functions probably have evolved independently and may serve as the base to the development of specific therapies for each of those diseases. Here it is discussed what is currently known about the non-canonical roles of dengue virus (DENV non-structural proteins (NSPs, which may account for some of the effects specifically observed in DENV infection, but not in other members of the Flaviviridae family. This review explores how DENV NSPs contributes to the physiopathology of dengue, evasion from host immunity, metabolic changes, and redistribution of cellular components during infection.

  18. Catalytic/non-catalytic combination process for nitrogen oxides reduction

    International Nuclear Information System (INIS)

    Luftglass, B.K.; Sun, W.H.; Hofmann, J.E.

    1992-01-01

    This patent describes a process for the reduction of nitrogen oxides in the effluent from the combustion of a carbonaceous fuel. It comprises introducing a nitrogenous treatment agent comprising urea, one or more of the hydrolysis products of urea, ammonia, compounds which produce ammonia as a by-product, ammonium salts of organic acids, 5- or 6-membered heterocyclic hydrocarbons having at least one cyclic nitrogen, hydroxy amino hydrocarbons, or mixtures thereof into the effluent at an effluent temperature between about 1200 degrees F and about 2100 degrees F; and contacting the treated effluent under conditions effective to reduce the nitrogen oxides in the effluent with a catalyst effective for the reduction of nitrogen oxides in the presence of ammonia

  19. Chemical composition and deoxynivalenol in wheat of Central- Southern Paraná: nitrogen fertilization in top dressing associated with Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    Thiago Montagner Souza

    2014-02-01

    Full Text Available The impact of agricultural management practices on the quality of grain was evaluated in wheat (Triticum aestivum L. BRS Tangará from the South Central region of Paraná State (Ponta Grossa in the crop years of 2010 and 2011. The field trial was carried out in succession with soybean (2010 and corn (2011. The treatments included inoculation of seeds with Azospirillum brasilense and increasing levels of nitrogen application in top dressing (0, 30, 60, 90 and 120 kg ha-1. The experimental design was in randomized block, factorial 2 x 5 (inoculation x N levels, with four replications. The parameters evaluated were water activity, moisture, protein, and grain contamination by deoxynivalenol (DON. The data were subjected to analysis of variance, comparison of means by Tukey’s test (p<0.05 and regression for nitrogen levels. The inoculation of seeds with A. brasilense increased the protein content in grain in 2010 (+1.6%; 16.9 g 100g-1 and 2011 (+1.7%, 15.7 g 100g-1, independently of the nitrogen level (p<0.01. Levels of nitrogen in 2010 presented a positive linear response with protein content, increasing by 14.2% using non-inoculated seeds (p<0.01, R2=0.955 and 14.4% for those inoculated with A. brasilense (p<0.01, R2=0.906. However, in 2011 a quadratic response was observed between nitrogen levels and protein content (p<0.01, R2=0.99, with stabilization or reduction in protein content using high levels of nitrogen (?120 kg ha-1. The contamination by DON was greater using high levels of nitrogen (3574 ?g kg-1, 120 kg ha-1; non-inoculated seeds in 2011, with a quadratic response between nitrogen levels and contamination of grains (p<0.05, R2=0.772. Furthermore, 37.5% of the samples presented contamination by DON higher than the maximum tolerated limit established by Brazilian legislation (2000 ?g kg-1; whole-wheat grain. The data demonstrates that proper management of nitrogen enhances intrinsic effects arising from plant breeding.

  20. Genome-wide identification and functional prediction of nitrogen-responsive intergenic and intronic long non-coding RNAs in maize (Zea mays L.).

    Science.gov (United States)

    Lv, Yuanda; Liang, Zhikai; Ge, Min; Qi, Weicong; Zhang, Tifu; Lin, Feng; Peng, Zhaohua; Zhao, Han

    2016-05-11

    Nitrogen (N) is an essential and often limiting nutrient to plant growth and development. Previous studies have shown that the mRNA expressions of numerous genes are regulated by nitrogen supplies; however, little is known about the expressed non-coding elements, for example long non-coding RNAs (lncRNAs) that control the response of maize (Zea mays L.) to nitrogen. LncRNAs are a class of non-coding RNAs larger than 200 bp, which have emerged as key regulators in gene expression. In this study, we surveyed the intergenic/intronic lncRNAs in maize B73 leaves at the V7 stage under conditions of N-deficiency and N-sufficiency using ribosomal RNA depletion and ultra-deep total RNA sequencing approaches. By integration with mRNA expression profiles and physiological evaluations, 7245 lncRNAs and 637 nitrogen-responsive lncRNAs were identified that exhibited unique expression patterns. Co-expression network analysis showed that the nitrogen-responsive lncRNAs were enriched mainly in one of the three co-expressed modules. The genes in the enriched module are mainly involved in NADH dehydrogenase activity, oxidative phosphorylation and the nitrogen compounds metabolic process. We identified a large number of lncRNAs in maize and illustrated their potential regulatory roles in response to N stress. The results lay the foundation for further in-depth understanding of the molecular mechanisms of lncRNAs' role in response to nitrogen stresses.

  1. A nitrogen response pathway regulates virulence in plant pathogenic fungi: role of TOR and the bZIP protein MeaB.

    Science.gov (United States)

    López-Berges, Manuel S; Rispail, Nicolas; Prados-Rosales, Rafael C; Di Pietro, Antonio

    2010-12-01

    Virulence in plant pathogenic fungi is controlled through a variety of cellular pathways in response to the host environment. Nitrogen limitation has been proposed to act as a key signal to trigger the in planta expression of virulence genes. Moreover, a conserved Pathogenicity mitogen activated protein kinase (MAPK) cascade is strictly required for plant infection in a wide range of pathogens. We investigated the relationship between nitrogen signaling and the Pathogenicity MAPK cascade in controlling infectious growth of the vascular wilt fungus Fusarium oxysporum. Several MAPK-activated virulence functions such as invasive growth, vegetative hyphal fusion and host adhesion were strongly repressed in the presence of the preferred nitrogen source ammonium. Repression of these functions by ammonium was abolished by L-Methionine sulfoximine (MSX) or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR (Target Of Rapamycin), respectively, and was dependent on the bZIP protein MeaB. Supplying tomato plants with ammonium rather than nitrate resulted in a significant delay of vascular wilt symptoms caused by the F. oxysporum wild type strain, but not by the ΔmeaB mutant. Ammonium also repressed invasive growth in two other pathogens, the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. Our results suggest the presence of a conserved nitrogen-responsive pathway that operates via TOR and MeaB to control infectious growth in plant pathogenic fungi.

  2. Stimulation effect of synthetic cytokinins on the uptake and incorporation of nitrogen-15-labelled ammonium nitrate and urea in wheat leaves

    International Nuclear Information System (INIS)

    Iglewski, S.M.; Szarvas, T.; Pozsar, B.I.

    1977-01-01

    The turnover of different labelled nitrogen sources in wheat leaves has been investigated using the isotopic tracer technique. The 15 N at.% was determined in free ammonium ion, in the nitrate and the nitrite levels, and also in the non-disintegrated urea. The accumulation and the incorporation of stable nitrogen was measured in the TCA insoluble protein fraction. According to the experimental data the intensity of incorporation of urea nitrogen is relatively higher than that of the different inorganic compounds. The utilization of ammonium ion was 76% compared with the urea, whereas that of the nitrate nitrogen was 60% in the wheat leaves. The incorporation rate of the two nitrogen atoms from ammonium nitrate was 32% lower than that of the urea nitrogen, in the leaf protein of Bezostaia-1 wheat variety. The turnover of urea through the transamination was very rapid, the amination with ammonium ion was slower, and the first phase of the nitrate reduction was relatively more retarded than the nitrite reduction. The endogenous cytokinin-like biological activity and some synthetic cytokinins (kinetin, benzyladenine) have a remarkably stimulating effect on the incorporation of the different 15 N-labelled nitrogen sources into the leaf protein fraction. (author)

  3. Non-platinum nanocatalyst on porous nitrogen-doped carbon fabricated by cathodic vacuum arc plasma technique

    Energy Technology Data Exchange (ETDEWEB)

    Sirirak, Reungruthai [Material Science Research Center, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Department of Chemistry and Center of Excellence for Innovation in Chemistry (PERCH-CIC), Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Sarakonsri, Thapanee, E-mail: tsarakonsri@gmail.com [Material Science Research Center, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Department of Chemistry and Center of Excellence for Innovation in Chemistry (PERCH-CIC), Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Medhesuwakul, Min [Plasma & Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand)

    2015-11-30

    Highlights: • High surface area porous coral-like nitrogen-doped carbon (NC) and non-platinum nanocatalysts were fabricated on proton exchange membrane using the cathodic vacuum arc plasma (CVAP) technique. • It is a one-step catalysts preparation directly on nafion proton exchange membrane. This CVAP technique is the first new method that was applied in a polymer electrolyte membrane fuel cells (PEMFCs) catalysts preparation. • Due to these excellent characteristics of nitrogen-doped carbon, it is expected to exhibit a good catalyst supporter for PEMFC. • In addition, the Fe–NC catalysts fabricated via this CVAP technique are sphere-like nanoparticle and well disperse on coral-like NC film, which particularity exhibits that these prepared catalysts ought to be a good oxygen reduction reaction (ORR) catalyst for PEMFC. • This approach can be extended to the synthesis of other non-platinum ORR catalyst for broad range applications in energy conversion. - Abstract: Polymer electrolyte membrane fuel cells (PEMFCs) convert chemical energy directly into electrical energy where catalysts composing of non-noble transition metals, nitrogen, and carbon compounds are the most promising materials to replace the expensive platinum catalysts for oxygen reduction reaction (ORR). In this research, cathodic vacuum arc plasma (CVAP) technique was used to fabricate porous nitrogen doped carbon (NC) and non-platinum catalyst on porous NC (Fe–NC) directly on ion exchange membrane for being used as an ORR catalyst at the cathode. The porous NC layer was fabricated on silicon wafer at 0.05 mTorr, 0.1 mTorr, 0.5 mTorr, 1 mTorr, and 5 mTorr of nitrogen gas inlet. The AFM, and SEM images are observed to be regularly big with quite high hillocks and thin NC layers; these results indicate that the optimum process pressure of nitrogen gas inlet is 5 mTorr for porous NC fabrication. The SEM–EDS detects Fe, N, and C elements in the prepared catalysts, and the XRD pattern reviews

  4. Non-platinum nanocatalyst on porous nitrogen-doped carbon fabricated by cathodic vacuum arc plasma technique

    International Nuclear Information System (INIS)

    Sirirak, Reungruthai; Sarakonsri, Thapanee; Medhesuwakul, Min

    2015-01-01

    Highlights: • High surface area porous coral-like nitrogen-doped carbon (NC) and non-platinum nanocatalysts were fabricated on proton exchange membrane using the cathodic vacuum arc plasma (CVAP) technique. • It is a one-step catalysts preparation directly on nafion proton exchange membrane. This CVAP technique is the first new method that was applied in a polymer electrolyte membrane fuel cells (PEMFCs) catalysts preparation. • Due to these excellent characteristics of nitrogen-doped carbon, it is expected to exhibit a good catalyst supporter for PEMFC. • In addition, the Fe–NC catalysts fabricated via this CVAP technique are sphere-like nanoparticle and well disperse on coral-like NC film, which particularity exhibits that these prepared catalysts ought to be a good oxygen reduction reaction (ORR) catalyst for PEMFC. • This approach can be extended to the synthesis of other non-platinum ORR catalyst for broad range applications in energy conversion. - Abstract: Polymer electrolyte membrane fuel cells (PEMFCs) convert chemical energy directly into electrical energy where catalysts composing of non-noble transition metals, nitrogen, and carbon compounds are the most promising materials to replace the expensive platinum catalysts for oxygen reduction reaction (ORR). In this research, cathodic vacuum arc plasma (CVAP) technique was used to fabricate porous nitrogen doped carbon (NC) and non-platinum catalyst on porous NC (Fe–NC) directly on ion exchange membrane for being used as an ORR catalyst at the cathode. The porous NC layer was fabricated on silicon wafer at 0.05 mTorr, 0.1 mTorr, 0.5 mTorr, 1 mTorr, and 5 mTorr of nitrogen gas inlet. The AFM, and SEM images are observed to be regularly big with quite high hillocks and thin NC layers; these results indicate that the optimum process pressure of nitrogen gas inlet is 5 mTorr for porous NC fabrication. The SEM–EDS detects Fe, N, and C elements in the prepared catalysts, and the XRD pattern reviews

  5. Sensitivity of nitrogen dioxide concentrations to oxides of nitrogen controls in the United Kingdom

    International Nuclear Information System (INIS)

    Dixon, J.

    2001-01-01

    There is a possibility of further controls on emissions to the atmosphere of nitrogen dioxides to meet air quality objectives in the UK. Data in the National Air Quality Archive were used to calculate the likely sensitivity of hourly concentrations of nitrogen dioxide in ambient urban air to changes in the total oxides of nitrogen. Since the role of atmospheric chemical reactions is to make the responses non-linearly dependent on the emissions control, we seek to establish the magnitude and sign of the effects that this non-linearity might cause. We develop a quantitative approach to analysing the non-linearity in the data. Polynomial fits have been developed for the empirical ratio NO 2 :NO x (the 'yield'). They describe nitrogen dioxide concentrations using total oxides of nitrogen. The new functions have the important feature of increased yield in winter episodes. Simpler functions tend to omit this feature of the yields at the highest hourly concentrations. Based on this study, the hourly nitrogen dioxide objective in the UK may require emissions control of no more than about 50% on total oxides of nitrogen at the most polluted sites: other sites require less or even no control. (Author)

  6. Nitrogen in global animal production and management options for improving nitrogen use efficiency

    NARCIS (Netherlands)

    Oenema, O.; Tamminga, S.

    2005-01-01

    Animal production systems convert plant protein into animal protein. Depending on animal species, ration and management, between 5% and 45 % of the nitrogen (N) in plant protein is converted to and deposited in animal protein. The other 55%-95% is excreted via urine and feces, and can be used as

  7. Application of the Open Cycle Stirling Engine Driven with Liquid Nitrogen for the Non-Polluting Automobiles

    Directory of Open Access Journals (Sweden)

    M.B. Kravchenko

    2017-10-01

    Full Text Available Progress on advancing technology of using liquid nitrogen for the non-polluting automobiles is reported. It is shown that the low exergy efficiency of the known engines fueled with liquid nitrogen has discredited the very idea of a cryomobile. The design of the open-cycle cryogenic Stirling engine is proposed. This engine allows extracting up to 57% of the exergy accumulated in liquid nitrogen. The method used to calculate of such open-cycle Stirling engine is described and the calculation results and discussion are presented. It is shown that 200 liters of liquid nitrogen is sufficient for 180 km range of cryomobile at speed of 55 km/h, while a full charge of the 300-kilogram battery of Nissan LEAF electric vehicle is sufficient for a range of 160 km. Use of liquid nitrogen or liquid air as an energy vector in a transport will not require scarce materials, and, in comparison with using of lithium-ion batteries or hydrogen, this will require less capital investment.

  8. Storage and recycling utilization of leaf-nitrogen of jujube tree

    International Nuclear Information System (INIS)

    Zeng Xiang; Hao Zhongning

    1991-01-01

    16 N-urea was foliarly applied on bearing or young jujube tree in autumn of 1987. The effects of leaf-nitrogen retranslocation in the trees, positions of the N stored, forms of reserved N, and reutilization of storage N in the next year were studied. The results were as follows: 15 N returned and stored in all parts of the tree following foliar application of 15 N-urea. Root could use the nitrogen not only absorbed from soil but also transported from leaves. The above-ground organs and roots of jujube tree played the same important roles on nitrogen storage in winter. The main forms of storage nitrogen were protein-N, which was 2-3 fold more than non-protein-N. The storage nitrogen existed in above-ground parts was used first in early spring, and that returned from leaves last year could be prior used for the developments of leaves, branchlets and infloresences. The relative distribution of nitrogen in floresence was more in bearing tree than in young tree. In the next year, 15 N was redistributed in branchlets, leaves, flowers, young fruits and perennial spurs in autumn. The 15 N transported out of the treated spurs reappeared in next spring and further transported to neighboring spurs. The local storage N was prior used for growth. There was 21.49% of fertilizer-N stored in the young jujube trees when treated foliarly with urea in autumn of 1987. After one years's use, there was still 18.91% of fertilizer-N existed in the trees, which indicated a characteristic of circulatory utilization of nitrogen for a long period and the reutilized nitrogen was mainly from jujube leaves and deciduous branchlets

  9. Urinary Excretion of Sodium, Nitrogen, and Sugar Amounts Are Valid Biomarkers of Dietary Sodium, Protein, and High Sugar Intake in Nonobese Adolescents.

    Science.gov (United States)

    Moore, Lori B; Liu, Sarah V; Halliday, Tanya M; Neilson, Andrew P; Hedrick, Valisa E; Davy, Brenda M

    2017-12-01

    Background: Objective indicators of dietary intake (e.g., biomarkers) are needed to overcome the limitations of self-reported dietary intake assessment methods in adolescents. To our knowledge, no controlled feeding studies to date have evaluated the validity of urinary sodium, nitrogen, or sugar excretion as dietary biomarkers in adolescents. Objective: This investigation aimed to evaluate the validity of urinary sodium, nitrogen, and total sugars (TS) excretion as biomarkers for sodium, protein, and added sugars (AS) intake in nonobese adolescents. Methods: In a crossover controlled feeding study design, 33 adolescents [12-18 y of age, 47 ± 25th percentile (mean ± SD) of body mass index (BMI; in kg/m 2 ) for age] consumed 5% AS [low added sugars (LAS)] and 25% AS [high added sugars (HAS)] isocaloric, macronutrient-matched (55% carbohydrate, 30% fat, and 15% protein) diets for 7 d each, in a randomly assigned order, with a 4-wk washout period between diets. On the final 2 d of each diet period, 24-h urine samples were collected. Thirty-two adolescents completed all measurements (97% retention). Results: Urinary sodium was not different from the expected 90% recovery (mean ± SD: 88% ± 18%, P = 0.50). Urinary nitrogen was correlated with protein intake ( r = 0.69, P sodium appears to be a valid biomarker for sodium intake in nonobese adolescents. Urinary nitrogen is associated with protein intake, but nitrogen excretion rates were less than previously reported for adults, possibly owing to adolescent growth rates. TS excretion reflects AS at 25% AS intake and was responsive to the change in AS intake. Thus, urinary biomarkers are promising objective indicators of dietary intake in adolescents, although larger-scale feeding trials are needed to confirm these findings. This trial was registered at clinicaltrials.gov as NCT02455388. © 2017 American Society for Nutrition.

  10. Human Decisions: Nitrogen Footprints and Environmental Effects

    Science.gov (United States)

    Leach, A. M.; Bleeker, A.; Galloway, J. N.; Erisman, J.

    2012-12-01

    Human consumption choices are responsible for growing losses of reactive nitrogen (Nr) to the environment. Once in the environment, Nr can cause a cascade of negative impacts such as smog, acid rain, coastal eutrophication, climate change, and biodiversity loss. Although all humans must consume nitrogen as protein, the food production process releases substantial Nr to the environment. This dilemma presents a challenge: how do we feed a growing population while reducing Nr? Although top-down strategies to reduce Nr losses (e.g., emissions controls) are necessary, the bottom-up strategies focusing on personal consumption patterns will be imperative to solve the nitrogen challenge. Understanding the effects of different personal choices on Nr losses and the environment is an important first step for this strategy. This paper will utilize information and results from the N-Calculator, a per capita nitrogen footprint model (www.N-Print.org), to analyze the impact of different food consumption patterns on a personal food nitrogen footprint and the environment. Scenarios will analyze the impact of the following dietary patterns on the average United States (28 kg Nr/cap/yr) food nitrogen footprint: 1) Consuming only the recommended protein as defined by the WHO and the USDA; 2) Reducing food waste by 50%; 3) Consuming a vegetarian diet; 4) Consuming a vegan diet; 5) Consuming a demitarian diet (replacing half of animal protein consumption with vegetable protein); 6) Substituting chicken (a more efficient animal protein) with beef (a less efficient animal protein); 7) Consuming sustainably-produced food; and 8) Using advanced wastewater treatment. Preliminary results suggest that widespread advanced wastewater treatment with nutrient removal technology and halving food waste would each reduce the US personal food nitrogen footprint by 13%. In addition, reducing protein consumption to the recommended levels would reduce the footprint by about 42%. Combining these measures

  11. Transcriptome study of storage protein genes of field-grown barley in response to inorganic nitrogen fertilizers

    DEFF Research Database (Denmark)

    Hansen, Michael; Bowra, Steve; Lange, Mette

    2010-01-01

    The storage proteins of barley, in terms of both amino acid profile and quantity, are traits strongly influenced by the amount of nitrogen applied. Given this, we performed a developmental expression analysis of the genes from barley grains grown under field conditions to further our understanding...... profile under different N regimes. Reviewing the expression of the storage protein homologues within the families revealed markedly different temporal profiles; for example, some alleles were expressed very early in development. Furthermore, the differential temporal expression of the homologues suggested...

  12. Controlled production of Camembert-type cheeses. Part I: Microbiological and physicochemical evolutions.

    Science.gov (United States)

    Leclercq-Perlat, Marie-Noëlle; Buono, Frédéric; Lambert, Denis; Latrille, Eric; Spinnler, Henry-Eric; Corrieu, Georges

    2004-08-01

    A holistic approach of a mould cheese ripening is presented. The objective was to establish relationships between the different microbiological and biochemical changes during cheese ripening. Model cheeses were prepared from pasteurized milk inoculated with Kluyveromyces lactis, Geotrichum candidum, Penicillium camemberti and Brevibacterium linens under aseptic conditions. Two cheese-making trials with efficient control of environmental parameters were carried out and showed similar ripening characteristics. K. lactis grew rapidly between days 1 and 6 (generation time around 48 h). G. candidum grew exponentially between days 4 and 10 (generation time around 4.6 d). Brevi. linens also grew exponentially but after day 6 when Pen. camemberti mycelium began developing and the pH of the rind was close to 7. Its exponential growth presented 3 phases in relation to carbon and nitrogen substrate availability. Concentrations of Pen. camemberti mycelium were not followed by viable cell count but they were evaluated visually. The viable microorganism concentrations were well correlated with the carbon substrate concentrations in the core and in the rind. The lactose concentrations were negligible after 10 d ripening, and changes in lactate quantities were correlated with fungi flora. The pH of the inner part depended on NH3. Surface pH was significantly related to NH3 concentration and to fungi growth. The acid-soluble nitrogen (ASN) and non-protein nitrogen (NPN) indexes and NH3 concentrations of the rind were low until day 6, and then increased rapidly to follow the fungi concentrations until day 45. The ASN and NPN indexes and NH3 concentrations in the core were lower than in the rind and they showed the same evolution. G. candidum and Pen. camemberti populations have a major effect on proteolysis; nevertheless, K. lactis and Brevi. linens cell lysis also had an impact on proteolysis. Viable cell counts of K. lactis, G. candidum, Pen. camemberti and Brevi. linens were

  13. Estimating causal effects with a non-paranormal method for the design of efficient intervention experiments.

    Science.gov (United States)

    Teramoto, Reiji; Saito, Chiaki; Funahashi, Shin-ichi

    2014-06-30

    Knockdown or overexpression of genes is widely used to identify genes that play important roles in many aspects of cellular functions and phenotypes. Because next-generation sequencing generates high-throughput data that allow us to detect genes, it is important to identify genes that drive functional and phenotypic changes of cells. However, conventional methods rely heavily on the assumption of normality and they often give incorrect results when the assumption is not true. To relax the Gaussian assumption in causal inference, we introduce the non-paranormal method to test conditional independence in the PC-algorithm. Then, we present the non-paranormal intervention-calculus when the directed acyclic graph (DAG) is absent (NPN-IDA), which incorporates the cumulative nature of effects through a cascaded pathway via causal inference for ranking causal genes against a phenotype with the non-paranormal method for estimating DAGs. We demonstrate that causal inference with the non-paranormal method significantly improves the performance in estimating DAGs on synthetic data in comparison with the original PC-algorithm. Moreover, we show that NPN-IDA outperforms the conventional methods in exploring regulators of the flowering time in Arabidopsis thaliana and regulators that control the browning of white adipocytes in mice. Our results show that performance improvement in estimating DAGs contributes to an accurate estimation of causal effects. Although the simplest alternative procedure was used, our proposed method enables us to design efficient intervention experiments and can be applied to a wide range of research purposes, including drug discovery, because of its generality.

  14. Identification of multiply charged proteins and amino acid clusters by liquid nitrogen assisted spray ionization mass spectrometry.

    Science.gov (United States)

    Kumar Kailasa, Suresh; Hasan, Nazim; Wu, Hui-Fen

    2012-08-15

    The development of liquid nitrogen assisted spray ionization mass spectrometry (LNASI MS) for the analysis of multiply charged proteins (insulin, ubiquitin, cytochrome c, α-lactalbumin, myoglobin and BSA), peptides (glutathione, HW6, angiotensin-II and valinomycin) and amino acid (arginine) clusters is described. The charged droplets are formed by liquid nitrogen assisted sample spray through a stainless steel nebulizer and transported into mass analyzer for the identification of multiply charged protein ions. The effects of acids and modifier volumes for the efficient ionization of the above analytes in LNASI MS were carefully investigated. Multiply charged proteins and amino acid clusters were effectively identified by LNASI MS. The present approach can effectively detect the multiply charged states of cytochrome c at 400 nM. A comparison between LNASI and ESI, CSI, SSI and V-EASI methods on instrumental conditions, applied temperature and observed charge states for the multiply charged proteins, shows that the LNASI method produces the good quality spectra of amino acid clusters at ambient conditions without applied any electric field and heat. To date, we believe that the LNASI method is the most simple, low cost and provided an alternative paradigm for production of multiply charged ions by LNASI MS, just as ESI-like ions yet no need for applying any electrical field and it could be operated at low temperature for generation of highly charged protein/peptide ions. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Nitrogen recycling through the gut and the nitrogen economy of ruminants: An asynchronous symbiosis

    DEFF Research Database (Denmark)

    Reynolds, C K; Kristensen, Niels Bastian

    2007-01-01

    The extensive development of the ruminant forestomach sets apart their nitrogen (N) economy from that of nonruminants in a number of respects. Extensive pre-gastric fermentation alters the profile of protein reaching the small intestine, largely through the transformation of nitrogenous compounds...

  16. Biome-scale nitrogen fixation strategies selected by climatic constraints on nitrogen cycle.

    Science.gov (United States)

    Sheffer, Efrat; Batterman, Sarah A; Levin, Simon A; Hedin, Lars O

    2015-11-23

    Dinitrogen fixation by plants (in symbiosis with root bacteria) is a major source of new nitrogen for land ecosystems(1). A long-standing puzzle(2) is that trees capable of nitrogen fixation are abundant in nitrogen-rich tropical forests, but absent or restricted to early successional stages in nitrogen-poor extra-tropical forests. This biome-scale pattern presents an evolutionary paradox(3), given that the physiological cost(4) of nitrogen fixation predicts the opposite pattern: fixers should be out-competed by non-fixers in nitrogen-rich conditions, but competitively superior in nitrogen-poor soils. Here we evaluate whether this paradox can be explained by the existence of different fixation strategies in tropical versus extra-tropical trees: facultative fixers (capable of downregulating fixation(5,6) by sanctioning mutualistic bacteria(7)) are common in the tropics, whereas obligate fixers (less able to downregulate fixation) dominate at higher latitudes. Using a game-theoretic approach, we assess the ecological and evolutionary conditions under which these fixation strategies emerge, and examine their dependence on climate-driven differences in the nitrogen cycle. We show that in the tropics, transient soil nitrogen deficits following disturbance and rapid tree growth favour a facultative strategy and the coexistence of fixers and non-fixers. In contrast, sustained nitrogen deficits following disturbance in extra-tropical forests favour an obligate fixation strategy, and cause fixers to be excluded in late successional stages. We conclude that biome-scale differences in the abundance of nitrogen fixers can be explained by the interaction between individual plant strategies and climatic constraints on the nitrogen cycle over evolutionary time.

  17. Non-protein and agro-industrial by-products utilization by ruminants in Bangladesh

    International Nuclear Information System (INIS)

    Tareque, A.M.M.

    1987-01-01

    A series of experiments were designed to (1) investigate mixtures of locally available feedstuffs, particularly agro-industrial by-products with or without non-protein nitrogen supplementation as production rations for local and imported breeds of ruminants, (2) formulate rations based on locally available feedstuffs which can be compounded either on a large scale or at the village level for local animals, (3) determine the nutritive value of some non-conventional feedstuffs in terms of their digestibility and their ability to promote microbial synthesis. Rice straw, constituting about 85% of the total available feed dry matter in Bangladesh, is considered a basal, or sometimes the sole, feed for ruminant animals. The efficiency of utilization of rice straw could be improved by adding non-conventional feed resources, such as azolla, banana plant, sweet potato leaves and other legumes and grasses. Rates of growth and feed efficiency by local animals were found to be higher in those fed with urea treated rice straw or bagasse, with or without the addition of concentrates, than in animals fed untreated straw. Rations were also found to be satisfactory when rice straw was fed in combination with urea, legumes such as cowpea hay, azolla and sweet potato leaves or concentrates. It is concluded that the utilization of rice straw by ruminants can be improved by suitable supplementation with non-conventional feed resources. Research is needed to evaluate the use of molasses as a feed ingredient for ruminants in Bangladesh. (author)

  18. Key intermediates in nitrogen transformation during microwave pyrolysis of sewage sludge: a protein model compound study.

    Science.gov (United States)

    Zhang, Jun; Tian, Yu; Cui, Yanni; Zuo, Wei; Tan, Tao

    2013-03-01

    The nitrogen transformations with attention to NH3 and HCN were investigated at temperatures of 300-800°C during microwave pyrolysis of a protein model compound. The evolution of nitrogenated compounds in the char, tar and gas products were conducted. The amine-N, heterocyclic-N and nitrile-N compounds were identified as three important intermediates during the pyrolysis. NH3 and HCN were formed with comparable activation energies competed to consume the same reactive substances at temperatures of 300-800°C. The deamination and dehydrogenation of amine-N compounds from protein cracking contributed to the formation of NH3 (about 8.9% of Soy-N) and HCN (6.6%) from 300 to 500°C. The cracking of nitrile-N and heterocyclic-N compounds from the dehydrogenation and polymerization of amine-N generated HCN (13.4%) and NH3 (31.3%) between 500 and 800°C. It might be able to reduce the HCN and NH3 emissions through controlling the intermediates production at temperatures of 500-800°C. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Computational modeling to predict nitrogen balance during acute metabolic decompensation in patients with urea cycle disorders.

    Science.gov (United States)

    MacLeod, Erin L; Hall, Kevin D; McGuire, Peter J

    2016-01-01

    Nutritional management of acute metabolic decompensation in amino acid inborn errors of metabolism (AA IEM) aims to restore nitrogen balance. While nutritional recommendations have been published, they have never been rigorously evaluated. Furthermore, despite these recommendations, there is a wide variation in the nutritional strategies employed amongst providers, particularly regarding the inclusion of parenteral lipids for protein-free caloric support. Since randomized clinical trials during acute metabolic decompensation are difficult and potentially dangerous, mathematical modeling of metabolism can serve as a surrogate for the preclinical evaluation of nutritional interventions aimed at restoring nitrogen balance during acute decompensation in AA IEM. A validated computational model of human macronutrient metabolism was adapted to predict nitrogen balance in response to various nutritional interventions in a simulated patient with a urea cycle disorder (UCD) during acute metabolic decompensation due to dietary non-adherence or infection. The nutritional interventions were constructed from published recommendations as well as clinical anecdotes. Overall, dextrose alone (DEX) was predicted to be better at restoring nitrogen balance and limiting nitrogen excretion during dietary non-adherence and infection scenarios, suggesting that the published recommended nutritional strategy involving dextrose and parenteral lipids (ISO) may be suboptimal. The implications for patients with AA IEM are that the medical course during acute metabolic decompensation may be influenced by the choice of protein-free caloric support. These results are also applicable to intensive care patients undergoing catabolism (postoperative phase or sepsis), where parenteral nutritional support aimed at restoring nitrogen balance may be more tailored regarding metabolic fuel selection.

  20. Effect of Plant Density, Rate and Split Application of Nitrogen Fertilizer on Quality Characteristics and Nitrogen Use Efficiency of Safflower under Weed Competition

    Directory of Open Access Journals (Sweden)

    M Fuladvand

    2015-09-01

    Full Text Available In order to evaluation of plant density, rate and method of nitrogen fertilizer split application on quality characteristics and nitrogen use efficiency of safflower (Sofeh variety under weed competition a field experiment was carried out in field research Yasouj University in 2013. This experiment was a factorial based on randomized complete block design with three replications. First factor was a two levels plant density (20 and 40 plants m-2 and second factor was nitrogen rate application on nine levels. That included; non nitrogen application and 75 and 150 kgN ha-1 nitrogen application that both used with four split method. Split methods were included; S1 (%50 in pre planting stage - %50 in stem elongation stage, S2 (%25 in pre planting stage - %75 in stem elongation stage, S3 (%25 in pre planting stage - %50 in stem elongation stage -%25 in flowering stage and S4 (%25 in pre planting stage - %25 in stem elongation stage - %25 in flowering stage. Also in this experiment, weed did not control. Results showed that whit increasing crop density, oil yield and protein grain yield increased by 20 percent and nitrogen utilization efficiency increased by 10 percent. The highest oil yield (50.25 g m-2 was obtained from 75 kg ha-1 nitrogen with three-stage split application (S4. Finally, results showed that increasing nitrogen fertilizer application decreased nitrogen utilization efficiency but three-stage split method application increased this trait.

  1. Consumo e dinâmica ruminal da fibra em detergente neutro em bovinos em pastejo no período das águas recebendo suplementação com nitrogênio não-proteico e/ou proteína verdadeira Intake and rumen dynamics of neutral detergent fiber in grazing cattle supplemented with non-protein nitrogen and, or true protein during the rainy season

    Directory of Open Access Journals (Sweden)

    Viviane Aparecida Carli Costa

    2011-12-01

    Full Text Available Objetivou-se avaliar o efeito de diferentes relações entre proteína verdadeira e nitrogênio não-proteico sobre o consumo e a dinâmica de trânsito e degradação ruminal da fibra em detergente neutro (FDN da forragem em bovinos em pastejo durante o período das águas. Foram utilizados cinco novilhos mestiços Holandês × Zebu, castrados, com peso corporal inicial de 335±35 kg fistulados no rúmen e no abomaso. Os tratamentos foram: controle (somente pasto; e suplementos com ureia; com 2/3 de compostos nitrogenados oriundos da ureia e 1/3 de compostos nitrogenados oriundos da albumina; com 1/3 de compostos nitrogenados oriundos da ureia e 2/3 de compostos nitrogenados oriundos da albumina; e com albumina. Foram fornecidos 200 g/dia de proteína bruta (PB a partir dos suplementos. O experimento foi conduzido segundo delineamento em quadrado latino 5 × 5, com cinco períodos experimentais de 15 dias. Não foram observados efeitos da suplementação sobre o consumo voluntário, com exceção do consumo de PB, que aumentou com a suplementação. A substituição da ureia por albumina nos suplementos teve efeito linear sobre o consumo de PB. Os consumos dos demais componentes da dieta não foram afetados pela composição dos suplementos. Nenhum efeito foi observado sobre a taxa de passagem ruminal de compostos fibrosos. O fornecimento de suplementos ampliou, em média, a estimativa da taxa comum de latência e degradação da FDN. Contudo, não houve efeito da alteração na composição dos suplementos sobre este parâmetro. A suplementação de bovinos com fontes de compostos nitrogenados degradáveis no rúmen proteicos ou não-proteicos durante o período das águas não afeta o consumo voluntário de pasto.The objective of this study was to evaluate the effect of different true protein:non-protein nitrogen ratios in supplements on intake and ruminal transit and degradation dynamics of neutral detergent fiber (NDF in grazing cattle

  2. Distribution of protein fraction in the milk of West African dwarf goat ...

    African Journals Online (AJOL)

    Milks from lactating West African dwarf goat and white Fulani cow were analysed for total protein, casein, whey protein, non protein nitrogen, Globulin and albumin and proteose peptone contents. Milk samples were from healthy goats and cows (n=24) in mid-lactation. The data were grouped and analysed as treatment 1 ...

  3. Mass spectrometric detection of proteins in non-aqueous media : the case of prion proteins in biodiesel

    Energy Technology Data Exchange (ETDEWEB)

    Douma, M.D.; Kerr, G.M.; Brown, R.S.; Keller, B.O.; Oleschuk, R.D. [Queen' s Univ., Kingston, ON (Canada). Dept. of Chemistry

    2008-08-15

    This paper presented a filtration method for detecting protein traces in non-aqueous media. The extraction technique used a mixture of acetonitrile, non-ionic detergent and water along with filter disks with embedded C{sub 8}-modified silica particles to capture the proteins from non-aqueous samples. The extraction process was then followed by an elution of the protein from the filter disk and direct mass spectrometric detection and tryptic digestion with peptide mapping and MS/MS fragmentation of protein-specific peptides. The method was used to detect prion proteins in spiked biodiesel samples. A tryptic peptide with the sequence YGQGSPGGNR was used for unambiguous identification. Results of the study showed that the method is suitable for the large-scale testing of protein impurities in tallow-based biodiesel production processes. 33 refs., 6 figs.

  4. Urea and Ammonia Metabolism and the Control of Renal Nitrogen Excretion

    Science.gov (United States)

    Mitch, William E.; Sands, Jeff M.

    2015-01-01

    Renal nitrogen metabolism primarily involves urea and ammonia metabolism, and is essential to normal health. Urea is the largest circulating pool of nitrogen, excluding nitrogen in circulating proteins, and its production changes in parallel to the degradation of dietary and endogenous proteins. In addition to serving as a way to excrete nitrogen, urea transport, mediated through specific urea transport proteins, mediates a central role in the urine concentrating mechanism. Renal ammonia excretion, although often considered only in the context of acid-base homeostasis, accounts for approximately 10% of total renal nitrogen excretion under basal conditions, but can increase substantially in a variety of clinical conditions. Because renal ammonia metabolism requires intrarenal ammoniagenesis from glutamine, changes in factors regulating renal ammonia metabolism can have important effects on glutamine in addition to nitrogen balance. This review covers aspects of protein metabolism and the control of the two major molecules involved in renal nitrogen excretion: urea and ammonia. Both urea and ammonia transport can be altered by glucocorticoids and hypokalemia, two conditions that also affect protein metabolism. Clinical conditions associated with altered urine concentrating ability or water homeostasis can result in changes in urea excretion and urea transporters. Clinical conditions associated with altered ammonia excretion can have important effects on nitrogen balance. PMID:25078422

  5. High-resolution measurements of the exited states (n,pn), (n,dn) C-12 cross sections

    Science.gov (United States)

    Pillon, M.; Angelone, M.; Belloni, F.; Geerts, W.; Loreti, S.; Milocco, A.; Plompen, A. J. M.

    2017-09-01

    Measurements of C12 cross sections for the excited states (n,p0) up to (n,p4) and (n,d0), (n,d1) have been carried out. The Van de Graaff neutron generator of the EC-JRC-IRMM laboratory has been used for these measurements. A very thin tritiated target (263 μg/cm2) was employed with deuteron beams energies impinging on the target in the range 2.5-4.0 MeV. Neutrons in the range 18.9-20.7 MeV were produced with an intrinsic energy spread of 0.2-0.25% FWHM. With such narrow neutron energy spread, using a high energy resolution device such as a single crystal diamond detector, several peaks from the outgoing charged particles produced by the (n,pn), (n,dn) and also (n,α0) reactions appear in the pulse height spectrum. The peaks can be identified using the reaction Q-values. The diamond detector used for these measurements has shown an intrinsic energy resolution lower than 0.9% FWHM. The analysis of the peaks has permitted to derive the partial carbon reaction cross sections for several excited states. The results are presented in this paper with the associated uncertainties and they are compared with different versions of TENDL compilation when these data are available (e.g. versions 2009, 2010, 2011 and 2015) and also with experimental results available in the EXFOR database.

  6. High-resolution measurements of the exited states (n,pn, (n,dn C-12 cross sections

    Directory of Open Access Journals (Sweden)

    Pillon M.

    2017-01-01

    Full Text Available Measurements of C12 cross sections for the excited states (n,p0 up to (n,p4 and (n,d0, (n,d1 have been carried out. The Van de Graaff neutron generator of the EC-JRC-IRMM laboratory has been used for these measurements. A very thin tritiated target (263 μg/cm2 was employed with deuteron beams energies impinging on the target in the range 2.5–4.0 MeV. Neutrons in the range 18.9–20.7 MeV were produced with an intrinsic energy spread of 0.2–0.25% FWHM. With such narrow neutron energy spread, using a high energy resolution device such as a single crystal diamond detector, several peaks from the outgoing charged particles produced by the (n,pn, (n,dn and also (n,α0 reactions appear in the pulse height spectrum. The peaks can be identified using the reaction Q-values. The diamond detector used for these measurements has shown an intrinsic energy resolution lower than 0.9% FWHM. The analysis of the peaks has permitted to derive the partial carbon reaction cross sections for several excited states. The results are presented in this paper with the associated uncertainties and they are compared with different versions of TENDL compilation when these data are available (e.g. versions 2009, 2010, 2011 and 2015 and also with experimental results available in the EXFOR database.

  7. A Nitrogen Response Pathway Regulates Virulence Functions in Fusarium oxysporum via the Protein Kinase TOR and the bZIP Protein MeaB

    OpenAIRE

    López-Berges, Manuel S.; Rispail, Nicolas; Prados-Rosales, Rafael C.; Pietro, Antonio D.

    2010-01-01

    During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine s...

  8. The influence of nitrogen supplementation on microbial protein synthesis on water-buffaloes

    International Nuclear Information System (INIS)

    Abidin, Zainal; Hendratno, C.; Suharjono; Rustam, B.

    1982-01-01

    This work was carried out to observe the effects of nitrogen supplementation from urea and soybean meal on microbial protein synthesis, and other parameters of rumen functions of the waterbuffalo. Four rations were given to four water-buffaloes assigned in 4x4 latin square design. Ration A consisted of local grass+0% urea, ration B local grass+0.7% urea, ration C local grass+1.4% urea and ration D local grass+8.5% soybean meal. The result indicated that microbial protein synthesis was significantly affected (P/0.05) by the supplementation of urea, and the utilization of N in ration B was more efficient compared to the other rations. The ammonia concentration in the rumen fluid also increased (P/0.05) as a result of urea supplementation. However, no changes were found in the total volatile fatty acids production and total protozoal counts. An increased (P/0.05) of pH in the rumen fluid was also observed in the rations B and C. (author)

  9. Nitrogen retention and water balance in animals fed medium protein ...

    African Journals Online (AJOL)

    amount of nitrogen, in contrast to control animals that lost 2.4% nitrogen via the faeces. Inadequate drinking caused decreased excretion of urea. The improved nitrogen retention coupled with high rates of urea recycling enhances nutrients digestion and consequently the animals' absorptive capabilities. . (Afr. J. Biomed.

  10. Evaluation of the Effects of Bio Fertilizers Containing non Symbiotic Nitrogen Fixing and Phosphate Solubilizing Bacteria on Quantitative and Qualitative Traits of Wheat

    Directory of Open Access Journals (Sweden)

    M Mohtadi

    2016-02-01

    Full Text Available Introduction Wheat crop plays an important role in food security in a country such as Iran. Therefore, serious attention has been paid to ecological farming systems and sustainable management of wheat. For this purpose extensive efforts is done to find proper strategies to improve the quality of soil, agricultural products and started removal pollutants. One of the factors to achieve sustainable agriculture is to use natural agents such as biofertilizers. Several mechanisms are proposed to explain how effective plant growth promoting rhizobacteria is for growth and development of plants. These mechanisms include two groups, direct and indirect in general. Indirect mechanism is to increase absorption and availability of the nutrient elements soluble, producing plant growth regulators, siderophore production of iron chelator, and the phosphate soluble. Through indirect mechanisms such as antagonistic relation, PGPRs moderate the harmful effects of of plant pathogens and thereby lead to increase plant growth. The main goal of this study was to investigate the effect of biofertilizers containing non-symbiotic nitrogen fixing and phosphate solubilizing bacteria on quantitative and qualitative traits of wheat. Materials and Methods This Experiment was conducted in the research farm of Baykola agricultural research stations affiliated by agriculture and natural resources research center of Mazandaran during 2011-12 cropping season. In order to determine physical and chemical properties of the soil samples were taken from the depth of 0-30 cm,. Experimental design was split plots arrangement based on randomized complete block design with three replications. In this experiment chemical fertilizer was assumed as the main plot in 3 levels include: 1- noconsumption (C0, 2- equivalent to 50% of the fertilizer recommendations (C1, 3- equivalent to 100% of the fertilizer recommendations(C2 and two types of biological fertilizers was applied in the sub plot in

  11. Globular and disordered – the non-identical twins in protein-protein interactions

    Directory of Open Access Journals (Sweden)

    Kaare eTeilum

    2015-07-01

    Full Text Available In biology proteins from different structural classes interact across and within classes in ways that are optimized to achieve balanced functional outputs. The interactions between intrinsically disordered proteins (IDPs and other proteins rely on changes in flexibility and this is seen as a strong determinant for their function. This has fostered the notion that IDP’s bind with low affinity but high specificity. Here we have analyzed available detailed thermodynamic data for protein-protein interactions to put to the test if the thermodynamic profiles of IDP interactions differ from those of other protein-protein interactions. We find that ordered proteins and the disordered ones act as non identical twins operating by similar principles but where the disordered proteins complexes are on average less stable by 2.5 kcal mol-1.

  12. Effect of compounds astragalus extract and cysteamine on finishing pigs growth and protein turnover

    International Nuclear Information System (INIS)

    Wang Cheng; Wang Zhisheng; Zhou Anguo; Liu Guilian; Xue Bai

    2008-01-01

    32 PIC pigs, weighted 59.82±1.32 kg on average, were subjected randomly to 4 treatments for determining the effects of extrogenous metabolism-regulating agents on pig performance, protein turn-over and nitrogen retention by using isotope ( 15 N-Gly) technique and nitrogen balance trial. The 4 treatments were: (1) basal diet; (2) basal diet plus cysteamine (70mg/kg, CS group); (3) basal diet plus non-stable astragalus extracts 250mg/kg (NCAE group); (4) basal diet plus stably astragalus extracts 250mg/kg (CAE group). Astragalus extracts and cysteamine, especially NCAE, redounded to increase pig performance, especially increase average day gain (P<0.05). Both astragalus extracts and cysteamine accelerated protein aggradation rate and amino acid utilization rate, as well as biological value. Astragalus extracts helped to accelerate the synthesis rate of amino acid into body protein and reduce the excretion rate of endogenous urine nitrogen. The mechanism of increasing protein deposition of cysteamine is reducing body protein degradation rate (26.71% reduction, compared to control group), while that of astragalus extracts is bilateral, reducing protein degradation rate (24.84% and 3.66% reduction for NCAE and CAE) and accelerating protein synthesis rate (22.86% and 19.18% increase for NCAE and CAE). Both astragalus extracts and cysteamine contributed the increasing nitrogen retention, net nitrogen utilization and biological value. (authors)

  13. Water and temperature stresses impact canola (Brassica napus L.) fatty acid, protein and yield over nitrogen and sulfur

    Science.gov (United States)

    Interactive effects of weather and soil nutrient status often control crop productivity. An experiment was conducted to determine effects of N and S fertilizer rate, soil water, and atmospheric temperature on canola fatty acid (FA), total oil, protein and grain yield. Nitrogen and S were assessed in...

  14. [Non-enzymatic glycosylation of dietary protein in vitro].

    Science.gov (United States)

    Bednykh, B S; Evdokimov, I A; Sokolov, A I

    2015-01-01

    Non-enzymatic glycosylation of proteins, based on discovered by Mayarn reaction of carbohydrate aldehyde group with a free amino group of a protein molecule, is well known to experts in biochemistry of food industry. Generated brown solid in some cases give the product marketable qualities--crackling bread--in others conversely, worsen the product. The biological effects of far-advanced products of non-enzymatic protein glycosylation reaction have not been studied enough, although it was reported previously that they are not split by digestive enzymes and couldn't be absorbed by animals. The objective of this work was to compare the depth of glycosylation of different food proteins of animal and vegetable origin. The objects of the study were proteins of animal (casein, lactoglobulin, albumin) and vegetable (soy isolate, proteins of rice flour, buckwheat, oatmeal) origin, glucose and fructose were selected as glycosylation agents, exposure 15 days at 37 degrees C. Lactoglobulin was glycosylated to a lesser extent among the proteins of animal origin while protein of oatmeal was glycosylated in the least degree among vegetable proteins. Conversely, such proteins as casein and soya isolate protein bound rather large amounts of carbohydrates. Fructose binding with protein was generally higher than the binding of glucose. The only exception was a protein of oatmeal. When of glucose and fructose simultaneously presented in the incubation medium, glucose binding usually increased while binding of fructose, in contrast, reduced. According to the total amount of carbohydrate (mcg), which is able to attach a protein (mg) the studied food proteins located in the following order: albumin (38) > soy protein isolate (23) > casein (15,) > whey protein rice flour protein (6) > protein from buckwheat flour (3) > globulin (2) > protein of oatmeal (0.3). The results obtained are to be used to select the optimal combination of proteins and carbohydrates, in which the glycosylation

  15. Investigation on the Assimilation of Nitrogen by Maize Roots and the Transport of Some Major Nitrogen Compounds by Xylem Sap. II

    DEFF Research Database (Denmark)

    Ingversen, J.; Ivanko, S.

    1971-01-01

    The amino acid and protein metabolism of roots of maize has been studied. The important role of the free amino acids and proteins of the roots as active agents in nitrogen assimilation is pointed out. Nitrogen supplied as nitrate is preferably incorporated into α-ketoglutaric acid, and then by tr...

  16. Simultaneous effect of nitrate (NO3- concentration, carbon dioxide (CO2 supply and nitrogen limitation on biomass, lipids, carbohydrates and proteins accumulation in Nannochloropsis oculata

    Directory of Open Access Journals (Sweden)

    Aarón Millán-Oropeza

    2015-03-01

    Full Text Available Biodiesel from microalgae is a promising technology. Nutrient limitation and the addition of CO2 are two strategies to increase lipid content in microalgae. There are two different types of nitrogen limitation, progressive and abrupt limitation. In this work, the simultaneous effect of initial nitrate concentration, addition of CO2, and nitrogen limitation on biomass, lipid, protein and carbohydrates accumulation were analyzed. An experimental design was established in which initial nitrogen concentration, culture time and CO2 aeration as independent numerical variables with three levels were considered. Nitrogen limitation was taken into account as a categorical independent variable. For the experimental design, all the experiments were performed with progressive nitrogen limitation. The dependent response variables were biomass, lipid production, carbohydrates and proteins. Subsequently, comparison of both types of limitation i.e. progressive and abrupt limitation, was performed. Nitrogen limitation in a progressive mode exerted a greater effect on lipid accumulation. Culture time, nitrogen limitation and the interaction of initial nitrate concentration with nitrogen limitation had higher influences on lipids and biomass production. The highest lipid production and productivity were at 582 mgL-1 (49.7 % lipid, dry weight basis and 41.5 mgL-1d-1, respectively; under the following conditions: 250 mgL-1 of initial nitrate concentration, CO2 supply of 4% (v/v, 12 d of culturing and 2 d in state of nitrogen starvation induced by progressive limitation. This work presents a novel way to perform simultaneous analysis of the effect of the initial concentration of nitrate, nitrogen limitation, and CO2 supply on growth and lipid production of Nannochloropsis oculata, with the aim to produce potential biofuels feedstock.

  17. Properties of non-stoichiometric nitrogen doped LPCVD silicon thin films

    Energy Technology Data Exchange (ETDEWEB)

    Mansour, F.; Mahamdi, R. [Departement d' Electronique, Universite Mentouri, Constantine (Algeria); Beghoul, M.R. [Departement d' Electronique, Universite de Jijel (Algeria); Temple-Boyer, P. [CNRS, LAAS, Toulouse (France); Universite de Toulouse, UPS, INSA, INP, ISAE, LAAS, Toulouse (France); Bouridah, H.

    2010-02-15

    The influence of nitrogen on the internal structure and so on the electrical properties of silicon thin films obtained by low-pressure chemical vapor deposition (LPCVD) was studied using several investigation methods. We found by using Raman spectroscopy and SEM observations that a strong relationship exists between the structural order of the silicon matrix and the nitrogen ratio in film before and after thermal treatment. As a result of the high disorder caused by nitrogen on silicon network during the deposit phase of films, the crystallization phenomena in term of nucleation and crystalline growth were found to depend upon the nitrogen content. Resistivity measurements results show that electrical properties of NIDOS films depend significantly on structural properties. It was appeared that for high nitrogen content, the films tend to acquire an insulator behavior. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  18. Utilization of urea-nitrogen-15 in ruminants

    International Nuclear Information System (INIS)

    Boda, K.; Varady, J.; Havassy, I.

    1976-01-01

    In Merino sheep a series of experiments were carried out investigating exogenous and endogenous urea utilization. On the experimental sheep with isolated jejunum, rumen and intestine fistula, re-entral intestine cannulae, and after intra-ruminal or intra-intestinal 15 N-urea administration it was found that urea- 15 N takes part in the nitrogen recycling, and is utilized in the nitrogen pool. In experiments with synthetic protein-free diet, low protein diet and high nitrogen diet, after the intravenous administration of 15 N-urea the following findings were made: The results of experiments with synthetic diet, where the only nitrogen source was perorally (for 3-6 months) and then intravenously (for 3 months) administered urea, indicated the ability of ruminants to replace fully the nitrogen in the feed under certain conditions by increased endogenous urea recirculation. The results of the experiments with various nitrogen intakes showed that considerable amounts of urea- 15 N (44-96% from the given dose) were retained. Nitrogen compounds synthetized from blood urea- 15 N were recycled through the alimentary tract. Its secretion predominated in the forestomachs, abomasum and duodenum, and its reabsorption took place in the intestinal tract. From the 15 N incorporated into the nitrogenous substances which passed through the duodenum, 73-84% was reabsorbed. The retained 15 N was incorporated into the microbial and plasma proteins and its amide-N. On the basis of these results it is concluded that in addition to the rumeno-hepatal circulation, the entero-hepatal circulation of nitrogenous substances, including endogenous nitrogen, also plays an important role quantitatively and perhaps qualitatively in the process of re-utilizing the blood urea N for proteosynthesis and synthesis of other N-metabolites in ruminants. The hydrolysis of endogenous urea in the gastro-intestinal tract of ruminants and its utilization is a natural process indispensable for the maintenance of

  19. [Analysis on nitrogen and phosphorus loading of non-point sources in Shiqiao river watershed based on L-THIA model].

    Science.gov (United States)

    Li, Kai; Zeng, Fan-Tang; Fang, Huai-Yang; Lin, Shu

    2013-11-01

    Based on the Long-term Hydrological Impact Assessment (L-THIA) model, the effect of land use and rainfall change on nitrogen and phosphorus loading of non-point sources in Shiqiao river watershed was analyzed. The parameters in L-THIA model were revised according to the data recorded in the scene of runoff plots, which were set up in the watershed. The results showed that the distribution of areas with high pollution load was mainly concentrated in agricultural land and urban land. Agricultural land was the biggest contributor to nitrogen and phosphorus load. From 1995 to 2010, the load of major pollutants, namely TN and TP, showed an obviously increasing trend with increase rates of 17.91% and 25.30%, respectively. With the urbanization in the watershed, urban land increased rapidly and its area proportion reached 43.94%. The contribution of urban land to nitrogen and phosphorus load was over 40% in 2010. This was the main reason why pollution load still increased obviously while the agricultural land decreased greatly in the past 15 years. The rainfall occurred in the watershed was mainly concentrated in the flood season, so the nitrogen and phosphorus load of the flood season was far higher than that of the non-flood season and the proportion accounting for the whole year was over 85%. Pearson regression analysis between pollution load and the frequency of different patterns of rainfall demonstrated that rainfall exceeding 20 mm in a day was the main rainfall type causing non-point source pollution.

  20. Sulfur in human nutrition - effects beyond protein synthesis

    NARCIS (Netherlands)

    Gertjan Schaafsma

    2008-01-01

    That sulfur is essential to humans is based on the requirement of S-animo acids for normal growth and maintenance of nitrogen balance and not on the optimization of metabolic proccesses involving the synthesis of non-protein sulphur containing compounds. This paper reviews the significance of sulfur

  1. Synergetic effects of radiation stress and hot-carrier stress on the current gain of npn bipolar junction transistors

    International Nuclear Information System (INIS)

    Witczak, S.C.; Kosier, S.L.; Schrimpf, R.D.; Galloway, K.F.

    1994-01-01

    The combined effects of ionizing radiation and hot-carrier stress on the current gain of npn bipolar junction transistors were investigated. The analysis was carried out experimentally by examining the consequences of interchanging the order in which the two stress types were applied to identical transistors which were stressed to various levels of damage. The results indicate that the hot-carrier response of the transistor is improved by radiation damage, whereas hot-carrier damage has little effect on subsequent radiation stress. Characterization of the temporal progression of hot-carrier effects revealed that hot-carrier stress acts initially to reduce excess base current and improve current gain in irradiated transistors. PISCES simulations show that the magnitude of the peak electric-field within the emitter-base depletion region is reduced significantly by net positive oxide charges induced by radiation. The interaction of the two stress types is explained in a qualitative model based on the probability of hot-carrier injection determined by radiation damage and on the neutralization and compensation of radiation-induced positive oxide charges by injected electrons. The result imply that a bound on damage due to the combined stress types is achieved when hot-carrier stress precedes any irradiation

  2. Effect of T- and C-loop mutations on the Herbaspirillum seropedicae GlnB protein in nitrogen signalling.

    Science.gov (United States)

    Bonatto, Ana C; Souza, Emanuel M; Pedrosa, Fábio O; Yates, M Geoffrey; Benelli, Elaine M

    2005-01-01

    Proteins of the PII family are found in species of all kingdoms. Although these proteins usually share high identity, their functions are specific to the different organisms. Comparison of structural data from Escherichia coli GlnB and GlnK and Herbaspirillum seropedicae GlnB showed that the T-loop and C-terminus were variable regions. To evaluate the role of these regions in signal transduction by the H. seropedicae GlnB protein, four mutants were constructed: Y51F, G108A/P109a, G108W and Q3R/T5A. The activities of the native and mutated proteins were assayed in an E. coli background constitutively expressing the Klebsiella pneumoniae nifLA operon. The results suggested that the T-loop and C-terminus regions of H. seropedicae GlnB are involved in nitrogen signal transduction.

  3. [Effects of the nitrogen nutrition conditions on the growth and protein synthesis of carboxydobacteria].

    Science.gov (United States)

    Volova-Kesler, T G; Barashkov, V A; Trubachev, I N; Stasishina, G N

    1979-01-01

    The rate of growth of bacterial strains oxidizing carbon monoxide (Pseudomonas gazotropha Z-1156, Comamonas compransoris Z-1155, and Seliberia carboxydohydrogena Z--1062) was studied as a function of the concentration of NH4Cl in the medium. The bacteria could grow on media containing various nitrogen sources (NH4Cl, KNO3, CO(NH2)2). Changes in the amino acid content and biochemical composition of the biomass were studied during growth of the bacteria on these media. The biological value of proteins of the bacteria was estimated.

  4. BMAA Inhibits Nitrogen Fixation in the Cyanobacterium Nostoc sp. PCC 7120

    Science.gov (United States)

    Berntzon, Lotta; Erasmie, Sven; Celepli, Narin; Eriksson, Johan; Rasmussen, Ulla; Bergman, Birgitta

    2013-01-01

    Cyanobacteria produce a range of secondary metabolites, one being the neurotoxic non-protein amino acid β-N-methylamino-L-alanine (BMAA), proposed to be a causative agent of human neurodegeneration. As for most cyanotoxins, the function of BMAA in cyanobacteria is unknown. Here, we examined the effects of BMAA on the physiology of the filamentous nitrogen-fixing cyanobacterium Nostoc sp. PCC 7120. Our data show that exogenously applied BMAA rapidly inhibits nitrogenase activity (acetylene reduction assay), even at micromolar concentrations, and that the inhibition was considerably more severe than that induced by combined nitrogen sources and most other amino acids. BMAA also caused growth arrest and massive cellular glycogen accumulation, as observed by electron microscopy. With nitrogen fixation being a process highly sensitive to oxygen species we propose that the BMAA effects found here may be related to the production of reactive oxygen species, as reported for other organisms. PMID:23966039

  5. Nitrogen utilization efficiency and nitrogen nutrition of rice crops at MADA using the microplot nitrogen balance method

    International Nuclear Information System (INIS)

    Ahmad Nazrul Abd Wahid; Abdul Razak Ruslan; Latiffah Norddin; Hazlina Abdullah; Khairuddin Abdul Rahim

    2004-01-01

    Nitrogen (N) is a very important nutrient for rice crops and is a main component of protein. Nitrogen is essential in the production of plant chlorophyll and involves in vegetative and fruit growth and development processes. Nitrogen is a critical input and exert high cost in rice crop production. Nitrogen fertilizer is not fully utilised by the rice crop; some is lost due the processes of vaporization, hydrolysis, erosion, leaching and used by other plants and microorganisms. Several agronomic practices have been studied and adopted in this country with the purpose of increasing the efficiency nitrogen fertilizer utilization and thus, reducing the output cost for rice crops. The microplot nitrogen balance method is one of the methods used to determine uptake efficiency of nitrogen fertilizers by rice crops. In this research, the microplot of 1 m x 1 m squares in paddy plot were used, to ensure that sequential sampling was done at predetermined areas. Scheduled monthly sampling of soil and rice crops was conducted until the mature stage, harvest and post-harvest period. This MINT-MADA cooperative project contains the elements of information sharing on fertilizer efficiency measurement methods by using the N-15 isotopic tracer technique and the N-balance technique in soil, besides the cooperation on use of infrastructure and facilities, expertise and labour. (Author)

  6. Introducing non-flooded crops in rice-dominated landscapes: Impact on carbon, nitrogen and water budgets

    Science.gov (United States)

    Jauker, Frank; Wassmann, Reiner; Amelung, Wulf; Breuer, Lutz; Butterbach-Bahl, Klaus; Conrad, Ralf; Ekschmitt, Klemens; Goldbach, Heiner; He, Yao; John, Katharina; Kiese, Ralf; Kraus, David; Reinhold-Hurek, Barbara; Siemens, Jan; Weller, Sebastian; Wolters, Volkmar

    2013-04-01

    Rice production consumes about 30% of all freshwater used worldwide and 45% in Asia. Turning away from permanently flooded rice cropping systems for mitigating future water scarcity and reducing methane emissions, however, will alter a variety of ecosystem services with potential adverse effects to both the environment and agricultural production. Moreover, implementing systems that alternate between flooded and non-flooded crops increases the risk of disruptive effects. The multi-disciplinary DFG research unit ICON aims at exploring and quantifying the ecological consequences of altered water regimes (flooded vs. non-flooded), crop diversification (irrigated rice vs. aerobic rice vs. maize), and different fertilization strategies (conventional, site-specific, and zero N fertilization). ICON particularly focuses on the biogeochemical cycling of carbon and nitrogen, green-house gas (GHG) emissions, water balance, soil biotic processes and other important ecosystem services. The overarching goal is to provide the basic process understanding that is necessary for balancing the revenues and environmental impacts of high-yield rice cropping systems while maintaining their vital ecosystem services. To this aim, a large-scale field experiment has been established at the experimental farm of the International Rice Research Institute (IRRI, Philippines). Ultimately, the experimental results are analyzed in the context of management scenarios by an integrated modeling of crop development (ORYZA), carbon and nitrogen cycling (MoBiLE-DNDC), and water fluxes (CMF), providing the basis for developing pathways to a conversion of rice-based systems towards higher yield potentials under minimized environmental impacts. In our presentation, we demonstrate the set-up of the controlled large-scale field experiment for simultaneous assessment of carbon and nitrogen fluxes and water budgets. We show and discuss first results for: - Quantification and assessment of the net-fluxes of CH4

  7. Is nitrogen the next carbon?

    Science.gov (United States)

    Battye, William; Aneja, Viney P.; Schlesinger, William H.

    2017-09-01

    Just as carbon fueled the Industrial Revolution, nitrogen has fueled an Agricultural Revolution. The use of synthetic nitrogen fertilizers and the cultivation of nitrogen-fixing crops both expanded exponentially during the last century, with most of the increase occurring after 1960. As a result, the current flux of reactive, or fixed, nitrogen compounds to the biosphere due to human activities is roughly equivalent to the total flux of fixed nitrogen from all natural sources, both on land masses and in the world's oceans. Natural fluxes of fixed nitrogen are subject to very large uncertainties, but anthropogenic production of reactive nitrogen has increased almost fivefold in the last 60 years, and this rapid increase in anthropogenic fixed nitrogen has removed any uncertainty on the relative importance of anthropogenic fluxes to the natural budget. The increased use of nitrogen has been critical for increased crop yields and protein production needed to keep pace with the growing world population. However, similar to carbon, the release of fixed nitrogen into the natural environment is linked to adverse consequences at local, regional, and global scales. Anthropogenic contributions of fixed nitrogen continue to grow relative to the natural budget, with uncertain consequences.

  8. The simulation research of dissolved nitrogen and phosphorus non-point source pollution in Xiao-Jiang watershed of Three Gorges Reservoir area.

    Science.gov (United States)

    Wu, Lei; Long, Tian-Yu; Li, Chong-Ming

    2010-01-01

    Xiao-jiang, with a basin area of almost 5,276 km(2) and a length of 182.4 km, is located in the center of the Three Gorges Reservoir Area, and is the largest tributary of the central section in Three Gorges Reservoir Area, farmland accounts for a large proportion of Xiao-jiang watershed, and the hilly cropland of purple soil is much of the farmland of the watershed. After the second phase of water storage in the Three Gorges Reservoir, the majority of sub-rivers in the reservoir area experienced eutrophication phenomenon frequently, and non-point source (NPS) pollution has become an important source of pollution in Xiao-jiang Watershed. Because dissolved nitrogen and phosphorus non-point source pollution are related to surface runoff and interflow, using climatic, topographic and land cover data from the internet and research institutes, the Semi-Distributed Land-use Runoff Process (SLURP) hydrological model was introduced to simulate the complete hydrological cycle of the Xiao-jiang Watershed. Based on the SLURP distributed hydrological model, non-point source pollution annual output load models of land use and rural residents were respectively established. Therefore, using GIS technology, considering the losses of dissolved nitrogen and phosphorus in the course of transport, a dissolved non-point source pollution load dynamic model was established by the organic coupling of the SLURP hydrological model and land-use output model. Through the above dynamic model, the annual dissolved non-point source nitrogen and phosphorus pollution output as well as the load in different types were simulated and quantitatively estimated from 2001 to 2008, furthermore, the loads of Xiao-jiang Watershed were calculated and expressed by temporal and spatial distribution in the Three Gorges Reservoir Area. The simulation results show that: the temporal changes of dissolved nitrogen and phosphorus load in the watershed are close to the inter-annual changes of rainfall runoff, and the

  9. Retrotransposons and non-protein coding RNAs

    DEFF Research Database (Denmark)

    Mourier, Tobias; Willerslev, Eske

    2009-01-01

    does not merely represent spurious transcription. We review examples of functional RNAs transcribed from retrotransposons, and address the collection of non-protein coding RNAs derived from transposable element sequences, including numerous human microRNAs and the neuronal BC RNAs. Finally, we review...

  10. Effects of split nitrogen fertilization on post-anthesis photoassimilates, nitrogen use efficiency and grain yield in malting barley

    DEFF Research Database (Denmark)

    Cai, Jian; Jiang, Dong; Liu, Fulai

    2011-01-01

    photosynthesis after anthesis, dry matter accumulation and assimilates remobilization, nitrogen use efficiency and grain yield to fraction of topdressed nitrogen treatments were investigated in malting barley. Net photosynthetic rate of the penultimate leaf, leaf area index and light extinction coefficient...... assimilation rate and nitrogen use efficiency resulting in higher grain yields and proper grain protein content in malting barley.......Split nitrogen applications are widely adopted to improve grain yield and enhance nitrogen use effective in crops. In a twoyear field experiment at two eco-sites, five fractions of topdressed nitrogen of 0%, 20%, 30%, 40% and 50% were implemented. Responses of radiation interception and leaf...

  11. Terrestrial nitrogen cycles: Some unanswered questions

    Science.gov (United States)

    Vitousek, P.

    1984-01-01

    Nitrogen is generally considered to be the element which most often limits the growth of plants in both natural and agricultural ecosystems. It regulates plant growth because photosynthetic rates are strongly dependent on the concentration of nitrogen in leaves, and because relatively large mounts of protein are required for cell division and growth. Yet nitrogen is abundant in the biosphere - the well-mixed pool in the atmosphere is considered inexhaustible compared to biotic demand, and the amount of already fixed organic nitrogen in soils far exceeds annual plant uptake in terrestrial ecosystems. In regions where natural vegetation is not nitrogen limited, continuous cultivation induces nitrogen deficiency. Nitrogen loss from cultivated lands is more rapid than that of other elements, and nitrogen fertilization is generally required to maintain crop yield under any continuous system. The pervasiveness of nitrogen deficiency in many natural and most managed sites is discussed.

  12. Crystalline amino acids and nitrogen emission

    NARCIS (Netherlands)

    Verstegen, M.W.A.; Jongbloed, A.W.

    2003-01-01

    Reductions in dietary protein level and supplementation with certain crystalline amino acids is a well-established method of formulating diets to achieve a more ideal amino acid pattern and to reduce nitrogen excretion. Up to 35% reduction in nitrogen excretion may be achieved by supplementing pig

  13. Chemical Composition, Nitrogen Fractions and Amino Acids Profile of Milk from Different Animal Species

    Directory of Open Access Journals (Sweden)

    Saima Rafiq

    2016-07-01

    Full Text Available Milk composition is an imperative aspect which influences the quality of dairy products. The objective of study was to compare the chemical composition, nitrogen fractions and amino acids profile of milk from buffalo, cow, sheep, goat, and camel. Sheep milk was found to be highest in fat (6.82%±0.04%, solid-not-fat (11.24%±0.02%, total solids (18.05%±0.05%, protein (5.15%±0.06% and casein (3.87%±0.04% contents followed by buffalo milk. Maximum whey proteins were observed in camel milk (0.80%±0.03%, buffalo (0.68%±0.02% and sheep (0.66%±0.02% milk. The non-protein-nitrogen contents varied from 0.33% to 0.62% among different milk species. The highest r-values were recorded for correlations between crude protein and casein in buffalo (r = 0.82, cow (r = 0.88, sheep (r = 0.86 and goat milk (r = 0.98. The caseins and whey proteins were also positively correlated with true proteins in all milk species. A favorable balance of branched-chain amino acids; leucine, isoleucine, and valine were found both in casein and whey proteins. Leucine content was highest in cow (108±2.3 mg/g, camel (96±2.2 mg/g and buffalo (90±2.4 mg/g milk caseins. Maximum concentrations of isoleucine, phenylalanine, and histidine were noticed in goat milk caseins. Glutamic acid and proline were dominant among non-essential amino acids. Conclusively, current exploration is important for milk processors to design nutritious and consistent quality end products.

  14. Evolution of nitrogen species in landfill leachates under various stabilization states.

    Science.gov (United States)

    Zhao, Renzun; Gupta, Abhinav; Novak, John T; Goldsmith, C Douglas

    2017-11-01

    In this study, nitrogen species in landfill leachates under various stabilization states were investigated with emphasis on organic nitrogen. Ammonium nitrogen was found to be approximately 1300mg/L in leachates from younger landfill units (less than 10years old), and approximately 500mg/L in leachates from older landfill units (up to 30years old). The concentration and aerobic biodegradability of organic nitrogen decreased with landfill age. A size distribution study showed that most organic nitrogen in landfill leachates is nitrogen (TON, mg/L-N, R 2 =0.88 and 0.98 for untreated and treated samples, respectively). The slopes of the regression curves of untreated (protein=0.45TON) and treated (protein=0.31TON) leachates indicated that the protein is more biodegradable than the other organic nitrogen species in landfill leachates. XAD-8 resin was employed to isolate the hydrophilic fraction of leachate samples, and it was found that the hydrophilic fraction proportion in terms of organic nitrogen decreased with landfill age. Solid-state 15 N nuclear magnetic resonance (NMR) was utilized to identify the nitrogen species. Proteinaceous materials were found to be readily biodegradable, while heterocyclic nitrogen species were found to be resistant to biodegradation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Nitrate and ammonium lead to distinct global dynamic phosphorylation patterns when resupplied to nitrogen-starved Arabidopsis seedlings.

    Science.gov (United States)

    Engelsberger, Wolfgang R; Schulze, Waltraud X

    2012-03-01

    Nitrogen is an essential macronutrient for plant growth and development. Inorganic nitrogen and its assimilation products control various metabolic, physiological and developmental processes. Although the transcriptional responses induced by nitrogen have been extensively studied in the past, our work here focused on the discovery of candidate proteins for regulatory events that are complementary to transcriptional changes. Most signaling pathways involve modulation of protein abundance and/or activity by protein phosphorylation. Therefore, we analyzed the dynamic changes in protein phosphorylation in membrane and soluble proteins from plants exposed to rapid changes in nutrient availability over a time course of 30 min. Plants were starved of nitrogen and subsequently resupplied with nitrogen in the form of nitrate or ammonium. Proteins with maximum change in their phosphorylation level at up to 5 min after nitrogen resupply (fast responses) included GPI-anchored proteins, receptor kinases and transcription factors, while proteins with maximum change in their phosphorylation level after 10 min of nitrogen resupply (late responses) included proteins involved in protein synthesis and degradation, as well as proteins with functions in central metabolism and hormone metabolism. Resupply of nitrogen in the form of nitrate or ammonium resulted in distinct phosphorylation patterns, mainly of proteins with signaling functions, transcription factors and transporters. © 2011 The Authors. The Plant Journal © 2011 Blackwell Publishing Ltd.

  16. Effect of dietary protein sources of on blood or milk urea nitrogen of native cows

    Energy Technology Data Exchange (ETDEWEB)

    Sarker, N R; Huque, K S; Asaduzzaman, M. [Animal Production Research Division, Bangladesh Livestock Research Institute, Savar, Dhaka (Bangladesh)], E-mail: nathusarker@yahoo.com

    2009-07-01

    When feed protein metabolism in ruminants produces urea in the liver and recycles or blood urea (BUN) filters into milk urea nitrogen (MUN), an indicator of protein status in diets or feeding urea as one of the non-protein nitrogen sources for ruminants is scientifically acceptable throughout the world; a section of environmentalists, policy makers or even professionals often raise question of residual effects in milk and/or meat of fattening and/or dairy cattle fed with diets containing urea. Keeping their views in consideration, a feeding trial on 30 Pabna milking cows of 2 to 4 parities dividing equally into 5 groups was arranged to determine the effect of feeding of different sources of protein on BUN and MUN, and milk yield or protein content. To achieve the objectives, a group of cows was fed a diet of rice straw and concentrate as the control (T{sub 0}), two out of the rests was fed either with urea-molasses straw (UMS) (T{sub 1}) or Matikalai (Vigna mungo) hay ( T{sub 2}) as sources of basal roughage. The rest two groups of cows were fed the control diet replacing % of feed protein by the amount of urea and molasses fed to UMS group. The amount of urea and molasses was fed daily either in two meals (T{sub 3}) or fed to cows mixing with other concentrate feed (T{sub 4}). In addition, a concentrate mixture containing 45 % wheat bran, 24% Khesari bran, 12% Til oil cake, 12% soybean meal, 4% fishmeal, 2.0% oyster-shell, 0.5% DCP and 0.5% common salt, was supplied twice daily. Having adjusted the cows with the diets for 20 d, a 20 d feeding trial was conducted, when feed intake and samples of blood and milk were collected. Milk samples were collected from individual cow after feeding the experimental diets in the morning and evening milking. Samples were collected from milk bucket after complete milking and mixing thoroughly. Samples were analyzed for milk urea content (MUN) using a Colorimetric p-dimethylaminobenzaldehyde (DMAB) method as described by Bector et

  17. Plant densities and modulation of symbiotic nitrogen fixation in soybean

    Directory of Open Access Journals (Sweden)

    Marcos Javier de Luca

    2014-06-01

    Full Text Available Soybean nitrogen (N demands can be supplied to a large extent via biological nitrogen fixation, but the mechanisms of source/sink regulating photosynthesis/nitrogen fixation in high yielding cultivars and current crop management arrangements need to be investigated. We investigated the modulation of symbiotic nitrogen fixation in soybean [Glycine max (L. Merrill] at different plant densities. A field trial was performed in southern Brazil with six treatments, including non-inoculated controls without and with N-fertilizer, both at a density of 320,000 plants ha−1, and plants inoculated with Bradyrhizobium elkanii at four densities, ranging from 40,000 to 320,000 plants ha−1. Differences in nodulation, biomass production, N accumulation and partition were observed at stage R5, but not at stage V4, indicating that quantitative and qualitative factors (such as sunlight infrared/red ratio assume increasing importance during the later stages of plant growth. Decreases in density in the inoculated treatments stimulated photosynthesis and nitrogen fixation per plant. Similar yields were obtained at the different plant densities, with decreases only at the very low density level of 40,000 plants ha−1, which was also the only treatment to show differences in seed protein and oil contents. Results confirm a fine tuning of the mechanisms of source/sink, photosynthesis/nitrogen fixation under lower plant densities. Higher photosynthesis and nitrogen fixation rates are capable of sustaining increased plant growth.

  18. Purine nitrogen index, potentially a new parameter for rapid feed evaluation in ruminants

    International Nuclear Information System (INIS)

    Chen, X.B.; Oerskov, E.R.; Subba, D.B.; Jayasuriya, M.C.N.

    1999-01-01

    The concept of a new parameter 'Purine Nitrogen Index (PNI)' for feed evaluation in ruminants is discussed. PNI refers to the ratio of purine derivative (PD) nitrogen to total nitrogen in urine. It is suggested that PNI can potentially be used as an indicator of the efficiency with which degradable dietary nitrogen is converted to microbial protein in the rumen. The excretion of PD in the urine provides an estimation of the intestinal flow of microbial protein, and therefore, PNI effectively corresponds to the amount of microbial protein produced in the rumen relative to the nitrogen loss in the urine. If a diet or a dietary regime has a high conversion efficiency, proportionally more rumen degradable nitrogen is converted to microbial protein and less nitrogen is excreted in the urine, resulting in a high PNI. Conversely, if a diet has a poor conversion efficiency, proportionally less dietary nitrogen is converted to microbial protein and more is excreted in the urine, resulting in a low PNI. Preliminary data from six experiments involving 34 sheep confirmed a positive correlation between PNI and the nitrogen conversion efficiency, and suggested that a dietary regime with a PNI lower than 0.08 for sheep appeared to be a less efficient in the production of microbial protein and have a greater loss of nitrogen in the urine. PNI can theoretically be determined in spot urine samples, and has the potential to serve as a 'dipstick' method for the rapid evaluation of ruminant feeds. However, more research with a mathematical modelling approach is required to evaluate and develop the concept further. (author)

  19. Purine nitrogen index, potentially a new parameter for rapid feed evaluation in ruminants

    Energy Technology Data Exchange (ETDEWEB)

    Chen, X B; Oerskov, E R [Rowett Research Institute, Bucksburn, Aberdeen (United Kingdom); Subba, D B [Pakhribas Agricultural Centre, Dhankuta, Kathmandu (Nepal); Jayasuriya, M C.N. [International Atomic Energy Agency, Animal Production and Health Section, Vienna (Austria)

    1999-06-01

    The concept of a new parameter `Purine Nitrogen Index (PNI)` for feed evaluation in ruminants is discussed. PNI refers to the ratio of purine derivative (PD) nitrogen to total nitrogen in urine. It is suggested that PNI can potentially be used as an indicator of the efficiency with which degradable dietary nitrogen is converted to microbial protein in the rumen. The excretion of PD in the urine provides an estimation of the intestinal flow of microbial protein, and therefore, PNI effectively corresponds to the amount of microbial protein produced in the rumen relative to the nitrogen loss in the urine. If a diet or a dietary regime has a high conversion efficiency, proportionally more rumen degradable nitrogen is converted to microbial protein and less nitrogen is excreted in the urine, resulting in a high PNI. Conversely, if a diet has a poor conversion efficiency, proportionally less dietary nitrogen is converted to microbial protein and more is excreted in the urine, resulting in a low PNI. Preliminary data from six experiments involving 34 sheep confirmed a positive correlation between PNI and the nitrogen conversion efficiency, and suggested that a dietary regime with a PNI lower than 0.08 for sheep appeared to be a less efficient in the production of microbial protein and have a greater loss of nitrogen in the urine. PNI can theoretically be determined in spot urine samples, and has the potential to serve as a `dipstick` method for the rapid evaluation of ruminant feeds. However, more research with a mathematical modelling approach is required to evaluate and develop the concept further. (author) 15 refs, 5 figs, 4 tabs

  20. Stable carbon, nitrogen and sulfur isotopes in non-carbonate fractions of cold-seep carbonates

    Science.gov (United States)

    Feng, Dong; Peng, Yongbo; Peckmann, Jörn; Roberts, Harry; Chen, Duofu

    2017-04-01

    Sulfate-driven anaerobic oxidation of methane (AOM) supports chemosynthesis-based communities and limits the release of methane from marine sediments. This process promotes the formation of carbonates close to the seafloor along continental margins. The geochemical characteristics of the carbonate minerals of these rocks are increasingly understood, questions remain about the geochemical characteristics of the non-carbonate fractions. Here, we report stable carbon, nitrogen and sulfur isotope patterns in non-carbonate fractions of seep carbonates. The authigenic carbonates were collected from three modern seep provinces (Black Sea, Gulf of Mexico, and South China Sea) and three ancient seep deposits (Marmorito, northern Italy, Miocene; SR4 deposit of the Lincoln Creek Formation and Whiskey Creek, western Washington, USA, Eocene to Oligocene). The δ13C values of non-carbonate fractions range from ˜-25‰ to -80‰ VPDB. These values indicate that fossil methane mixed with varying amounts of pelagic organic matter is the dominant source of carbon in these fractions. The relatively small offset between the δ34S signatures of the non-carbonate fractions and the respective sulfide minerals suggests that locally produced hydrogen sulfide is the main source of sulfur in seep environments. The δ15N values of the non-carbonate fractions are generally lower than the corresponding values of deep-sea sediments, suggesting that organic nitrogen is mostly of a local origin. This study reveals the potential of using δ13C, δ15N, δ34S values to discern seep and non-seep deposits. In cases where δ13Ccarbonate values are only moderately low due to mixing processes and lipid biomarkers have been erased in the course of burial, it is difficult to trace back AOM owing to the lack of other records. This problem is even more pronounced when authigenic carbonate is not available in ancient seep environments. Acknowledgments: The authors thank BOEM and NOAA for their years' support

  1. Uptake of pulse injected nitrogen by soil microbes and mycorrhizal and non-mycorrhizal plants in a species-diverse subarctic heath ecosystem

    DEFF Research Database (Denmark)

    Andresen, Louise Christoffersen; Jonasson, Sven; Strom, Lena

    2008-01-01

    15N labeled ammonium, glycine or glutamic acid was injected into subarctic heath soil in situ, with the purpose of investigating how the nitrogen added in these pulses was subsequently utilized and cycled in the ecosystem. We analyzed the acquisition of 15N label in mycorrhizal and non-mycorrhiza......15N labeled ammonium, glycine or glutamic acid was injected into subarctic heath soil in situ, with the purpose of investigating how the nitrogen added in these pulses was subsequently utilized and cycled in the ecosystem. We analyzed the acquisition of 15N label in mycorrhizal and non...

  2. Effect of feeding aflatoxin on nitrogen kinetics in crossbred and buffalo calves fed different levels of protein

    International Nuclear Information System (INIS)

    Dass, R.S.; Arora, S.P.

    1989-01-01

    The studies were conducted to elucidate the effect of feeding aflatoxin on nitrogen kinetics in rumen fistulated calves. One calf each in groups 1, 2, 5 and 6 and one bufffalo calf each, in groups 3, 4, 7 and 8 were alloted. Calves of groups 5 to 8 were provided optimum protein (OP) while those in groups 1 to 4 were given 42.5 per cent more protein (HP) in their diets. In addition, animals in groups 2, 4, 6 and 8 were given an oral dose of aflatoxin at the rate of 1.0 ppm of drymatter intake. Subsequent to digestibility trial, 2 hourly feeding was practised for 10 days, after which 15 N-ammonium sulphate and 51 Cr-EDTA were infused intra-ruminally. Results indicated that there was no effect of feeding aflatoxin on the digestibility of nutrients except crude protein. Nitrogen balances were better with groups fed OP diets as compared to HP diets, more in crossbreds than the buffalo. The estimated rumen volume ranged from 37.70 to 56.00 litres and rumen fluid outflow rates varied from 87.34 to 123.70 litres per day. Ruminal ammonia pool size, ruminal ammonia entry rates and irreversible loss rates were higher in HP fed groups without showing any effect of afflatoxins. Ruminal ammonia-N was better utilized for incorporation into bacterial protein and for transfer to plasma urea-N with OP fed groups, again without showing aflatoxin toxicity effect. Ruminal ammonia-N excretion pattern through urine was greater as a result of aflatoxin toxicity, more in crossbreds as compared to buffalo. (author). 19 refs. 5 tabs

  3. [Comparative investigation of the non-histone proteins of chromatin from pigeon erythroblasts and erythrocytes].

    Science.gov (United States)

    Fedina, A B; Gazarian, G G

    1976-01-01

    Chromosomal non-histone proteins are obtained from nuclei of two types of pigeon erythroid cells: erythroblasts (cells active in RNA synthesis) and erythrocytes (cells with repressed RNA synthesis). They are well soluble in solutions of low ionic strength. Electrophoretic separation of the obtained non-histone proteins in polyacrylamide gels with urea and SDS shows the presence of qualitative differences in the pattern of non-histone proteins of chromatine from erythroblasts and erythrocytes. By electrophoresis in urea some protein bands of non-histone proteins of chromatine from erythroblasts were found which disappear with the aging of cells. At the same time two protein fractions were observed in chromatine from erythrocytes which were absent in that of erythroblasts. Disappearance of some high molecular weight protein fractions from erythrocyte chromatine as compared to erythroblasts was observed by separation of the non-histone proteins in the presence of SDS. These fractions of the non-histone proteins disappearing during aging of cells are well extractable from erythroblast chromatine by 0.35 M NaCl solution. In the in vitro system with E. coli RNA polymerase addition of non-histone proteins of chromatine from erythroblasts to chromatine from erythrocytes increases RNA synthesis 2--3 times. At the same time addition of non-histone proteins from erythrocytes is either without any influence on this process or somewhat inhibiting.

  4. Nitrogen Assimilation in Escherichia coli: Putting Molecular Data into a Systems Perspective

    Science.gov (United States)

    van Heeswijk, Wally C.; Westerhoff, Hans V.

    2013-01-01

    SUMMARY We present a comprehensive overview of the hierarchical network of intracellular processes revolving around central nitrogen metabolism in Escherichia coli. The hierarchy intertwines transport, metabolism, signaling leading to posttranslational modification, and transcription. The protein components of the network include an ammonium transporter (AmtB), a glutamine transporter (GlnHPQ), two ammonium assimilation pathways (glutamine synthetase [GS]-glutamate synthase [glutamine 2-oxoglutarate amidotransferase {GOGAT}] and glutamate dehydrogenase [GDH]), the two bifunctional enzymes adenylyl transferase/adenylyl-removing enzyme (ATase) and uridylyl transferase/uridylyl-removing enzyme (UTase), the two trimeric signal transduction proteins (GlnB and GlnK), the two-component regulatory system composed of the histidine protein kinase nitrogen regulator II (NRII) and the response nitrogen regulator I (NRI), three global transcriptional regulators called nitrogen assimilation control (Nac) protein, leucine-responsive regulatory protein (Lrp), and cyclic AMP (cAMP) receptor protein (Crp), the glutaminases, and the nitrogen-phosphotransferase system. First, the structural and molecular knowledge on these proteins is reviewed. Thereafter, the activities of the components as they engage together in transport, metabolism, signal transduction, and transcription and their regulation are discussed. Next, old and new molecular data and physiological data are put into a common perspective on integral cellular functioning, especially with the aim of resolving counterintuitive or paradoxical processes featured in nitrogen assimilation. Finally, we articulate what still remains to be discovered and what general lessons can be learned from the vast amounts of data that are available now. PMID:24296575

  5. BMAA Inhibits Nitrogen Fixation in the Cyanobacterium Nostoc sp. PCC 7120

    Directory of Open Access Journals (Sweden)

    Birgitta Bergman

    2013-08-01

    Full Text Available Cyanobacteria produce a range of secondary metabolites, one being the neurotoxic non-protein amino acid β-N-methylamino-L-alanine (BMAA, proposed to be a causative agent of human neurodegeneration. As for most cyanotoxins, the function of BMAA in cyanobacteria is unknown. Here, we examined the effects of BMAA on the physiology of the filamentous nitrogen-fixing cyanobacterium Nostoc sp. PCC 7120. Our data show that exogenously applied BMAA rapidly inhibits nitrogenase activity (acetylene reduction assay, even at micromolar concentrations, and that the inhibition was considerably more severe than that induced by combined nitrogen sources and most other amino acids. BMAA also caused growth arrest and massive cellular glycogen accumulation, as observed by electron microscopy. With nitrogen fixation being a process highly sensitive to oxygen species we propose that the BMAA effects found here may be related to the production of reactive oxygen species, as reported for other organisms.

  6. Non-ammonium reduced nitrogen species in atmospheric aerosol particles

    Energy Technology Data Exchange (ETDEWEB)

    Dod, R.L.; Gundel, L.A.; Benner, W.H.; Novakov, T.

    1983-08-01

    The traditional belief that ambient aerosol particles contain nitrogen predominantly in the form of inorganic ionic species such as NH/sub 4//sup +/ and NO/sub 3//sup -/ was challenged about 10 years ago by results from x-ray photoelectron spectroscopic analysis (ESCA) of California aerosol particles. A significant fraction (approx. 50%) of the reduced nitrogen was observed to have an oxidation state more reduced than ammonium, characteristic of organic nitrogen species. We have used a recently developed thermal evolved gas analysis method (NO/sub x/) in conjunction with ESCA to confirm the existence of these species in aerosol particles collected in both the United States and Europe. The agreement of EGA and ESCA analyses indicates that these species are found not only on the surface but also throughout the particles. 9 references, 6 figures.

  7. Economics of low nitrogen feeding strategies

    NARCIS (Netherlands)

    Vuuren, van A.M.; Pineiro, C.; Hoek, Van der K.W.; Oenema, O.

    2015-01-01

    Livestock retains typically between 10 and 40 % of the protein-nitrogen in the animal feed in milk, egg and/or meat, depending also on animal productivity and management. The remaining 60–90 % of the nitrogen (N) is excreted in urine and faeces, and contributes to the emissions of ammonia (NH3) and

  8. Nitrogen balance study in young Nigerian adult males using four levels of protein intake.

    Science.gov (United States)

    Atinmo, T; Mbofung, C M; Egun, G; Osotimehin, B

    1988-11-01

    1. The present study was carried out to estimate precisely, via the nitrogen balance technique, the protein requirement of Nigerians (earlier estimated via the obligatory N method) using graded levels of protein intake. 2. Fifteen medical students of the University of Ibadan who volunteered to participate in the study were given graded levels of protein (0.3, 0.45, 0.6 and 0.75 g/kg body-weight per d) derived from foods similar to those usually consumed by the subjects. 3. Each subject was given each of the dietary protein levels for a period of 10 d. Subjects were divided into two groups and the feeding pattern followed a criss-cross design with one group starting with the highest level of protein intake (0.3 g). Mean energy intake during each of the eleven experimental periods was maintained at 0.2 MJ/kg per d. After an initial 5 d adaptation period in each experimental period, 24 h urine and faecal samples were collected in marked containers for five consecutive days for N determination. 4. Mean N balance during consumption of the four protein levels (0.30, 0.45, 0.6 and 0.75 g/kg) were -11.02 (SD 8.07), -9.90 (SD 6.64), +9.70 (SD 4.15) and +5.13 (SD 4.62) respectively. Using regression analysis, the mean daily N requirement was estimated at 110.25 mg N/kg body-weight (0.69 g protein/kg body-weight). Estimates of allowances for individual variations to cover 97.5% of the population adjusted this value to 0.75 g protein/kg body-weight. Net protein utilization for the diet at maintenance level was estimated at 57.5.

  9. Dryland Winter Wheat Yield, Grain Protein, and Soil Nitrogen Responses to Fertilizer and Biosolids Applications

    Directory of Open Access Journals (Sweden)

    Richard T. Koenig

    2011-01-01

    Full Text Available Applications of biosolids were compared to inorganic nitrogen (N fertilizer for two years at three locations in eastern Washington State, USA, with diverse rainfall and soft white, hard red, and hard white winter wheat (Triticum aestivum L. cultivars. High rates of inorganic N tended to reduce yields, while grain protein responses to N rate were positive and linear for all wheat market classes. Biosolids produced 0 to 1400 kg ha−1 (0 to 47% higher grain yields than inorganic N. Wheat may have responded positively to nutrients other than N in the biosolids or to a metered N supply that limited vegetative growth and the potential for moisture stress-induced reductions in grain yield in these dryland production systems. Grain protein content with biosolids was either equal to or below grain protein with inorganic N, likely due to dilution of grain N from the higher yields achieved with biosolids. Results indicate the potential to improve dryland winter wheat yields with biosolids compared to inorganic N alone, but perhaps not to increase grain protein concentration of hard wheat when biosolids are applied immediately before planting.

  10. Nitrogen balance of healthy Dutch women before and during pregnancy

    NARCIS (Netherlands)

    Mojtahedi, M.; Groot, de C.P.G.M.; Boekholt, H.A.; Raaij, van J.M.A.

    2002-01-01

    Background: Experimental studies including longitudinal nitrogen balance studies could provide insight into protein metabolism in pregnancy. Objective: Our aim was to determine the development of nitrogen balance during pregnancy compared with nitrogen balance before pregnancy in women consuming

  11. Characteristics of whey proteinhydrolysates from cheese whey, favors onvarious food applications

    Directory of Open Access Journals (Sweden)

    Jeewanthi Chaturika Renda Kankanamge

    2014-01-01

    Full Text Available This study was conducted to investigate theproduction of whey protein hydrolysates,examiningthe physiochemical properties withfive enzyme types named Alcalase, Protease S,Protease M, Trypsin, and Pepsin. Whey protein concentratewas adjusted by ultrafiltration,increasing the whey content to 135% that of initial levels. The hydrolysates have been shown to improve the characteristics of a number of food products, and the type of enzyme has a considerable influence on the end result of hydrolysatesproduction. Bulk density, Solubility, NPN, foaming capacity, and the degree of hydrolysis were increased with hydrolysis time. Maximum Bulk density was shownby Protease S. Pepsinand Alcalase, whichgraduallyincreasedthe foaming capacity, resulting in acomparatively lower pH and a lower degree of hydrolysis. The highestdegree of hydrolysiswas shown by Protease M. The highest NPN value was provided by Pepsin, which was much greater than that of other enzymes. There wasno significant difference in NPN according to the enzyme typeapplied. Allhydrolysates in alkaline media were shown more than 50% solubility. HMFcontents were also shown anobviousdifference with the enzyme type.

  12. Symbiosome-like intracellular colonization of cereals and other crop plants by nitrogen-fixing bacteria for reduced inputs of synthetic nitrogen fertilizers.

    Science.gov (United States)

    Cocking, Edward C; Stone, Philip J; Davey, Michael R

    2005-09-01

    It has been forecast that the challenge of meeting increased food demand and protecting environmental quality will be won or lost in maize, rice and wheat cropping systems, and that the problem of environmental nitrogen enrichment is most likely to be solved by substituting synthetic nitrogen fertilizers by the creation of cereal crops that are able to fix nitrogen symbiotically as legumes do. In legumes, rhizobia present intracellularly in membrane-bound vesicular compartments in the cytoplasm of nodule cells fix nitrogen endosymbiotically. Within these symbiosomes, membrane-bound vesicular compartments, rhizobia are supplied with energy derived from plant photosynthates and in return supply the plant with biologically fixed nitrogen, usually as ammonia. This minimizes or eliminates the need for inputs of synthetic nitrogen fertilizers. Recently we have demonstrated, using novel inoculation conditions with very low numbers of bacteria, that cells of root meristems of maize, rice, wheat and other major non-legume crops, such as oilseed rape and tomato, can be intracellularly colonized by the non-rhizobial, non-nodulating, nitrogen fixing bacterium,Gluconacetobacter diazotrophicus that naturally occurs in sugarcane.G. diazotrophicus expressing nitrogen fixing (nifH) genes is present in symbiosome-like compartments in the cytoplasm of cells of the root meristems of the target cereals and non-legume crop species, somewhat similar to the intracellular symbiosome colonization of legume nodule cells by rhizobia. To obtain an indication of the likelihood of adequate growth and yield, of maize for example, with reduced inputs of synthetic nitrogen fertilizers, we are currently determining the extent to which nitrogen fixation, as assessed using various methods, is correlated with the extent of systemic intracellular colonization byG. diazotrophicus, with minimal or zero inputs.

  13. The effect of high pressure on nitrogen compounds of milk

    International Nuclear Information System (INIS)

    Kielczewska, Katarzyna; Czerniewicz, Maria; Michalak, Joanna; Brandt, Waldemar

    2004-01-01

    The effect of pressurization at different pressures (from 200 to 1000 MPa, at 200 MPa intervals, t const. = 15 min) and periods of time (from 15 to 35 min, at 10 min intervals, p const. = 800 MPa) on the changes of proteins and nitrogen compounds of skimmed milk was studied. The pressurization caused an increase in the amount of soluble casein and denaturation of whey proteins. The level of nonprotein nitrogen compounds and proteoso-peptone nitrogen compounds increased as a result of the high-pressure treatment. These changes increased with an increase in pressure and exposure time. High-pressure treatment considerably affected the changes in the conformation of milk proteins, which was reflected in the changes in the content of proteins sedimenting and an increase in their degree of hydration

  14. Split Nitrogen Application Improves Wheat Baking Quality by Influencing Protein Composition Rather Than Concentration.

    Science.gov (United States)

    Xue, Cheng; Auf'm Erley, Gunda Schulte; Rossmann, Anne; Schuster, Ramona; Koehler, Peter; Mühling, Karl-Hermann

    2016-01-01

    The use of late nitrogen (N) fertilization (N application at late growth stages of wheat, e.g., booting, heading or anthesis) to improve baking quality of wheat has been questioned. Although it increases protein concentration, the beneficial effect on baking quality (bread loaf volume) needs to be clearly understood. Two pot experiments were conducted aiming to evaluate whether late N is effective under controlled conditions and if these effects result from increased N rate or N splitting. Late N fertilizers were applied either as additional N or split from the basal N at late boot stage or heading in the form of nitrate-N or urea. Results showed that late N fertilization improved loaf volume of wheat flour by increasing grain protein concentration and altering its composition. Increasing N rate mainly enhanced grain protein quantitatively. However, N splitting changed grain protein composition by enhancing the percentages of gliadins and glutenins as well as certain high molecular weight glutenin subunits (HMW-GS), which led to an improved baking quality of wheat flour. The late N effects were greater when applied as nitrate-N than urea. The proportions of glutenin and x-type HMW-GS were more important than the overall protein concentration in determining baking quality. N splitting is more effective in improving wheat quality than the increase in the N rate by late N, which offers the potential to cut down N fertilization rates in wheat production systems.

  15. Split nitrogen application improves wheat baking quality by influencing protein composition rather than concentration

    Directory of Open Access Journals (Sweden)

    Cheng eXue

    2016-06-01

    Full Text Available The use of late nitrogen (N fertilization (N application at late growth stages of wheat, e.g. booting, heading or anthesis to improve baking quality of wheat has been questioned. Although it increases protein concentration, the beneficial effect on baking quality (bread loaf volume needs to be clearly understood. Two pot experiments were conducted aiming to evaluate whether late N is effective under controlled conditions and if these effects result from increased N rate or N splitting. Late N fertilizers were applied either as additional N or split from the basal N at late boot stage or heading in the form of nitrate-N or urea. Results showed that late N fertilization improved loaf volume of wheat flour by increasing grain protein concentration and altering its composition. Increasing N rate mainly enhanced grain protein quantitatively. However, N splitting changed grain protein composition by enhancing the percentages of gliadins and glutenins as well as certain high molecular weight glutenin subunits (HMW-GS, which led to an improved baking quality of wheat flour. The late N effects were greater when applied as nitrate-N than urea. The proportions of glutenin and x-type HMW-GS were more important than the overall protein concentration in determining baking quality. N splitting is more effective in improving wheat quality than the increase in the N rate by late N, which offers the potential to cut down N fertilization rates in wheat production systems.

  16. Nitrogen control of chloroplast development: Progress report

    International Nuclear Information System (INIS)

    Schmidt, G.W.

    1987-11-01

    A manifestation of nitrogen deficiency in vascular plants and algae is chlorosis, indicating that chloroplast biogenesis can be strongly restricted by direct or indirect effects of nitrogen assimilation products. To define the molecular basis of nitrogen responses we are using Chlamydomonas reinhardtii. Depending on the levels of ammonium, steady-state deficiency conditions are established such that the cellular levels of chlorophylls and xanthophylls are depressed. Chloroplasts in nitrogen-deficient cells contain appreciable levels of carbon assimilation enzyme and thylakoids with high electron transport activities. However, the light harvesting complexes are nearly absent and Photosystem I exhibits unusual characteristics. Studies of rates of protein synthesis by in vivo pulse-chase labeling and levels of RNAs encoded by the chloroplast and nuclear genomes have been initiated: the accumulation of transcripts for the nuclear light-harvesting apoproteins is dramatically altered qualitatively and quantitatively; there is no major effect on chloroplast RNAs but, in general, these are inefficiently utilized for protein synthesis until nitrogen is provided to the cultures. Supplying nitrogen results in an almost immediate release of chloroplast mRNAs from a translational arrest but the stimulation of the accumulation of nuclear transcripts for light-harvesting apoproteins does not occur until after a 1-2 hour lag

  17. Nitrogen control of chloroplast development: Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, G.W.

    1987-11-01

    A manifestation of nitrogen deficiency in vascular plants and algae is chlorosis, indicating that chloroplast biogenesis can be strongly restricted by direct or indirect effects of nitrogen assimilation products. To define the molecular basis of nitrogen responses we are using Chlamydomonas reinhardtii. Depending on the levels of ammonium, steady-state deficiency conditions are established such that the cellular levels of chlorophylls and xanthophylls are depressed. Chloroplasts in nitrogen-deficient cells contain appreciable levels of carbon assimilation enzyme and thylakoids with high electron transport activities. However, the light harvesting complexes are nearly absent and Photosystem I exhibits unusual characteristics. Studies of rates of protein synthesis by in vivo pulse-chase labeling and levels of RNAs encoded by the chloroplast and nuclear genomes have been initiated: the accumulation of transcripts for the nuclear light-harvesting apoproteins is dramatically altered qualitatively and quantitatively; there is no major effect on chloroplast RNAs but, in general, these are inefficiently utilized for protein synthesis until nitrogen is provided to the cultures. Supplying nitrogen results in an almost immediate release of chloroplast mRNAs from a translational arrest but the stimulation of the accumulation of nuclear transcripts for light-harvesting apoproteins does not occur until after a 1-2 hour lag.

  18. Isotopic and non-isotopic estimations of fertilizer nitrogen uptake by wheat

    International Nuclear Information System (INIS)

    Hamid, A.; Ahmad, M.

    1990-01-01

    Recoveries of fertilizer N in wheat (MexiPak-65) grown in a field experiment were calculated by difference methods including linear regression of total nitrogen in wheat plant, nitrogen 15 method and linear regression of fertilizer. The difference method overestimated recoveries of applied fertilizer at the rates of application when compared to the nitrogen 15 method. Similarly linear regression of total N in wheat on rates of N over estimated recoveries by 25% at the three rates. The difference method of calculating the recoveries of fertilizer N in wheat could give values similar to those calculated by nitrogen 15 method when the minimal N treatment was used as a base instead of zero-N. (orig./A.B.)

  19. Biogeochemical characteristics of suspended particulate matter in deep chlorophyll maximum layers in the southern East China Sea

    Science.gov (United States)

    Liu, Qianqian; Kandasamy, Selvaraj; Lin, Baozhi; Wang, Huawei; Chen, Chen-Tung Arthur

    2018-04-01

    Continental shelves and marginal seas are key sites of particulate organic matter (POM) production, remineralization and sequestration, playing an important role in the global carbon cycle. Elemental and stable isotopic compositions of organic carbon and nitrogen are thus frequently used to characterize and distinguish POM and its sources in suspended particles and surface sediments in the marginal seas. Here we investigated suspended particulate matter (SPM) collected around deep chlorophyll maximum (DCM) layers in the southern East China Sea for particulate organic carbon and nitrogen (POC and PN) contents and their isotopic compositions (δ13CPOC and δ15NPN) to understand provenance and dynamics of POM. Hydrographic parameters (temperature, salinity and turbidity) indicated that the study area was weakly influenced by freshwater derived from the Yangtze River during summer 2013. Elemental and isotopic results showed a large variation in δ13CPOC (-25.8 to -18.2 ‰) and δ15NPN (3.8 to 8.0 ‰), but a narrow molar C / N ratio (4.1-6.3) and low POC / Chl a ratio ( < 200 g g-1) in POM, and indicated that the POM in DCM layers was newly produced by phytoplankton. In addition to temperature effects, the range and distribution of δ13CPOC were controlled by variations in primary productivity and phytoplankton species composition; the former explained ˜ 70 % of the variability in δ13CPOC. However, the variation in δ15NPN was controlled by the nutrient status and δ15NNO3- in seawater, as indicated by similar spatial distribution between δ15NPN and the current pattern and water masses in the East China Sea; although interpretations of δ15NPN data should be verified with the nutrient data in future studies. Furthermore, the POM investigated was weakly influenced by the terrestrial OM supplied by the Yangtze River during summer 2013 due to the reduced sediment supply by the Yangtze River and north-eastward transport of riverine particles to the northern East China

  20. Preliminary study on plasma proteins in pregnant and non-pregnant female dogs.

    Science.gov (United States)

    Szczubiał, Marek; Wawrzykowski, Jacek; Dąbrowski, Roman; Krawczyk, Magdalena; Kankofer, Marta

    2017-07-15

    In this study, we used a combined approach based on 2-dimensional electrophoresis (2-DE), difference in gel electrophoresis (DIGE), and mass spectrometry (MS) to identify the plasma protein composition in pregnant female dogs and compared it with non-pregnant female dogs. We used the plasma samples obtained from four female dogs during I, II, and III thirds of pregnancy, three days after parturition, as well as from four non-pregnant female dogs in diestrus phase. Analysis of 2-DE gel image exhibited of 249 protein spots. The intensity of staining of 35 spots differed significantly (P dogs. We used matrix-assisted laser desorption/ionization-time of flight-mass spectrometry (MALDI TOF MS) to identify 47 spots corresponding to 52 different proteins. Five identified protein spots, including zinc finger BED domain-containing protein 5, hemoglobin subunit beta-2, integrator complex subunit 7, apolipoprotein A-I, and glutamyl aminopeptidase were differentially presented in the plasma of pregnant and non-pregnant female dogs. To the best of our knowledge, this is the first report on the plasma protein profile of pregnant and non-pregnant female dogs. In this study, we identified proteins that have not been previously identified in dogs. Our findings showed that numerous protein spots were differentially presented in the plasma of female dogs during normal pregnancy. Although we identified only a limited number of differentially presented proteins, our study demonstrated that the plasma protein profile changed during pregnancy in female dogs, which suggests its importance in maintaining pregnancy. Further studies are necessary to define complete plasma protein profile of pregnant female dogs and to identify all proteins that are differentially presented in the pregnant animals compared with the non-pregnant ones. In addition, studies are warranted to explain the role of those proteins in maintaining the pregnancy and their usefulness in detection of early pregnancy

  1. Verteerbaarheid (ileaal en faecaal) van biologisch geteelde eiwitrijke voedergrondstoffen bij varkens = Digestibility (ileal and faecal) of organically-grown protein-rich raw materials in pigs

    NARCIS (Netherlands)

    Jongbloed, A.W.; Diepen, van J.T.M.

    2007-01-01

    In this research the ileal digestibility of nitrogen and amino acids and the faecal digestibility of organic matter, nitrogen, fat, non-starch polysaccharides, energy and phosphorus of protein-rich organicallygrown feed raw materials were evaluated in pigs. The products were rapeseed meal expeller,

  2. Purification and binding analysis of the nitrogen fixation regulatory NifA protein from Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    L.M.P. Passaglia

    1998-11-01

    Full Text Available NifA protein activates transcription of nitrogen fixation operons by the alternative sigma54 holoenzyme form of RNA polymerase. This protein binds to a well-defined upstream activator sequence (UAS located at the -200/-100 position of nif promoters with the consensus motif TGT-N10-ACA. NifA of Azospirillum brasilense was purified in the form of a glutathione-S-transferase (GST-NifA fusion protein and proteolytic release of GST yielded inactive and partially soluble NifA. However, the purified NifA was able to induce the production of specific anti-A. brasilense NifA-antiserum that recognized NifA from A. brasilense but not from K. pneumoniae. Both GST-NifA and NifA expressed from the E. coli tac promoter are able to activate transcription from the nifHDK promoter but only in an A. brasilense background. In order to investigate the mechanism that regulates NifA binding capacity we have used E. coli total protein extracts expressing A. brasilense nifA in mobility shift assays. DNA fragments carrying the two overlapping, wild-type or mutated UAS motifs present in the nifH promoter region revealed a retarded band of related size. These data show that the binding activity present in the C-terminal domain of A. brasilense NifA protein is still functional even in the presence of oxygen.

  3. Metagenomic profiling of a microbial assemblage associated with the California mussel: a node in networks of carbon and nitrogen cycling.

    Directory of Open Access Journals (Sweden)

    Catherine A Pfister

    2010-05-01

    Full Text Available Mussels are conspicuous and often abundant members of rocky shores and may constitute an important site for the nitrogen cycle due to their feeding and excretion activities. We used shotgun metagenomics of the microbial community associated with the surface of mussels (Mytilus californianus on Tatoosh Island in Washington state to test whether there is a nitrogen-based microbial assemblage associated with mussels. Analyses of both tidepool mussels and those on emergent benches revealed a diverse community of Bacteria and Archaea with approximately 31 million bp from 6 mussels in each habitat. Using MG-RAST, between 22.5-25.6% were identifiable using the SEED non-redundant database for proteins. Of those fragments that were identifiable through MG-RAST, the composition was dominated by Cyanobacteria and Alpha- and Gamma-proteobacteria. Microbial composition was highly similar between the tidepool and emergent bench mussels, suggesting similar functions across these different microhabitats. One percent of the proteins identified in each sample were related to nitrogen cycling. When normalized to protein discovery rate, the high diversity and abundance of enzymes related to the nitrogen cycle in mussel-associated microbes is as great or greater than that described for other marine metagenomes. In some instances, the nitrogen-utilizing profile of this assemblage was more concordant with soil metagenomes in the Midwestern U.S. than for open ocean system. Carbon fixation and Calvin cycle enzymes further represented 0.65 and 1.26% of all proteins and their abundance was comparable to a number of open ocean marine metagenomes. In sum, the diversity and abundance of nitrogen and carbon cycle related enzymes in the microbes occupying the shells of Mytilus californianus suggest these mussels provide a node for microbial populations and thus biogeochemical processes.

  4. Elevated CO2 plus chronic warming reduce nitrogen uptake and levels or activities of nitrogen-uptake and -assimilatory proteins in tomato roots.

    Science.gov (United States)

    Jayawardena, Dileepa M; Heckathorn, Scott A; Bista, Deepesh R; Mishra, Sasmita; Boldt, Jennifer K; Krause, Charles R

    2017-03-01

    Atmospheric CO 2 enrichment is expected to often benefit plant growth, despite causing global warming and nitrogen (N) dilution in plants. Most plants primarily procure N as inorganic nitrate (NO 3 - ) or ammonium (NH 4 + ), using membrane-localized transport proteins in roots, which are key targets for improving N use. Although interactive effects of elevated CO 2 , chronic warming and N form on N relations are expected, these have not been studied. In this study, tomato (Solanum lycopersicum) plants were grown at two levels of CO 2 (400 or 700 ppm) and two temperature regimes (30 or 37°C), with NO 3 - or NH 4 + as the N source. Elevated CO 2 plus chronic warming severely inhibited plant growth, regardless of N form, while individually they had smaller effects on growth. Although %N in roots was similar among all treatments, elevated CO 2 plus warming decreased (1) N-uptake rate by roots, (2) total protein concentration in roots, indicating an inhibition of N assimilation and (3) shoot %N, indicating a potential inhibition of N translocation from roots to shoots. Under elevated CO 2 plus warming, reduced NO 3 - -uptake rate per g root was correlated with a decrease in the concentration of NO 3 - -uptake proteins per g root, reduced NH 4 + uptake was correlated with decreased activity of NH 4 + -uptake proteins and reduced N assimilation was correlated with decreased concentration of N-assimilatory proteins. These results indicate that elevated CO 2 and chronic warming can act synergistically to decrease plant N uptake and assimilation; hence, future global warming may decrease both plant growth and food quality (%N). © 2016 Scandinavian Plant Physiology Society.

  5. Structural determinants for protein adsorption/non-adsorption to silica surface

    International Nuclear Information System (INIS)

    Mathe, Christelle; Devineau, Stephanie; Aude, Jean-Christophe; Lagniel, Gilles; Chedin, Stephane; Legros, Veronique; Mathon, Marie-Helene; Renault, Jean-Philippe; Pin, Serge; Boulard, Yves; Labarre, Jean

    2013-01-01

    The understanding of the mechanisms involved in the interaction of proteins with inorganic surfaces is of major interest in both fundamental research and applications such as nano-technology. However, despite intense research, the mechanisms and the structural determinants of protein/surface interactions are still unclear. We developed a strategy consisting in identifying, in a mixture of hundreds of soluble proteins, those proteins that are adsorbed on the surface and those that are not. If the two protein subsets are large enough, their statistical comparative analysis must reveal the physicochemical determinants relevant for adsorption versus non-adsorption. This methodology was tested with silica nanoparticles. We found that the adsorbed proteins contain a higher number of charged amino acids, particularly arginine, which is consistent with involvement of this basic amino acid in electrostatic interactions with silica. The analysis also identified a marked bias toward low aromatic amino acid content (phenylalanine, tryptophan, tyrosine and histidine) in adsorbed proteins. Structural analyses and molecular dynamics simulations of proteins from the two groups indicate that non-adsorbed proteins have twice as many p-p interactions and higher structural rigidity. The data are consistent with the notion that adsorption is correlated with the flexibility of the protein and with its ability to spread on the surface. Our findings led us to propose a refined model of protein adsorption. (authors)

  6. Structural determinants for protein adsorption/non-adsorption to silica surface.

    Directory of Open Access Journals (Sweden)

    Christelle Mathé

    Full Text Available The understanding of the mechanisms involved in the interaction of proteins with inorganic surfaces is of major interest in both fundamental research and applications such as nanotechnology. However, despite intense research, the mechanisms and the structural determinants of protein/surface interactions are still unclear. We developed a strategy consisting in identifying, in a mixture of hundreds of soluble proteins, those proteins that are adsorbed on the surface and those that are not. If the two protein subsets are large enough, their statistical comparative analysis must reveal the physicochemical determinants relevant for adsorption versus non-adsorption. This methodology was tested with silica nanoparticles. We found that the adsorbed proteins contain a higher number of charged amino acids, particularly arginine, which is consistent with involvement of this basic amino acid in electrostatic interactions with silica. The analysis also identified a marked bias toward low aromatic amino acid content (phenylalanine, tryptophan, tyrosine and histidine in adsorbed proteins. Structural analyses and molecular dynamics simulations of proteins from the two groups indicate that non-adsorbed proteins have twice as many π-π interactions and higher structural rigidity. The data are consistent with the notion that adsorption is correlated with the flexibility of the protein and with its ability to spread on the surface. Our findings led us to propose a refined model of protein adsorption.

  7. Comportamento ingestivo de novilhas leiteiras alimentadas com dietas à base de Cana-de-açúcar Ingestive behavior of dairy heifers fed sugar cane based diets

    Directory of Open Access Journals (Sweden)

    Lídia Ferreira Miranda

    1999-01-01

    Full Text Available O objetivo deste trabalho foi avaliar o comportamento ingestivo de novilhas mestiças Holandês x Zebu alimentadas com dietas à base de cana-de-açúcar suplementadas com fontes de nitrogênio não-protéico [NNP] (uréia e cama de frango, em substituição parcial da uréia e, ou, adição de probióticos (sem probiótico, com levedura ou com microbiota ruminal. Vinte e quatro novilhas, com idade e peso médio inicial de 15 meses e 247 kg, respectivamente, foram mantidas em baias individuais e alimentadas à vontade, durante o período experimental de 84 dias. Os animais foram distribuídos em delineamento inteiramente casualisado, em esquema fatorial 2 x 3 (fontes de NNP vs fontes de probiótico, com quatro repetições. O comportamento ingestivo de cada novilha foi determinado visualmente, a cada 28 dias, a intervalos de 10 minutos, durante 24 horas. Não houve diferença no tempo despendido em alimentação, ruminação e mastigação total, em min/dia, das novilhas alimentadas com diferentes fontes de NNP e probióticos. O tempo médio de ruminação, em min/kg de MS e FDN, foi maior para os animais alimentados com uréia. O comportamento ingestivo das novilhas não foi influenciado pelas fontes de nitrogênio ou pela adição de probiótico.The objective of this work was to evaluate the ingestive behavior of crossbred dairy heifers fed sugar-cane based diets, supplemented with non protein nitrogen [NPN] sources (urea or broiler litter, in replacement of urea and, or, probiotics addition (without probiotic, with yeast or with ruminal microbiota. Twenty-four heifers, with age and average initial weight of 15 months and 247 kg, respectively, were maintained in individual stalls and ad libitum fed during the experimental period of 84 days. The animals were allotted to a completely randomized design, in a 2 x 3 factorial arrangement (NPN source vs probiotic source, with four replicates. The ingestive behavior of each heifer was visually

  8. Food nitrogen footprint reductions related to a balanced Japanese diet.

    Science.gov (United States)

    Oita, Azusa; Nagano, Ichiro; Matsuda, Hiroyuki

    2018-04-01

    Dietary choices largely affect human-induced reactive nitrogen accumulation in the environment and resultant environmental problems. A nitrogen footprint (NF) is an indicator of how an individual's consumption patterns impact nitrogen pollution. Here, we examined the impact of changes in the Japanese diet from 1961 to 2011 and the effect of alternative diets (the recommended protein diet, a pescetarian diet, a low-NF food diet, and a balanced Japanese diet) on the food NF. The annual per capita Japanese food NF has increased by 55% as a result of dietary changes since 1961. The 1975 Japanese diet, a balanced omnivorous diet that reportedly delays senescence, with a protein content similar to the current level, reduced the current food NF (15.2 kg N) to 12.6 kg N, which is comparable to the level in the recommended protein diet (12.3 kg N). These findings will help consumers make dietary choices to reduce their impacts on nitrogen pollution.

  9. Accumulation of dry matter and nitrogen in the developing seeds of high protein mutant lines of Triticum Aestivum (L.) produced by the IAEA

    International Nuclear Information System (INIS)

    Mir Ali, N.; Nabulsi, I.

    1993-03-01

    Accumulation patterns of dry matter and nitrogen in the developing seeds of nine mutant lines produced by the IAEA and their mother Triticum Aestivum (L.) line were studied. The experiments lasted 2 years under rain fed conditions. Significant differences were found among the lines in dry matter and nitrogen rates, and periods of accumulation, whereas no significant differences were found in the final seed weight of the lines. The highest rates of accumulation for dry matter and nitrogen were accompanied with the shortest period of accumulation in two late flowering mutant lines. However, these two lines were the lowest in their yield per plot. The other mutant lines achieved the high nitrogen percentage in their seeds through the relative reduction in dry matter accumulation rate compared to their mother line rather than through higher rate of nitrogen accumulation. This study revealed some of the potential reasons behind the higher percentage of protein in the seeds of the mutant lines under investigation. (author). 17 refs., 3 figs., 2 tabs

  10. Nitrogen fixation in the tissues of ruminant

    International Nuclear Information System (INIS)

    Buttery, P.J.

    1990-01-01

    Protein metabolism in animals is in a constant state of flux, the processes of protein synthesis and protein breakdown acting against each other, and the balance between the two processes causing changes in the mass of protein in a tissue. Reduction in the diet reduces both protein synthesis and protein degradation unless the dietary depletion is severe and prolonged, when there is a marked increase in protein catabolism. The synthesis and degradation of protein can be manipulated by anabolic agents, thus increasing the efficiency of animals. While the use of these agents has met with success in many countries, it remains to be seen whether they will be useful in harsh environments. Lactation and pregnancy put an extra demand on the nitrogen economy of animals. Evidence indicates that the extra amino acids needed for milk production do not come from muscle protein breakdown. Many animals in harsh environments are infected with parasites; intestinal parasites reduce food intake and cause blood loss into the intestines. Associated with this is a general disruption of protein metabolism. In all these studies, isotopic techniques have played a vital role. Few studies have been conducted on nitrogen metabolism in the tissue of ruminants exposed to harsh environments (with one notable exception: rumen function studies, some of which are described elsewhere in the Proceedings of this Seminar). This lack of work on nitrogen metabolism of animals from the harsher environments has often made it necessary to extrapolate data obtained from animals found and maintained in the temperate zones to quite different environments and to animals maintained on quite different dietary regimens. Several examples of the use of isotopes in metabolic studies with animals to yield information of direct or potential relevance to the harsh environments are presented. (author). 23 refs. 1 fig. 6 tabs

  11. Role of the outer-edge flame on flame extinction in nitrogen-diluted non-premixed counterflow flames with finite burner diameters

    KAUST Repository

    Chung, Yong Ho; Park, Daegeun; Park, Jeong; Kwon, Oh Boong; Yun, Jin Han; Keel, Sang In

    2013-01-01

    This study of nitrogen-diluted non-premixed counterflow flames with finite burner diameters investigates the important role of the outer-edge flame on flame extinction through experimental and numerical analyses. It explores flame stability diagrams

  12. Interaction of a non-histone chromatin protein (high-mobility group protein 2) with DNA

    International Nuclear Information System (INIS)

    Goodwin, G.H.; Shooter, K.V.; Johns, E.W.

    1975-01-01

    The interaction with DNA of the calf thymus chromatin non-histone protein termed the high-mobility group protein 2 has been studied by sedimentation analysis in the ultracentrifuge and by measuring the binding of the 125 I-labelled protein to DNA. The results have been compared with those obtained previously by us [Eur. J. Biochem. (1974) 47, 263-270] for the interaction of high-mobility group protein 1 with DNA. Although the binding parameters are similar for these two proteins, high-mobility group protein 2 differs from high-mobility group protein 1 in that the former appears to change the shape of the DNA to a more compact form. The molecular weight of high-mobility group protein 2 has been determined by equilibrium sedimentation and a mean value of 26,000 was obtained. A low level of nuclease activity detected in one preparation of high-mobility group protein 2 has been investigated. (orig.) [de

  13. Metabolism of organic acids, nitrogen and amino acids in chlorotic leaves of 'Honeycrisp' apple (Malus domestica Borkh) with excessive accumulation of carbohydrates.

    Science.gov (United States)

    Wang, Huicong; Ma, Fangfang; Cheng, Lailiang

    2010-07-01

    Metabolite profiles and activities of key enzymes in the metabolism of organic acids, nitrogen and amino acids were compared between chlorotic leaves and normal leaves of 'Honeycrisp' apple to understand how accumulation of non-structural carbohydrates affects the metabolism of organic acids, nitrogen and amino acids. Excessive accumulation of non-structural carbohydrates and much lower CO(2) assimilation were found in chlorotic leaves than in normal leaves, confirming feedback inhibition of photosynthesis in chlorotic leaves. Dark respiration and activities of several key enzymes in glycolysis and tricarboxylic acid (TCA) cycle, ATP-phosphofructokinase, pyruvate kinase, citrate synthase, aconitase and isocitrate dehydrogenase were significantly higher in chlorotic leaves than in normal leaves. However, concentrations of most organic acids including phosphoenolpyruvate (PEP), pyruvate, oxaloacetate, 2-oxoglutarate, malate and fumarate, and activities of key enzymes involved in the anapleurotic pathway including PEP carboxylase, NAD-malate dehydrogenase and NAD-malic enzyme were significantly lower in chlorotic leaves than in normal leaves. Concentrations of soluble proteins and most free amino acids were significantly lower in chlorotic leaves than in normal leaves. Activities of key enzymes in nitrogen assimilation and amino acid synthesis, including nitrate reductase, glutamine synthetase, ferredoxin and NADH-dependent glutamate synthase, and glutamate pyruvate transaminase were significantly lower in chlorotic leaves than in normal leaves. It was concluded that, in response to excessive accumulation of non-structural carbohydrates, glycolysis and TCA cycle were up-regulated to "consume" the excess carbon available, whereas the anapleurotic pathway, nitrogen assimilation and amino acid synthesis were down-regulated to reduce the overall rate of amino acid and protein synthesis.

  14. Endophytic colonization of plant roots by nitrogen-fixing bacteria

    International Nuclear Information System (INIS)

    Cocking, Edward C.

    2001-01-01

    Nitrogen-fixing bacteria are able to enter into roots from the rhizosphere, particularly at the base of emerging lateral roots, between epidermal cells and through root hairs. In the rhizosphere growing root hairs play an important role in symbiotic recognition in legume crops. Nodulated legumes in endosymbiosis with rhizobia are amongst the most prominent nitrogen-fixing systems in agriculture. The inoculation of non-legumes, especially cereals, with various non-rhizobial diazotrophic bacteria has been undertaken with the expectation that they would establish themselves intercellularly within the root system, fixing nitrogen endophytic ally and providing combined nitrogen for enhanced crop production. However, in most instances bacteria colonize only the surface of the roots and remain vulnerable to competition from other rhizosphere micro-organisms, even when the nitrogen-fixing bacteria are endophytic, benefits to the plant may result from better uptake of soil nutrients rather than from endophytic nitrogen fixation. Azorhizobium caulinodans is known to enter the root system of cereals, other nonlegume crops and Arabidopsis, by intercellular invasion between epidermal cells and to internally colonize the plant intercellularly, including the xylem. This raises the possibility that xylem colonization might provide a nonnodular niche for endosymbiotic nitrogen fixation in rice, wheat, maize, sorghum and other non-legume crops. A particularly interesting, naturally occurring, non-qodular xylem colonising endophytic diazotrophic interaction with evidence for endophytic nitrogen fixation is that of Gluconacetobacter diazotrophicus in sugarcane. Could this beneficial endophytic colonization of sugarcane by G. diazotrophicus be extended to other members of the Gramineae, including the major cereals, and to other major non-legume crops of the World? (author)

  15. Non-surface activity and micellization behavior of cationic amphiphilic block copolymer synthesized by reversible addition-fragmentation chain transfer process.

    Science.gov (United States)

    Ghosh, Arjun; Yusa, Shin-ichi; Matsuoka, Hideki; Saruwatari, Yoshiyuki

    2011-08-02

    Cationic amphiphilic diblock copolymers of poly(n-butylacrylate)-b-poly(3-(methacryloylamino)propyl)trimethylammonium chloride) (PBA-b-PMAPTAC) with various hydrophobic and hydrophilic chain lengths were synthesized by a reversible addition-fragmentation chain transfer (RAFT) process. Their molecular characteristics such as surface activity/nonactivity were investigated by surface tension measurements and foam formation observation. Their micelle formation behavior and micelle structure were investigated by fluorescence probe technique, static and dynamic light scattering (SLS and DLS), etc., as a function of hydrophilic and hydrophobic chain lengths. The block copolymers were found to be non-surface active because the surface tension of the aqueous solutions did not change with increasing polymer concentration. Critical micelle concentration (cmc) of the polymers could be determined by fluorescence and SLS measurements, which means that these polymers form micelles in bulk solution, although they were non-surface active. Above the cmc, the large blue shift of the emission maximum of N-phenyl-1-naphthylamine (NPN) probe and the low micropolarity value of the pyrene probe in polymer solution indicate the core of the micelle is nonpolar in nature. Also, the high value of the relative intensity of the NPN probe and the fluorescence anisotropy of the 1,6-diphenyl-1,3,5-hexatriene (DPH) probe indicated that the core of the micelle is highly viscous in nature. DLS was used to measure the average hydrodynamic radii and size distribution of the copolymer micelles. The copolymer with the longest PBA block had the poorest water solubility and consequently formed micelles with larger size while having a lower cmc. The "non-surface activity" was confirmed for cationic amphiphilic diblock copolymers in addition to anionic ones studied previously, indicating the universality of non-surface activity nature.

  16. Xylem sap nitrogen compounds of some Crotalaria species

    Directory of Open Access Journals (Sweden)

    Vitória Angela Pierre

    1999-01-01

    Full Text Available Thirteen species of Crotalaria were analysed for nitrogen compounds in the xylem root bleeding sap. Amino acids were the main form of organic nitrogen found, but only traces of ureides were present. Of the four species analysed for amino acid composition, asparagine was found to be the major amino acid, accounting for over 68% of the nitrogen transported. No striking deviations from this general pattern was found between species, between vegetative and floral stages of development, or between nodulated and non-nodulated plants. It was concluded that the Crotalaria species studied here have an asparagine-based nitrogen metabolism, consistent with many other non-ureide-producing legume species.

  17. Respiration and nitrogen assimilation: targeting mitochondria-associated metabolism as a means to enhance nitrogen use efficiency.

    Science.gov (United States)

    Foyer, Christine H; Noctor, Graham; Hodges, Michael

    2011-02-01

    Considerable advances in our understanding of the control of mitochondrial metabolism and its interactions with nitrogen metabolism and associated carbon/nitrogen interactions have occurred in recent years, particularly highlighting important roles in cellular redox homeostasis. The tricarboxylic acid (TCA) cycle is a central metabolic hub for the interacting pathways of respiration, nitrogen assimilation, and photorespiration, with components that show considerable flexibility in relation to adaptations to the different functions of mitochondria in photosynthetic and non-photosynthetic cells. By comparison, the operation of the oxidative pentose phosphate pathway appears to represent a significant limitation to nitrogen assimilation in non-photosynthetic tissues. Valuable new insights have been gained concerning the roles of the different enzymes involved in the production of 2-oxoglutarate (2-OG) for ammonia assimilation, yielding an improved understanding of the crucial role of cellular energy balance as a broker of co-ordinate regulation. Taken together with new information on the mechanisms that co-ordinate the expression of genes involved in organellar functions, including energy metabolism, and the potential for exploiting the existing flexibility for NAD(P)H utilization in the respiratory electron transport chain to drive nitrogen assimilation, the evidence that mitochondrial metabolism and machinery are potential novel targets for the enhancement of nitrogen use efficiency (NUE) is explored.

  18. [Nitrogen balance assessment in burn patients].

    Science.gov (United States)

    Beça, Andreia; Egipto, Paula; Carvalho, Davide; Correia, Flora; Oliveira, Bruno; Rodrigues, Acácio; Amarante, José; Medina, J Luís

    2010-01-01

    The burn injury probably represents the largest stimulus for muscle protein catabolism. This state is characterized by an accelerated catabolism of the lean or skeletal mass that results in a clinical negative balance of nitrogen and muscle wasting. The determination of an appropriate value for protein intake is essential, since it is positively related to the nitrogen balance (NB) and accordingly several authors argue that a positive NB is the key parameter associated with nutritional improvement of a burn patient. Evaluation of the degree of protein catabolism by assessment of the Nitrogen Balance; Defining of nutritional support (protein needs) to implement in patients with burned surface area (BSA) = 10%. We prospectively evaluated the clinical files and scrutinized the clinical variables of interest. The NB was estimated according to three formulae. Each gram of nitrogen calculated by the NB was then converted into grams of protein, subtracted or added to protein intake (or administered enteric or parenterically) and divided by kg of reference Weight (kg Rweight), in an attempt to estimate the daily protein needs. The cohort consisted of 10 patients, 6 females, with average age of 58(23) years old, a mean of BSA of 21.4(8.4)%, ranging from a minimum of 10.0% and máximum of 35.0%. On average, patients were 58 (23) years old. The average number of days of hospitalization in the burn unit was 64.8(36.5) days. We observed significant differences between the 3 methods used for calculating the NB (p = 0.004), on average the NB was positive. When the formula A was used the average value of NB was higher. Regarding the attempt to estimate the needs of g prot/kg Rweight/day most of the values did not exceed, on average, 2.6 g Prot/kg Rweight/day and no significant differences between patients with a BSA% of 10-20% and with BSA% > 20% were found. Despite being able to estimate the protein catabolism through these formulas and verifying that most values were above zero

  19. Nitrogen fixed by wheat plants as affected by nitrogen fertilizer levels and Non-symbiotic bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Soliman, S; Aly, S S.M.; Gadalla, A M [Soils and Water Dept., Atomic Energy Authority, Cairo (Egypt); Abou Seeda, M [Soils and Water Dept., National Res. Centre, Cairo (Egypt)

    1995-10-01

    Inorganic nitrogen is required for all egyptian soils for wheat. Free living and N 2-fixing microorganisms are able associate closely related with the roots of geraminacae. Pot experiment studies were carried out to examine the response of wheat plants to inoculation with Azospirillum Brasilense and Azotobacter Chroococcum, single or in combination, under various levels of ammonium sulfate interaction between both the inoculants increased straw or grain yield as well as N-uptake by wheat plants with increasing N levels. Results showed that grains of wheat plants derived over 19,24 and 15% of its N content from the atmospheric - N 2 (Ndfa) with application of 25,50 and 75 mg N kg-1 soil in the presence of + Azospirillum + azotobacter. The final amount of N 2-fixers. The highest values of N 2-fixed were observed with mixed inoculants followed by inoculation with Azospirillum and then azotobacter. The recovery of applied ammonium sulfate-N was markedly increased by inoculation with combined inoculants, but less in uninoculated treatments. Seeds inoculated with non-symbiotic fixing bacteria could be saved about 25 kg N without much affecting the grain yield. i fig., 4 tabs.

  20. Nitrogen fixed by wheat plants as affected by nitrogen fertilizer levels and Non-symbiotic bacteria

    International Nuclear Information System (INIS)

    Soliman, S.; Aly, S.S.M.; Gadalla, A.M.; Abou Seeda, M.

    1995-01-01

    Inorganic nitrogen is required for all egyptian soils for wheat. Free living and N 2-fixing microorganisms are able associate closely related with the roots of geraminacae. Pot experiment studies were carried out to examine the response of wheat plants to inoculation with Azospirillum Brasilense and Azotobacter Chroococcum, single or in combination, under various levels of ammonium sulfate interaction between both the inoculants increased straw or grain yield as well as N-uptake by wheat plants with increasing N levels. Results showed that grains of wheat plants derived over 19,24 and 15% of its N content from the atmospheric - N 2 (Ndfa) with application of 25,50 and 75 mg N kg-1 soil in the presence of + Azospirillum + azotobacter. The final amount of N 2-fixers. The highest values of N 2-fixed were observed with mixed inoculants followed by inoculation with Azospirillum and then azotobacter. The recovery of applied ammonium sulfate-N was markedly increased by inoculation with combined inoculants, but less in uninoculated treatments. Seeds inoculated with non-symbiotic fixing bacteria could be saved about 25 kg N without much affecting the grain yield. i fig., 4 tabs

  1. The effects of non-synonymous single nucleotide polymorphisms (nsSNPs) on protein-protein interactions.

    Science.gov (United States)

    Yates, Christopher M; Sternberg, Michael J E

    2013-11-01

    Non-synonymous single nucleotide polymorphisms (nsSNPs) are single base changes leading to a change to the amino acid sequence of the encoded protein. Many of these variants are associated with disease, so nsSNPs have been well studied, with studies looking at the effects of nsSNPs on individual proteins, for example, on stability and enzyme active sites. In recent years, the impact of nsSNPs upon protein-protein interactions has also been investigated, giving a greater insight into the mechanisms by which nsSNPs can lead to disease. In this review, we summarize these studies, looking at the various mechanisms by which nsSNPs can affect protein-protein interactions. We focus on structural changes that can impair interaction, changes to disorder, gain of interaction, and post-translational modifications before looking at some examples of nsSNPs at human-pathogen protein-protein interfaces and the analysis of nsSNPs from a network perspective. © 2013.

  2. Recent developments in the structural organization and regulation of nitrogen fixation genes in Herbaspirillum seropedicae.

    Science.gov (United States)

    Pedrosa, F O; Benelli, E M; Yates, M G; Wassem, R; Monteiro, R A; Klassen, G; Steffens, M B; Souza, E M; Chubatsu, L S; Rigo, L U

    2001-10-04

    Herbaspirillum seropedicae is a nitrogen-fixing bacterium found in association with economically important gramineae. Regulation of nitrogen fixation involves the transcriptional activator NifA protein. The regulation of NifA protein and its truncated mutant proteins is described and compared with that of other nitrogen fixation bacteria. Nitrogen fixation control in H. seropedicae, of the beta-subgroup of Proteobacteria, has regulatory features in common with Klebsiella pneumoniae, of the gamma-subgroup, at the level of nifA expression and with rhizobia and Azospirillum brasilense, of the alpha-subgroup, at the level of control of NifA by oxygen.

  3. Assessing ozone and nitrogen impact on net primary productivity with a Generalised non-Linear Model

    International Nuclear Information System (INIS)

    De Marco, Alessandra; Screpanti, Augusto; Attorre, Fabio; Proietti, Chiara; Vitale, Marcello

    2013-01-01

    Some studies suggest that in Europe the majority of forest growth increment can be accounted for N deposition and very little by elevated CO 2 . High ozone (O 3 ) concentrations cause reductions in carbon fixation in native plants by offsetting the effects of elevated CO 2 or N deposition. The cause-effect relationships between primary productivity (NPP) of Quercus cerris, Q. ilex and Fagus sylvatica plant species and climate and pollutants (O 3 and N deposition) in Italy have been investigated by application of Generalised Linear/non-Linear regression model (GLZ model). The GLZ model highlighted: i) cumulative O 3 concentration-based indicator (AOT40F) did not significantly affect NPP; ii) a differential action of oxidised and reduced nitrogen depositions to NPP was linked to the geographical location; iii) the species-specific variation of NPP caused by combination of pollutants and climatic variables could be a potentially important drive-factor for the plant species' shift as response to the future climate change. - Highlights: ► GLZ Models emphasized the role of combination of variables affecting NPP. ► A differential action of ox-N and red-N deposition to NPP was observed for plants. ► Different responses to climate and pollutants could affect the plant species' shift. - Ozone and nitrogen depositions have non-linear effects on primary productivity of tree species differently distributed in Italy.

  4. Nitrogen recycling from fuel-extracted algal biomass: residuals as the sole nitrogen source for culturing Scenedesmus acutus.

    Science.gov (United States)

    Gu, Huiya; Nagle, Nick; Pienkos, Philip T; Posewitz, Matthew C

    2015-05-01

    In this study, the reuse of nitrogen from fuel-extracted algal residues was investigated. The alga Scenedesmus acutus was found to be able to assimilate nitrogen contained in amino acids, yeast extracts, and proteinaceous alga residuals. Moreover, these alternative nitrogen resources could replace nitrate in culturing media. The ability of S. acutus to utilize the nitrogen remaining in processed algal biomass was unique among the promising biofuel strains tested. This alga was leveraged in a recycling approach where nitrogen is recovered from algal biomass residuals that remain after lipids are extracted and carbohydrates are fermented to ethanol. The protein-rich residuals not only provided an effective nitrogen resource, but also contributed to a carbon "heterotrophic boost" in subsequent culturing, improving overall biomass and lipid yields relative to the control medium with only nitrate. Prior treatment of the algal residues with Diaion HP20 resin was required to remove compounds inhibitory to algal growth. Copyright © 2014 Elsevier Ltd. All rights reserved.

  5. Cyanobacteria in CELSS: Growth strategies for nutritional variation and nitrogen cycling

    Science.gov (United States)

    Fry, I. V.; Packer, L.

    1990-01-01

    Cyanobacteria (blue-green algae) are versatile organisms which are capable of adjusting their cellular levels of carbohydrate, protein, and lipid in response to changes in the environment. Under stress conditions there is an imbalance between nitrogen metabolism and carbohydrate/lipid synthesis. The lesion in nitrogen assimilation is at the level of transport: the stress condition diverts energy from the active accumulation of nitrate to the extrusion of salt, and probably inhibits a cold-labile ATP'ace in the case of cold shock. Both situations affect the bioenergetic status of the cell such that the nitrogenous precursors for protein synthesis are depleted. Dispite the inhibition of protein synthesis and growth, photosynthetic reductant generation is relatively unaffected. The high O2 reductant would normally lead to photo-oxidative damage of cellular components; however, the organism copes by channeling the 'excess' reductant into carbon storage products. The increase in glycogen (28 to 35 percent dry weight increase) and the elongation of lipid fatty acid side chains (2 to 5 percent dry weight increase) at the expense of protein synthesis (25 to 34 percent dry weight decrease) results in carbohydrate, lipid and protein ratios that are closer to those required in the human diet. In addition, the selection of nitrogen fixing mutants which excrete ammonium ions present an opportunity to tailor these micro-organisms to meet the specific need for a sub-system to reverse potential loss of fixed nitrogen material.

  6. Autophagy supports biomass production and nitrogen use efficiency at the vegetative stage in rice.

    Science.gov (United States)

    Wada, Shinya; Hayashida, Yasukzu; Izumi, Masanori; Kurusu, Takamitsu; Hanamata, Shigeru; Kanno, Keiichi; Kojima, Soichi; Yamaya, Tomoyuki; Kuchitsu, Kazuyuki; Makino, Amane; Ishida, Hiroyuki

    2015-05-01

    Much of the nitrogen in leaves is distributed to chloroplasts, mainly in photosynthetic proteins. During leaf senescence, chloroplastic proteins, including Rubisco, are rapidly degraded, and the released nitrogen is remobilized and reused in newly developing tissues. Autophagy facilitates the degradation of intracellular components for nutrient recycling in all eukaryotes, and recent studies have revealed critical roles for autophagy in Rubisco degradation and nitrogen remobilization into seeds in Arabidopsis (Arabidopsis thaliana). Here, we examined the function of autophagy in vegetative growth and nitrogen usage in a cereal plant, rice (Oryza sativa). An autophagy-disrupted rice mutant, Osatg7-1, showed reduced biomass production and nitrogen use efficiency compared with the wild type. While Osatg7-1 showed early visible leaf senescence, the nitrogen concentration remained high in the senescent leaves. (15)N pulse chase analysis revealed suppression of nitrogen remobilization during leaf senescence in Osatg7-1. Accordingly, the reduction of nitrogen available for newly developing tissues in Osatg7-1 likely led its reduced leaf area and tillers. The limited leaf growth in Osatg7-1 decreased the photosynthetic capacity of the plant. Much of the nitrogen remaining in senescent leaves of Osatg7-1 was in soluble proteins, and the Rubisco concentration in senescing leaves of Osatg7-1 was about 2.5 times higher than in the wild type. Transmission electron micrographs showed a cytosolic fraction rich with organelles in senescent leaves of Osatg7-1. Our results suggest that autophagy contributes to efficient nitrogen remobilization at the whole-plant level by facilitating protein degradation for nitrogen recycling in senescent leaves. © 2015 American Society of Plant Biologists. All Rights Reserved.

  7. Effects of Mg on C and N Metabolism of Soybean at Different Nitrogen Supplying Levels

    Institute of Scientific and Technical Information of China (English)

    LANG Man; LIU Yuanying; PENG Xianlong; ZHANG Wenzhao

    2006-01-01

    A pot experiment was conducted to study the effects of magnesium on carbon and nitrogen metabolism of soybean at different nitrogen supplying levels. The results showed that the effects of magnesium at low nitrogen rate on N content, soluble protein, soluble sugar contents were not alike at different growth stage, although nodule dry weights raised, the yield and protein content of seeds decreased, however, the oil content was improved.The application of magnesium at medium and high nitrogen supplying levels promoted the uptake of N effectively,increased the soluble protein and soluble sugar contents, but the nodule dry weights of application magnesium at medium nitrogen supplying level decreased and the yield increased only a little despite the improved quality.Application of magnesium at high nitrogen supplying level raised nodule dry weights and soybean yield significantly, the quality of seeds was also improved.

  8. Optimising nitrogen in order to improve the efficiency, eco-physiology, yield and quality on one cultivar of durum wheat

    Directory of Open Access Journals (Sweden)

    Luigi Tedone

    2014-04-01

    Full Text Available A 3-year field experiment was carried out in southern Italy to evaluate the effect of different combinations of nitrogen (N fertilizer rates (0, 55, 90, 135 kg ha–1, time of application (sowing, tillering, stem elongation and number of nitrogen applications on durum wheat (Triticum turgidum L., var. durum. A total of eight different combinations - in terms of quantity and time of application - were arranged in a randomized complete block design with four replications. Soil plant analysis development was analysed along with leaf area index, grain and straw yield, plant height, plant lodging, thousand-kernel weight, non-vitreous kernels, shrunken and discarded kernels, hectolitre weight, grain protein content, and sodium dodecylsulfate sedimentation. Nitrogen contents of soil, grain and straw were measured in order to assess nitrogen efficiency. The results showed the positive effect of increased nitrogen dosages of 90 and 135 kg ha–1. The optimization of nitrogen administration increased by splitting the nitrogen into three application times, as shown by the eco-physiological, productive and qualitative parameters, and the nitrogen efficiency parameters measured (N application efficiency and N recovery fraction.

  9. Tissue protein metabolism in parasitized animals

    International Nuclear Information System (INIS)

    Symons, L.E.A.; Steel, J.W.; Jones, W.O.

    1981-01-01

    The effects of gastrointestinal nematode infection of mammals, particularly of the small intestine of the sheep, on protein metabolism of skeletal muscle, liver, the gastrointestinal tract and wool are described. These changes have been integrated to explain poor growth and production in the sheep heavily infected with Trichostrongylus colubriformis. The rates of both synthesis and catabolism of muscle protein are depressed, but nitrogen is lost from this tissue because the depression of synthesis exceeds that of catabolism. Anorexia is the major cause of these changes. Although the effect on liver protein synthesis is unclear, it is probable that the leakage of plasma proteins into the gastrointestinal tract stimulates an early increase in the rate of synthesis of these proteins, but this eventually declines and is insufficient to correct developing hypoalbuminaemia. Changes in the intestinal tract are complex. Exogenous nitrogen is reduced by anorexia, but the flow of nitrogen through the tract from abomasum to faeces is above normal because of the increase of endogenous protein from leakage of plasma protein and, presumably, from exfoliated epithelial cells. There is evidence that protein metabolism of intestinal tissue, particularly in the uninfected distal two-thirds, is increased. Synthesis of wool protein is decreased. As the result of anorexia, intestinal loss of endogenous protein and an increased rate of intestinal protein metabolism there is a net movement of amino nitrogen from muscle, liver and possibly skin to the intestine of the heavily infected sheep. Thus, the availability of amino nitrogen for growth and wool production is reduced. (author)

  10. Protein leverage effects of beef protein on energy intake in humans.

    Science.gov (United States)

    Martens, Eveline A; Tan, Sze-Yen; Dunlop, Mandy V; Mattes, Richard D; Westerterp-Plantenga, Margriet S

    2014-06-01

    The protein leverage hypothesis requires specific evidence that protein intake is regulated more strongly than energy intake. The objective was to determine ad libitum energy intake, body weight changes, appetite profile, and nitrogen balance in response to 3 diets with different protein-to-carbohydrate + fat ratios over 12 consecutive days, with beef as a source of protein. A 3-arm, 12-d randomized crossover study was performed in 30 men and 28 women [mean ± SD age: 33 ± 16 y; body mass index (in kg/m²): 24.4 ± 4.0] with the use of diets containing 5%, 15%, and 30% of energy (En%) from protein, predominantly from beef. Energy intake was significantly lower in the 30En%-protein condition (8.73 ± 1.93 MJ/d) than in the 5En%-protein (9.48 ± 1.67 MJ/d) and 15En%-protein (9.30 ± 1.62 MJ/d) conditions (P = 0.001), stemming largely from lower energy intake during meals (P = 0.001). Hunger (P = 0.001) and desire to eat (P = 0.001) ratings were higher and fullness ratings were lower (P = 0.001) in the 5En%-protein condition than in the 15En%-protein and 30En%-protein conditions. Nitrogen excretion was lower in the 5En%-protein condition (4.7 ± 1.5 g/24 h; P = 0.001) and was higher in the 30En%-protein condition (15.3 ± 8.7 g/24 h; P = 0.001) compared with the 15En%-protein condition (10.0 ± 5.2 g/24 h). Nitrogen balance was maintained in the 5En%-protein condition and was positive in the 15En%- and 30En%-protein conditions (P = 0.001). Complete protein leverage did not occur because subjects did not consume to a common protein amount at the expense of energy balance. Individuals did underconsume relative to energy requirements from high-protein diets. The lack of support for protein leverage effects on a low-protein diet may stem from the fact that protein intake was sufficient to maintain nitrogen balance over the 12-d trial. © 2014 American Society for Nutrition.

  11. Phenylbutyrate improves nitrogen disposal via alternative pathway without eliciting an increase in protein breakdown and catabolism in control and ornithine transcarbamylace-deficient patients

    Science.gov (United States)

    Phenylbutyrate (PB) is a drug used in urea cycle disorder patients to elicit alternative pathways for nitrogen disposal. However, PB decreases plasma branched chain amino acid (BCAA) concentrations and prior research suggests that PB may increase leucine oxidation, indicating increased protein degra...

  12. Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L.) increases seed protein content and weight without augmenting nitrogen supplying.

    Science.gov (United States)

    Zhao, Xiao-Qiang; Nie, Xuan-Li; Xiao, Xing-Guo

    2013-01-01

    Heavy nitrogen (N) application to gain higher yield of wheat (Triticum aestivum L.) resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR) in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed), respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s) in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

  13. Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L. increases seed protein content and weight without augmenting nitrogen supplying.

    Directory of Open Access Journals (Sweden)

    Xiao-Qiang Zhao

    Full Text Available Heavy nitrogen (N application to gain higher yield of wheat (Triticum aestivum L. resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed, respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

  14. Acute differential effects of dietary protein quality on postprandial lipemia in obese non-diabetic subjects

    DEFF Research Database (Denmark)

    Holmer-Jensen, Jens; Mortensen, Lene Sundahl; Astrup, Arne

    2013-01-01

    Non-fasting triglyceridemia is much closer associated to cardiovascular risk compared to fasting triglyceridemia. We hypothesized that there would be acute differential effects of four common dietary proteins (cod protein, whey isolate, gluten, and casein) on postprandial lipemia in obese non......-diabetic subjects. To test the hypothesis we conducted a randomized, acute clinical intervention study with crossover design. We supplemented a fat rich mixed meal with one of four dietary proteins i.e. cod protein, whey protein, gluten or casein. Eleven obese non-diabetic subjects (age: 40-68, body mass index: 30...... concentration in the chylomicron rich fraction (P = .0293). Thus, we have demonstrated acute differential effects on postprandial metabolism of four dietary proteins supplemented to a fat rich mixed meal in obese non-diabetic subjects. Supplementation with whey protein caused lower postprandial lipemia compared...

  15. Effects of dietary fermented spent coffee ground on nutrient digestibility and nitrogen utilization in sheep.

    Science.gov (United States)

    Choi, Yongjun; Rim, Jong-Su; Na, Youngjun; Lee, Sang Rak

    2018-03-01

    The objective of the study was to determine the effect of fermented spent coffee ground (FSCG) on nutrient digestibility and nitrogen utilization in sheep. Fermentation of spent coffee ground (SCG) was conducted using Lactobacillus plantrum . Fermentation was performed at moisture content of 70% and temperature of 39°C with anaerobic air tension for 48 h. Four adult rams (initial body weight = 56.8±0.4 kg) were housed in a respiration-metabolism chamber and the treatments were: i) control (Basal diet; 0% SCG or FSCG), ii) 10% level of SCG, iii) 10% level of FSCG, and iv) 20% level of FSCG in 4×4 Latin square design. Each dietary experiment period lasted for 18-d with a 14-d of adaptation period and a 4-d of sample collection period. In SCG fermentation experimental result, acid detergent insoluble nitrogen (ADIN) concentration of FSCG (64.5% of total N) was lower than that of non-fermented SCG (78.8% of total N). Digestibility of dry matter and organic matter was similar among treatment groups. Although crude protein (CP) digestibility of the control was greater than FSCG groups (pdigestibility and nitrogen retention than non-fermented 10% SCG group (pdigestibility, thereby increasing CP digestibility and nitrogen utilization in sheep. Fermentation using microorganisms in feed ingredients with low digestibility could have a positive effect on improving the quality of raw feed.

  16. Highly enhanced electrochemical activity of Ni foam electrodes decorated with nitrogen-doped carbon nanotubes for non-aqueous redox flow batteries

    Science.gov (United States)

    Lee, Jungkuk; Park, Min-Sik; Kim, Ki Jae

    2017-02-01

    Nitrogen-doped carbon nanotubes (NCNTs) are directly grown on the surface of a three-dimensional (3D) Ni foam substrate by floating catalytic chemical vapor deposition (FCCVD). The electrochemical properties of the 3D NCNT-Ni foam are thoroughly examined as a potential electrode for non-aqueous redox flow batteries (RFBs). During synthesis, nitrogen atoms can be successfully doped onto the carbon nanotube (CNT) lattices by forming an abundance of nitrogen-based functional groups. The 3D NCNT-Ni foam electrode exhibits excellent electrochemical activities toward the redox reactions of [Fe (bpy)3]2+/3+ (in anolyte) and [Co(bpy)3]+/2+ (in catholyte), which are mainly attributed to the hierarchical 3D structure of the NCNT-Ni foam electrode and the catalytic effect of nitrogen atoms doped onto the CNTs; this leads to faster mass transfer and charge transfer during operation. As a result, the RFB cell assembled with 3D NCNT-Ni foam electrodes exhibits a high energy efficiency of 80.4% in the first cycle; this performance is maintained up to the 50th cycle without efficiency loss.

  17. PLASMA PROTEIN AND HEMOGLOBIN PRODUCTION

    Science.gov (United States)

    Robscheit-Robbins, F. S.; Miller, L. L.; Whipple, G. H.

    1947-01-01

    Given healthy dogs fed abundant iron and protein-free or low protein diets with sustained anemia and hypoproteinemia, we can study the capacity of these animals to produce simultaneously new hemoglobin and plasma protein. Reserve stores of blood protein-building materials are measurably depleted and levels of 6 to 8 gm. per cent for hemoglobin and 4 to 5 gm. per cent for plasma protein can be maintained for weeks or months depending upon the intake of food proteins or amino acid mixtures. These dogs are very susceptible to infection and various poisons. Dogs tire of these diets and loss of appetite terminates many experiments. Under these conditions (double depletion) standard growth mixtures of essential amino acids are tested to show the response in blood protein output and urinary nitrogen balance. As a part of each tabulated experiment one of the essential amino acids is deleted from the complete growth mixture to compare such response with that of the whole mixture. Methionine, threonine, phenylalanine, and tryptophane when singly eliminated from the complete amino acid mixture do effect a sharp rise in urinary nitrogen. This loss of urinary nitrogen is corrected when the individual amino acid is replaced in the mixture. Histidine, lysine, and valine have a moderate influence upon urinary nitrogen balance toward nitrogen conservation. Leucine, isoleucine, and arginine have minimal or no effect upon urinary nitrogen balance when these individual amino acids are deleted from the complete growth mixture of amino acids during 3 to 4 week periods. Tryptophane and to a less extent phenylalanine and threonine when returned to the amino acid mixture are associated with a conspicuous preponderance of plasma protein output over the hemoglobin output (Table 4). Arginine, lysine, and histidine when returned to the amino acid mixture are associated with a large preponderance of hemoglobin output. Various amino acid mixtures under these conditions may give a positive

  18. [Research advance in nitrogen metabolism of plant and its environmental regulation].

    Science.gov (United States)

    Xu, Zhenzhu; Zhou, Guangsheng

    2004-03-01

    Nitrogen metabolism is not only one of the basic processes of plant physiology, but also one of the important parts of global chemical cycle. Plant nitrogen assimilation directly takes part in the synthesis and conversion of amino acid through the reduction of nitrate. During this stage, some key enzymes, e.g., nitrate reductase (NR), glutamine synthetase (GS), glutamate dehydrogenase (GDH), glutamine synthase (GOGAT), aspargine synthetase (AS), and asparate aminotransferase (AspAT) participate these processes. The protein is assimilated in plant cell through amino acid, and becomes a part of plant organism through modifying, classifying, transporting and storing processes, etc. The nitrogen metabolism is associated with carbonic metabolism through key enzyme regulations and the conversion of products, which consists of basic life process. Among these amino acids in plant cell, glutamic acid (Glu), glutamine (Gln), aspartic acid (Asp) and asparagines (Asn), etc., play a key role, which regulates their conversion each other and their contents in the plant cell through regulating formation and activity of those key enzymes. Environmental factors also affect the conversion and recycle of the key amino acids through regulating gene expression of the key enzymes and their activities. Nitrate and light intensity positively regulate the gene transcription of NR, but ammonium ions and Glu, Gln do the negative way. Water deficit is a very serious constraint on N2 fixation rate and soybean (Glycine max Merr.) grain yield, in which, ureide accumulation and degradation under water deficit appear to be the key issues of feedback mechanism on nitrogen fixation. Water stress decreases NR activity, but increases proteinase activity, and thus, they regulate plant nitrogen metabolism, although there are some different effects among species and cultivars. Water stress also decreases plant tissue protein content, ratio of protein and amino acid, and reduces the absorption of amino

  19. Diet-animal fractionation of nitrogen stable isotopes reflects the efficiency of nitrogen assimilation in ruminants.

    Science.gov (United States)

    Cantalapiedra-Hijar, G; Ortigues-Marty, I; Sepchat, B; Agabriel, J; Huneau, J F; Fouillet, H

    2015-04-14

    The natural abundance of ¹⁵N in animal proteins (δ¹⁵Nanimal) is greater than that in the diet consumed by the animals (δ¹⁵Ndiet), with a discrimination factor (Δ¹⁵N = δ¹⁵Nanimal - δ¹⁵Ndiet) that is known to vary according to nutritional conditions. The objectives of the present study were to test the hypothesis that Δ¹⁵N variations depend on the efficiency of nitrogen utilisation (ENU) in growing beef cattle, and to identify some of the physiological mechanisms responsible for this N isotopic fractionation in ruminants. Thus, we performed the regression of the Δ¹⁵N of plasma proteins obtained from thirty-five finishing beef cattle fed standard and non-conventional diets against different feed efficiency indices, including ENU. We also performed the regression of the Δ¹⁵N of different ruminant N pools (plasma and milk proteins, urine and faeces) against different splanchnic N fluxes obtained from multi-catheterised lactating dairy cows. The Δ¹⁵N of plasma proteins was negatively correlated with feed efficiency indices in beef cattle, especially ENU (body protein gain/N intake) and efficiency of metabolisable protein (MP) utilisation (body protein gain/MP intake). Although Δ¹⁵N obtained from different N pools in dairy cows were all negatively correlated with ENU, the highest correlation was found when Δ¹⁵N was calculated from plasma proteins. Δ¹⁵N showed no correlation with urea-N recycling or rumen NH₃ absorption, but exhibited a strong correlation with liver urea synthesis and splanchnic amino acid metabolism, which points to a dominant role of splanchnic tissues in the present N isotopic fractionation study.

  20. Intake, digestibility, and rumen and metabolic characteristics of cattle fed low-quality tropical forage and supplemented with nitrogen and different levels of starch.

    Science.gov (United States)

    de Oliveira Franco, Marcia; Detmann, Edenio; de Campos Valadares Filho, Sebastião; Batista, Erick Darlisson; de Almeida Rufino, Luana Marta; Barbosa, Marcília Medrado; Lopes, Alexandre Ribeiro

    2017-06-01

    Effects of nitrogen supplementation associated with different levels of starch on voluntary intake, digestibility, and rumen and metabolic characteristics of cattle fed low-quality tropical forage ( Brachiaria decumbens hay, 7.4% crude protein, CP) were evaluated using ruminal and abomasal cannulated steers. Five European×Zebu young bulls (186 kg body weight, BW) were distributed according to a 5×5 Latin square. The following treatments were evaluated: control, supplementation with 300 g CP/d (0:1), supplementation with 300 g starch/d and 300 g CP/d (1:1), supplementation with 600 g starch/d and 300 g CP/d (2:1), and supplementation with 900 g starch/d and 300 g CP/d (3:1). A mixture of nitrogenous compounds provided 1/3 from true protein (casein) and 2/3 from non-protein nitrogen (mixture of urea and ammonium sulphate, 9:1) was used as the nitrogen supplement. In order to supply energy a unique source of corn starch was used. Supplements increased (p0.05) forage intake. There was a cubic effect (pdigestibility, but did not affect (p>0.05) neutral detergent fibre corrected for ash and protein (NDFap) digestibility. There was a positive linear effect (pdigestibility. Total NDFap digestibility was not affected (p>0.05) by the amount of supplemental starch. Ruminal ammonia nitrogen concentrations were higher (p<0.05) in supplemented animals, however, a negative linear effect (p<0.05) of amount of starch was observed. Supplements increased (p<0.05) the nitrogen balance (NB) and efficiency of nitrogen utilization. These effects were attributed to increased body anabolism, supported by higher (p<0.05) serum concentration of insulin-like growth factor 1. Increasing the amount of starch tended (p<0.06) to linearly increase the NB. In spite of this, there was a highest NB value for the 2:1 starch:CP ratio amongst the treatments with supplementation. Nitrogen supplementation in cattle fed low-quality tropical forage increases nitrogen retention in the animal's body. An

  1. Removal of nitrogen compounds from gasification gas by selective catalytic or non-catalytic oxidation; Typpiyhdisteiden poisto kaasutuskaasusta selektiivisellae katalyyttisellae ja ei-katalyyttisellae hapetuksella

    Energy Technology Data Exchange (ETDEWEB)

    Leppaelahti, J.; Koljonen, T. [VTT Energy, Espoo (Finland)

    1996-12-01

    In gasification reactive nitrogenous compounds are formed from fuel nitrogen, which may form nitrogen oxides in gas combustion. In fluidized bed gasification the most important nitrogenous compound is ammonia (NH{sub 3}). If ammonia could be decomposed to N{sub 2} already before combustion, the emissions if nitrogen oxides could be reduced significantly. One way of increasing the decomposition rate of NH{sub 3} could be the addition of suitable reactants to the gas, which would react with NH{sub 3} and produce N{sub 2}. The aim of this research is to create basic information, which can be used to develop a new method for removal of nitrogen compounds from gasification gas. The reactions of nitrogen compounds and added reactants are studied in reductive atmosphere in order to find conditions, in which nitrogen compounds can be oxidized selectively to N{sub 2}. The project consists of following subtasks: (1) Selective non-catalytic oxidation (SNCO): Reactions of nitrogen compounds and oxidizers in the gas phase, (2) Selective catalytic oxidation (SCO): Reactions of nitrogen compounds and oxidizers on catalytically active surfaces, (3) Kinetic modelling of experimental results in co-operation with the Combustion Chemistry Research Group of Aabo Akademi University. The most important finding has been that NH{sub 3} can be made to react selectively with the oxidizers even in the presence of large amounts of CO and H{sub 2}. Aluminium oxides were found to be the most effective materials promoting selectivity. (author)

  2. Effects of Pineal Proteins on Biochemical, Enzyme Profile and Non ...

    African Journals Online (AJOL)

    Effects of Pineal Proteins on Biochemical, Enzyme Profile and Non-Specific Immune Response of Indian Goats under Thermal Stress. ... Total precipitated pineal proteins successfully and significantly relieved the animals from adverse effects of heat stress and metyrapone treatment. There is evidence that most of the ...

  3. Nitrogen metabolism in the tissues of the ruminant

    International Nuclear Information System (INIS)

    Buttery, P.J.

    1986-01-01

    Protein metabolism in animals is in a constant state of flux, the processes of protein synthesis and protein breakdown acting against each other, and the balance between the two processes causing changes in the mass of protein in a tissue. Reduction in the diet reduces both protein synthesis and protein degradation unless the dietary depletion is severe and prolonged, when there is a marked increase in protein catabolism. The synthesis and degradation of protein can be manipulated by anabolic agents, thus increasing the efficiency of animals. While the use of these agents has met with success in many countries, it remains to be seen whether they will be useful in harsh environments. Lactation and pregnancy put an extra demand on the nitrogen economy of animals. Evidence indicates that the extra amino acids needed for milk production do not come from muscle protein breakdown. Many animals in harsh environments are infected with parasites; intestinal parasites reduce food intake and cause blood loss into the intestines. Associated with this is a general disruption of protein metabolism. In all these studies, isotopic techniques have played a vital role. Few studies have been conducted on nitrogen metabolism in the tissue of ruminants exposed to harsh environments (with one notable exception: rumen function studies, some of which are described elsewhere in the Proceedings of this Seminar). This lack of work on nitrogen metabolism of animals from the harsher environments has often made it necessary to extrapolate data obtained from animals found and maintained in the temperate zones to quite different environments and to animals maintained on quite different dietary regimens. Several examples of the use of isotopes in metabolic studies with animals to yield information of direct or potential relevance to the harsh environments are presented. (author)

  4. Dry land Winter Wheat Yield, Grain Protein, and Soil Nitrogen Responses to Fertilizer and Bio solids Applications

    International Nuclear Information System (INIS)

    Koenig, R.T.; Cogger, C.G.; Bary, A.I.

    2011-01-01

    Applications of bio solids were compared to inorganic nitrogen (N) fertilizer for two years at three locations in eastern Washington State, USA, with diverse rainfall and soft white, hard red, and hard white winter wheat (Triticum aestivum L.) cultivars. High rates of inorganic N tended to reduce yields, while grain protein responses to N rate were positive and linear for all wheat market classes. Bio solids produced 0 to 1400 kg ha -1 (0 to 47%) higher grain yields than inorganic N. Wheat may have responded positively to nutrients other than N in the bio solids or to a metered N supply that limited vegetative growth and the potential for moisture stress-induced reductions in grain yield in these dry land production systems. Grain protein content with bio solids was either equal to or below grain protein with inorganic N, likely due to dilution of grain N from the higher yields achieved with bio solids. Results indicate the potential to improve dry land winter wheat yields with bio solids compared to inorganic N alone, but perhaps not to increase grain protein concentration of hard wheat when bio solids are applied immediately before planting.

  5. Manipulating vineyard nitrogen on a saline site: 1. Effect of nitrogen on growth, grape yield and nutrients of Vitis vinifera L. cv Shiraz.

    Science.gov (United States)

    Bell, Sally-Jean; Francis, I Leigh

    2013-08-15

    With increased prevalence of saline irrigation water applied to vines worldwide, the issue of appropriate nitrogen management is of concern. Different rates of nitrogen per vine as urea were applied to Shiraz vines on own roots over four seasons in a low-rainfall, saline growing environment. Application of nitrogen in the vineyard early in the season not only altered the vine nitrogen status but also increased some other elements in the petioles, notably chloride and sodium but also manganese and magnesium. In contrast, nitrogen application decreased petiole phosphorus. In comparison with the majority of nitrogen studies on non-saline sites, nitrogen-induced growth responses were restricted under the saline conditions in this study. While some changes in canopy density in response to nitrogen were observed, this did not affect light interception in the fruit zone. Yield responses were varied and could be related to the nutritional conditions under which bud development and flowering took place. This study demonstrated that current best practice guidelines, in terms of rate of nitrogen applied, for correcting a nitrogen deficiency on a non-saline site may not be appropriate for saline sites and that application of nitrogen can increase the potential for salt toxicity in vines. © 2013 Society of Chemical Industry.

  6. Nitrogen sparing by 2-ketoisocaproate in parenterally fed rats

    International Nuclear Information System (INIS)

    Yagi, M.; Matthews, D.E.; Walser, M.

    1990-01-01

    In rats receiving total parenteral nutrition with or without sodium 2-ketoisocaproate (KIC; 2.48 g.kg-1.day-1), L-[1- 13 C]leucine and [1- 14 C]KIC were constantly infused for 6 h. CO 2 production, 14 CO 2 production, 13 CO 2 enrichment, urinary urea nitrogen (N) plus ammonia N and total urinary N were measured. Whole body protein synthesis (S) was calculated in non-KIC-infused rats and also in unfed rats infused with [1- 14 C]leucine from fractional oxidation of labeled leucine (1-F), where F is fractional utilization for protein synthesis, and urea N plus ammonia N excretion (C) as S = C x F/(1-F). Addition of KIC caused a significant reduction in N excretion and a significant improvement in N balance. Fractional oxidation of labeled KIC increased, whereas fractional utilization of labeled KIC for protein synthesis decreased, but the extent of incorporation of infused KIC into newly synthesized protein (as leucine) amounted to at least 40% of the total rate of leucine incorporation into newly synthesized whole body protein. We conclude that addition of KIC spares N in parenterally fed rats and becomes a major source of leucine for protein synthesis

  7. Estimation of daily protein intake based on spot urine urea nitrogen concentration in chronic kidney disease patients.

    Science.gov (United States)

    Kanno, Hiroko; Kanda, Eiichiro; Sato, Asako; Sakamoto, Kaori; Kanno, Yoshihiko

    2016-04-01

    Determination of daily protein intake in the management of chronic kidney disease (CKD) requires precision. Inaccuracies in recording dietary intake occur, and estimation from total urea excretion presents hurdles owing to the difficulty of collecting whole urine for 24 h. Spot urine has been used for measuring daily sodium intake and urinary protein excretion. In this cross-sectional study, we investigated whether urea nitrogen (UN) concentration in spot urine can be used to predict daily protein intake instead of the 24-h urine collection in 193 Japanese CKD patients (Stages G1-G5). After patient randomization into 2 datasets for the development and validation of models, bootstrapping was used to develop protein intake estimation models. The parameters for the candidate multivariate regression models were male gender, age, body mass index (BMI), diabetes mellitus, dyslipidemia, proteinuria, estimated glomerular filtration rate, serum albumin level, spot urinary UN and creatinine level, and spot urinary UN/creatinine levels. The final model contained BMI and spot urinary UN level. The final model was selected because of the higher correlation between the predicted and measured protein intakes r = 0.558 (95 % confidence interval 0.400, 0.683), and the smaller distribution of the difference between the measured and predicted protein intakes than those of the other models. The results suggest that UN concentration in spot urine may be used to estimate daily protein intake and that a prediction formula would be useful for nutritional control in CKD patients.

  8. Phosphoproteome of the cyanobacterium Synechocystis sp. PCC 6803 and its dynamics during nitrogen starvation.

    Directory of Open Access Journals (Sweden)

    Philipp eSpät

    2015-03-01

    Full Text Available Cyanobacteria have shaped the earth’s biosphere as the first oxygenic photoautotrophs and still play an important role in many ecosystems. The ability to adapt to changing environmental conditions is an essential characteristic in order to ensure survival. To this end, numerous studies have shown that bacteria use protein post-translational modifications such as Ser/Thr/Tyr phosphorylation in cell signalling, adaptation and regulation. Nevertheless, our knowledge of cyanobacterial phosphoproteomes and their dynamic response to environmental stimuli is relatively limited. In this study, we applied gel-free methods and high accuracy mass spectrometry towards the unbiased detection of Ser/Thr/Tyr phosphorylation events in the model cyanobacterium Synechocystis sp. PCC 6803. We could identify over 300 phosphorylation events in cultures grown on nitrate as exclusive nitrogen source. Chemical dimethylation labelling was applied to investigate proteome and phosphoproteome dynamics during nitrogen starvation. Our dataset describes the most comprehensive (phosphoproteome of Synechocystis to date, identifying 2,382 proteins and 183 phosphorylation events and quantifying 2,111 proteins and 148 phosphorylation events during nitrogen starvation. Global protein phosphorylation levels were increased in response to nitrogen depletion after 24 hours. Among the proteins with increased phosphorylation, the PII signalling protein showed the highest fold-change, serving as positive control. Other proteins with increased phosphorylation levels comprised functions in photosynthesis and in carbon and nitrogen metabolism. This study reveals dynamics of Synechocystis phosphoproteome in response to environmental stimuli and suggests an important role of protein Ser/Thr/Tyr phosphorylation in fundamental mechanisms of homeostatic control in cyanobacteria.

  9. Nitrogen inputs by precipitation in the Nigerian Savanna | Adeniyi ...

    African Journals Online (AJOL)

    Inorganic nitrogen input via direct bulk precipitation was measured, and the relation between the different nitrogen species and rainfall characteristics determined over three rainy seasons at Shagunu, a remote, sparsely populated, non-industrialized site in the northern Guinea savanna of Nigeria. Nitrogen concentration per ...

  10. Nitrogen depletion in field red giants

    DEFF Research Database (Denmark)

    Masseron, T.; Lagarde, N.; Miglio, A.

    2017-01-01

    , the behaviour of nitrogen data along the evolution confirms the existence of non-canonical extramixing on the red giant branch (RGB) for all low-mass stars in the field. But more surprisingly, the data indicate that nitrogen has been depleted between the RGB tip and the red clump. This may suggest that some...

  11. Using biophysical models to manage nitrogen pollution from agricultural sources: Utopic or realistic approach for non-scientist users? Case study of a drinking water catchment area in Lorraine, France.

    Science.gov (United States)

    Bernard, Pierre-Yves; Benoît, Marc; Roger-Estrade, Jean; Plantureux, Sylvain

    2016-12-01

    The objectives of this comparison of two biophysical models of nitrogen losses were to evaluate first whether results were similar and second whether both were equally practical for use by non-scientist users. Results were obtained with the crop model STICS and the environmental model AGRIFLUX based on nitrogen loss simulations across a small groundwater catchment area (<1 km(2)) located in the Lorraine region in France. Both models simulate the influences of leaching and cropping systems on nitrogen losses in a relevant manner. The authors conclude that limiting the simulations to areas where soils with a greater risk of leaching cover a significant spatial extent would likely yield acceptable results because those soils have more predictable leaching of nitrogen. In addition, the choice of an environmental model such as AGRIFLUX which requires fewer parameters and input variables seems more user-friendly for agro-environmental assessment. The authors then discuss additional challenges for non-scientists such as lack of parameter optimization, which is essential to accurately assessing nitrogen fluxes and indirectly not to limit the diversity of uses of simulated results. Despite current restrictions, with some improvement, biophysical models could become useful environmental assessment tools for non-scientists. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Effect of Nitrogen and Phosphorus on Yield and Yield Components of Sesame (Sesamumindicum L.)

    OpenAIRE

    Muhammad Ibrahim; Manzoor Hussain; Ahmad Khan; Yousaf Jamal; Muhammad Ali; Muhammad Faisal Anwar Malik

    2014-01-01

    Nitrogen is a structural component of chlorophyll and protein therefore adequate supply of nitrogen is beneficial for both carbohydrates and protein metabolism as it promotes cell division and cell enlargement, resulting in more leaf area and thus ensuring good seed and dry matter yield. Theexperiment entitled effect of nitrogen and phosphorus on yield and yield components of sesame were conducted at New Developmental Farm of the University of Agriculture Peshawar during kharif 2013. Randomiz...

  13. Biogeochemical characteristics of suspended particulate matter in deep chlorophyll maximum layers in the southern East China Sea

    Directory of Open Access Journals (Sweden)

    Q. Liu

    2018-04-01

    Full Text Available Continental shelves and marginal seas are key sites of particulate organic matter (POM production, remineralization and sequestration, playing an important role in the global carbon cycle. Elemental and stable isotopic compositions of organic carbon and nitrogen are thus frequently used to characterize and distinguish POM and its sources in suspended particles and surface sediments in the marginal seas. Here we investigated suspended particulate matter (SPM collected around deep chlorophyll maximum (DCM layers in the southern East China Sea for particulate organic carbon and nitrogen (POC and PN contents and their isotopic compositions (δ13CPOC and δ15NPN to understand provenance and dynamics of POM. Hydrographic parameters (temperature, salinity and turbidity indicated that the study area was weakly influenced by freshwater derived from the Yangtze River during summer 2013. Elemental and isotopic results showed a large variation in δ13CPOC (−25.8 to −18.2 ‰ and δ15NPN (3.8 to 8.0 ‰, but a narrow molar C ∕ N ratio (4.1–6.3 and low POC ∕ Chl a ratio ( <  200 g g−1 in POM, and indicated that the POM in DCM layers was newly produced by phytoplankton. In addition to temperature effects, the range and distribution of δ13CPOC were controlled by variations in primary productivity and phytoplankton species composition; the former explained  ∼  70 % of the variability in δ13CPOC. However, the variation in δ15NPN was controlled by the nutrient status and δ15NNO3− in seawater, as indicated by similar spatial distribution between δ15NPN and the current pattern and water masses in the East China Sea; although interpretations of δ15NPN data should be verified with the nutrient data in future studies. Furthermore, the POM investigated was weakly influenced by the terrestrial OM supplied by the Yangtze River during summer 2013 due to the reduced sediment supply by the Yangtze River and north

  14. Role of the outer-edge flame on flame extinction in nitrogen-diluted non-premixed counterflow flames with finite burner diameters

    KAUST Repository

    Chung, Yong Ho

    2013-03-01

    This study of nitrogen-diluted non-premixed counterflow flames with finite burner diameters investigates the important role of the outer-edge flame on flame extinction through experimental and numerical analyses. It explores flame stability diagrams mapping the flame extinction response of nitrogen-diluted non-premixed counterflow flames to varying global strain rates in terms of burner diameter, burner gap, and velocity ratio. A critical nitrogen mole fraction exists beyond which the flame cannot be sustained; the critical nitrogen mole fraction versus global strain rate curves have C-shapes for various burner diameters, burner gaps, and velocity ratios. At sufficiently high strain-rate flames, these curves collapse into one curve; therefore, the flames follow the one-dimensional flame response of a typical diffusion flame. Low strain-rate flames are significantly affected by radial conductive heat loss, and therefore flame length. Three flame extinction modes are identified: flame extinction through shrinkage of the outer-edge flame with or without oscillations at the outer-edge flame prior to the extinction, and flame extinction through a flame hole at the flame center. The extinction modes are significantly affected by the behavior of the outer-edge flame. Detailed explanations are provided based on the measured flame-surface temperature and numerical evaluation of the fractional contribution of each term in the energy equation. Radial conductive heat loss at the flame edge to ambience is the main mechanism of extinction through shrinkage of the outer-edge flame in low strain-rate flames. Reduction of the burner diameter can extend the flame extinction mode by shrinking the outer-edge flame in higher strain-rate flames. © 2012 Elsevier Ltd. All rights reserved.

  15. Measurement of cross sections for the scattering of neutrons in the energy range from 2 MeV to 4 MeV with the 15N(p,n) reaction as neutron source

    International Nuclear Information System (INIS)

    Poenitz, Erik

    2010-01-01

    In future nuclear facilities, the materials lead and bismuth can play a more important role than in today's nuclear reactors. Reliable cross section data are required for the design of those facilities. In particular the neutron transport in the lead spallation target of an Accelerator-Driven Subcritical Reactor strongly depends on the inelastic neutron scattering cross sections in the energy region from 0.5 MeV to 6 MeV. In the recent 20 years, elastic and inelastic neutron scattering cross sections were measured with high precision for a variety of elements at the PTB time-of-flight spectrometer. The D(d,n) reaction was primarily used for the production of neutrons. Because of the Q value of the reaction and the available deuteron energies, neutrons in the energy range from 6 MeV to 16 MeV can be produced. For the cross section measurement at lower energies, however, another neutron producing reaction is required. The 15 N(p,n) 15 O reaction was chosen, as it allows the production of monoenergetic neutrons with up to 5.7MeV energy. In this work, the 15 N(p,n) reaction was studied with focus on the suitability as a source for monoenergetic neutrons in scattering experiments. This includes the measurement of differential cross sections for the neutron producing reaction and the choice of optimum target conditions. Differential elastic and inelastic neutron scattering cross sections were measured for lead at four energies in the region from 2 MeV to 4 MeV incident neutron energy using the time-of-flight technique. A lead sample with natural isotopic composition was used. NE213 liquid scintillation detectors with well-known detection efficiencies were used for the detection of the scattered neutrons. Angle-integrated cross sections were determined by a Legendre polynomial expansion using least-squares methods. Additionally, measurements were carried out for isotopically pure 209 Bi and 181 Ta samples at 4 MeV incident neutron energy. Results are compared with other

  16. Resistance training reduces whole-body protein turnover and improves net protein retention in untrained young males.

    Science.gov (United States)

    Hartman, Joseph W; Moore, Daniel R; Phillips, Stuart M

    2006-10-01

    It is thought that resistance exercise results in an increased need for dietary protein; however, data also exists to support the opposite conclusion. The purpose of this study was to determine the impact of resistance exercise training on protein metabolism in novices with the hypothesis that resistance training would reduce protein turnover and improve whole-body protein retention. Healthy males (n = 8, 22 +/- 1 y, BMI = 25.3 +/- 1.8 kg.m(-2)) participated in a progressive whole-body split routine resistance-training program 5d/week for 12 weeks. Before (PRE) and after (POST) the training, oral [15N]-glycine ingestion was used to assess nitrogen flux (Q), protein synthesis (PS), protein breakdown (PB), and net protein balance (NPB = PS-PB). Macronutrient intake was controlled over a 5d period PRE and POST, while estimates of protein turnover and urinary nitrogen balance (N(bal) = N(in) - urine N(out)) were conducted. Bench press and leg press increased 40% and 50%, respectively (p training-induced increases in both NPB (PRE = 0.22 +/- 0.13 g.kg(-1).d(-1); POST = 0.54 +/- 0.08 g.kg(-1).d(-1)) and urinary nitrogen balance (PRE = 2.8 +/- 1.7 g N.d(-1); POST = 6.5 +/- 0.9 g N.d(-1)) were observed. A program of resistance training that induced significant muscle hypertrophy resulted in reductions of both whole-body PS and PB, but an improved NPB, which favoured the accretion of skeletal muscle protein. Urinary nitrogen balance increased after training. The reduction in PS and PB and a higher NPB in combination with an increased nitrogen balance after training suggest that dietary requirements for protein in novice resistance-trained athletes are not higher, but lower, after resistance training.

  17. Nitrogen metabolism and protozoa production rate in cattle fed on diet containing protected protein

    International Nuclear Information System (INIS)

    Singh, G.P.; Gupta, B.N.

    1992-01-01

    Nitrogen metabolism and protozoa production rate using 14 C-choline as marker were studied on 9 adult male crossbred (Tharparker x Brown Swiss) rumen fistulated animals divided into 3 groups (A, B and C). All the animals were fed concentrate mixture and wheatstraw. However, groundnut cake (GNC) in concentrate mixture was untreated in group A, 50 per cent formaldehyde treated in group B and 100 per cent formaldehyde treated in group C. Although, DM intake was similar in these groups but water intake was significantly (P<0.05) higher in control group. Total-N, ammonia-N and blood urea were significantly lower in group B and C as compared to group A. Apparent CP digestibility was not affected by addition of formaldehyde treated GNC at 50 and 100 per cent levels. However, N balances increased significantly (P<0.05) due to addition of protected protein in diet. Protozoal pool as well as production rate were significantly (P<0.01) decreased due to formaldehyde treatment of GNC protein. Thus addition of formaldehyde treated GNC in diets decreased ammonia and protozoa production but increased N retention in groups B and C. (author). 27 refs., 3 tabs., 2 figs

  18. DNA mismatch repair protein deficient non-neoplastic colonic crypts: a novel indicator of Lynch syndrome.

    Science.gov (United States)

    Pai, Rish K; Dudley, Beth; Karloski, Eve; Brand, Randall E; O'Callaghan, Neil; Rosty, Christophe; Buchanan, Daniel D; Jenkins, Mark A; Thibodeau, Stephen N; French, Amy J; Lindor, Noralane M; Pai, Reetesh K

    2018-06-08

    Lynch syndrome is the most common form of hereditary colorectal carcinoma. However, establishing the diagnosis of Lynch syndrome is challenging, and ancillary studies that distinguish between sporadic DNA mismatch repair (MMR) protein deficiency and Lynch syndrome are needed, particularly when germline mutation studies are inconclusive. The aim of this study was to determine if MMR protein-deficient non-neoplastic intestinal crypts can help distinguish between patients with and without Lynch syndrome. We evaluated the expression of MMR proteins in non-neoplastic intestinal mucosa obtained from colorectal surgical resection specimens from patients with Lynch syndrome-associated colorectal carcinoma (n = 52) and patients with colorectal carcinoma without evidence of Lynch syndrome (n = 70), including sporadic MMR protein-deficient colorectal carcinoma (n = 30), MMR protein proficient colorectal carcinoma (n = 30), and "Lynch-like" syndrome (n = 10). MMR protein-deficient non-neoplastic colonic crypts were identified in 19 of 122 (16%) patients. MMR protein-deficient colonic crypts were identified in 18 of 52 (35%) patients with Lynch syndrome compared to only 1 of 70 (1%) patients without Lynch syndrome (p Lynch-like" syndrome and harbored two MSH2-deficient non-neoplastic colonic crypts. MMR protein-deficient non-neoplastic colonic crypts were not identified in patients with sporadic MMR protein-deficient or MMR protein proficient colorectal carcinoma. Our findings suggest that MMR protein-deficient colonic crypts are a novel indicator of Lynch syndrome, and evaluation for MMR protein-deficient crypts may be a helpful addition to Lynch syndrome diagnostics.

  19. 2BC Non-Structural Protein of Enterovirus A71 Interacts with SNARE Proteins to Trigger Autolysosome Formation.

    Science.gov (United States)

    Lai, Jeffrey K F; Sam, I-Ching; Verlhac, Pauline; Baguet, Joël; Eskelinen, Eeva-Liisa; Faure, Mathias; Chan, Yoke Fun

    2017-07-04

    Viruses have evolved unique strategies to evade or subvert autophagy machinery. Enterovirus A71 (EV-A71) induces autophagy during infection in vitro and in vivo. In this study, we report that EV-A71 triggers autolysosome formation during infection in human rhabdomyosarcoma (RD) cells to facilitate its replication. Blocking autophagosome-lysosome fusion with chloroquine inhibited virus RNA replication, resulting in lower viral titres, viral RNA copies and viral proteins. Overexpression of the non-structural protein 2BC of EV-A71 induced autolysosome formation. Yeast 2-hybrid and co-affinity purification assays showed that 2BC physically and specifically interacted with a N -ethylmaleimide-sensitive factor attachment receptor (SNARE) protein, syntaxin-17 (STX17). Co-immunoprecipitation assay further showed that 2BC binds to SNARE proteins, STX17 and synaptosome associated protein 29 (SNAP29). Transient knockdown of STX17, SNAP29, and microtubule-associated protein 1 light chain 3B (LC3B), crucial proteins in the fusion between autophagosomes and lysosomes) as well as the lysosomal-associated membrane protein 1 (LAMP1) impaired production of infectious EV-A71 in RD cells. Collectively, these results demonstrate that the generation of autolysosomes triggered by the 2BC non-structural protein is important for EV-A71 replication, revealing a potential molecular pathway targeted by the virus to exploit autophagy. This study opens the possibility for the development of novel antivirals that specifically target 2BC to inhibit formation of autolysosomes during EV-A71 infection.

  20. Optimization of proximity ligation assay (PLA) for detection of protein interactions and fusion proteins in non-adherent cells: application to pre-B lymphocytes.

    Science.gov (United States)

    Debaize, Lydie; Jakobczyk, Hélène; Rio, Anne-Gaëlle; Gandemer, Virginie; Troadec, Marie-Bérengère

    2017-01-01

    Genetic abnormalities, including chromosomal translocations, are described for many hematological malignancies. From the clinical perspective, detection of chromosomal abnormalities is relevant not only for diagnostic and treatment purposes but also for prognostic risk assessment. From the translational research perspective, the identification of fusion proteins and protein interactions has allowed crucial breakthroughs in understanding the pathogenesis of malignancies and consequently major achievements in targeted therapy. We describe the optimization of the Proximity Ligation Assay (PLA) to ascertain the presence of fusion proteins, and protein interactions in non-adherent pre-B cells. PLA is an innovative method of protein-protein colocalization detection by molecular biology that combines the advantages of microscopy with the advantages of molecular biology precision, enabling detection of protein proximity theoretically ranging from 0 to 40 nm. We propose an optimized PLA procedure. We overcome the issue of maintaining non-adherent hematological cells by traditional cytocentrifugation and optimized buffers, by changing incubation times, and modifying washing steps. Further, we provide convincing negative and positive controls, and demonstrate that optimized PLA procedure is sensitive to total protein level. The optimized PLA procedure allows the detection of fusion proteins and protein interactions on non-adherent cells. The optimized PLA procedure described here can be readily applied to various non-adherent hematological cells, from cell lines to patients' cells. The optimized PLA protocol enables detection of fusion proteins and their subcellular expression, and protein interactions in non-adherent cells. Therefore, the optimized PLA protocol provides a new tool that can be adopted in a wide range of applications in the biological field.

  1. Enhanced cytocompatibility of silver-containing biointerface by constructing nitrogen functionalities

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Wei, E-mail: weizhang@mail.ipc.ac.cn [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Liu, Jun [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Wang, Huaiyu [Department of Physics & Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Xu, Ying; Wang, Pingli [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Ji, Junhui, E-mail: jhji@mail.ipc.ac.cn [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Chu, Paul K. [Department of Physics & Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)

    2015-09-15

    Graphical abstract: Constructing nitrogen functionalities is promising method to enhance cytocompatibility of the biointerface by simultaneous Ag and N{sub 2} plasma modification. - Highlights: • N{sub 2} plasma immersion ion implantation (PIII) treatment generates plenty of nitrogen functionalities on polymer substrate. • N{sub 2} PIII treatment increases surface roughness and hydrophilicity and improves its capability to adsorb protein. • Simultaneous Ag and N{sub 2} plasma modification constructs nitrogen functionalities to enhance cytocompatibility of the biointerface. - Abstract: Silver (Ag) has recently been introduced into polymeric biomedical implants by plasma immersion ion implantation (PIII) to enhance the antibacterial capability. However, Ag ions and nanoparticles can increase the cytotoxicity and inhibit cellular proliferation and the relationship is time- and dose-dependent. In this study, Ag and N{sub 2} PIII is conducted in concert to produce nitrogen functional groups as well as Ag-containing biointerface. In addition to the creation of nitrogen functionalities, the surface roughness and hydrophilicity are improved in favor of protein adsorption. Compared to the biointerface created by Ag PIII only, the nitrogen functionalities generated by N{sub 2} co-PIII do not affect DNA synthesis and the total protein level but evidently enhance cellular adhesion, viability, and proliferation at the biointerface. The modified surface is observed to upregulate the osteogenesis-related marker expression of bone cells in contact. Our findings suggest that dual Ag and N{sub 2} PIII is a desirable technique to enhance both the cytocompatibility and antibacterial capability of medical polymers.

  2. Autophagy Supports Biomass Production and Nitrogen Use Efficiency at the Vegetative Stage in Rice1[OPEN

    Science.gov (United States)

    Hayashida, Yasukazu; Kurusu, Takamitsu; Kojima, Soichi; Makino, Amane

    2015-01-01

    Much of the nitrogen in leaves is distributed to chloroplasts, mainly in photosynthetic proteins. During leaf senescence, chloroplastic proteins, including Rubisco, are rapidly degraded, and the released nitrogen is remobilized and reused in newly developing tissues. Autophagy facilitates the degradation of intracellular components for nutrient recycling in all eukaryotes, and recent studies have revealed critical roles for autophagy in Rubisco degradation and nitrogen remobilization into seeds in Arabidopsis (Arabidopsis thaliana). Here, we examined the function of autophagy in vegetative growth and nitrogen usage in a cereal plant, rice (Oryza sativa). An autophagy-disrupted rice mutant, Osatg7-1, showed reduced biomass production and nitrogen use efficiency compared with the wild type. While Osatg7-1 showed early visible leaf senescence, the nitrogen concentration remained high in the senescent leaves. 15N pulse chase analysis revealed suppression of nitrogen remobilization during leaf senescence in Osatg7-1. Accordingly, the reduction of nitrogen available for newly developing tissues in Osatg7-1 likely led its reduced leaf area and tillers. The limited leaf growth in Osatg7-1 decreased the photosynthetic capacity of the plant. Much of the nitrogen remaining in senescent leaves of Osatg7-1 was in soluble proteins, and the Rubisco concentration in senescing leaves of Osatg7-1 was about 2.5 times higher than in the wild type. Transmission electron micrographs showed a cytosolic fraction rich with organelles in senescent leaves of Osatg7-1. Our results suggest that autophagy contributes to efficient nitrogen remobilization at the whole-plant level by facilitating protein degradation for nitrogen recycling in senescent leaves. PMID:25786829

  3. Contamination Detection and Mitigation Strategies for Unsymmetric Dimethylhydrazine/Nitrogen Tetroxide Non-Combustion Product Residues

    Science.gov (United States)

    Greene, Benjamin; Buchanan, Vanessa D.; Baker, David L.

    2006-01-01

    Dimethylamine and nitrite, which are non-combustion reaction products of unsymmetrical dimethylhydrazine (UDMH) and nitrogen tetroxide (NTO) propellants, can contaminate spacesuits during extra-vehicular activity (EVA) operations. They can react with water in the International Space Station (ISS) airlock to form N-nitrosodimethylamine (NDMA), a carcinogen. Detection methods for assessing nitrite and dimethylamine contamination were investigated. The methods are based on color-forming reactions in which intensity of color is proportional to concentration. A concept color detection kit using a commercially available presumptive field test for methamphetamine coupled with nitrite test strips was developed and used to detect dimethylamine and nitrite. Contamination mitigation strategies were also developed.

  4. Non-degradative Ubiquitination of Protein Kinases.

    Directory of Open Access Journals (Sweden)

    K Aurelia Ball

    2016-06-01

    Full Text Available Growing evidence supports other regulatory roles for protein ubiquitination in addition to serving as a tag for proteasomal degradation. In contrast to other common post-translational modifications, such as phosphorylation, little is known about how non-degradative ubiquitination modulates protein structure, dynamics, and function. Due to the wealth of knowledge concerning protein kinase structure and regulation, we examined kinase ubiquitination using ubiquitin remnant immunoaffinity enrichment and quantitative mass spectrometry to identify ubiquitinated kinases and the sites of ubiquitination in Jurkat and HEK293 cells. We find that, unlike phosphorylation, ubiquitination most commonly occurs in structured domains, and on the kinase domain, ubiquitination is concentrated in regions known to be important for regulating activity. We hypothesized that ubiquitination, like other post-translational modifications, may alter the conformational equilibrium of the modified protein. We chose one human kinase, ZAP-70, to simulate using molecular dynamics with and without a monoubiquitin modification. In Jurkat cells, ZAP-70 is ubiquitinated at several sites that are not sensitive to proteasome inhibition and thus may have other regulatory roles. Our simulations show that ubiquitination influences the conformational ensemble of ZAP-70 in a site-dependent manner. When monoubiquitinated at K377, near the C-helix, the active conformation of the ZAP-70 C-helix is disrupted. In contrast, when monoubiquitinated at K476, near the kinase hinge region, an active-like ZAP-70 C-helix conformation is stabilized. These results lead to testable hypotheses that ubiquitination directly modulates kinase activity, and that ubiquitination is likely to alter structure, dynamics, and function in other protein classes as well.

  5. NASCENT: an automatic protein interaction network generation tool for non-model organisms.

    Science.gov (United States)

    Banky, Daniel; Ordog, Rafael; Grolmusz, Vince

    2009-04-24

    Large quantity of reliable protein interaction data are available for model organisms in public depositories (e.g., MINT, DIP, HPRD, INTERACT). Most data correspond to experiments with the proteins of Saccharomyces cerevisiae, Drosophila melanogaster, Homo sapiens, Caenorhabditis elegans, Escherichia coli and Mus musculus. For other important organisms the data availability is poor or non-existent. Here we present NASCENT, a completely automatic web-based tool and also a downloadable Java program, capable of modeling and generating protein interaction networks even for non-model organisms. The tool performs protein interaction network modeling through gene-name mapping, and outputs the resulting network in graphical form and also in computer-readable graph-forms, directly applicable by popular network modeling software. http://nascent.pitgroup.org.

  6. Kinetics of irreversible thermal decomposition of dissociating nitrogen dioxide with nitrogen oxide or oxygen additions

    International Nuclear Information System (INIS)

    Gvozdev, A.A.

    1987-01-01

    The effect of NO or O 2 admixtures on kinetics of the irreversible thermal decomposition of nitrogen dioxide at temperatures 460-520 deg C and pressures 4-7 MPa has been studied. It follows from experimental data that the rate of N 2 O 4 formation reduces with the increase of partial pressure of oxygen or decrease of partial pressure of nitrogen oxide. The same regularity is seen for the rate of nitrogen formation. The rate constants of N 2 O formation in dissociating nitrogen tetroxide with oxygen or nitrogen oxide additions agree satisfactorily with previously published results, obtained in stoichiometric mixtures. The appreciable discrepancy at 520 deg C is bind with considerable degree of nitrogen oxide transformation which constitutes approximately 14%. It is determined that the kinetics of formation of the products of irreversible N 2 O and N 2 decomposition in stoichiometric and non-stoichiometric 2NO 2 ↔ 2NO+O 2 mixtures is described by identical 3NO → N 2 O+NO 2 and N 2 O+NO → N 2 +NO 2 reactions

  7. Effects of Synchronization of Carbohydrate and Protein Supply in Total Mixed Ration with Korean Rice Wine Residue on Ruminal Fermentation, Nitrogen Metabolism and Microbial Protein Synthesis in Holstein Steers

    Directory of Open Access Journals (Sweden)

    Min Yu Piao

    2012-11-01

    Full Text Available Three Holstein steers in the growing phase, each with a ruminal cannula, were used to test the hypothesis that the synchronization of the hourly rate of carbohydrate and nitrogen (N released in the rumen would increase the amount of retained nitrogen for growth and thus improve the efficiency of microbial protein synthesis (EMPS. In Experiment 1, in situ degradability coefficients of carbohydrate and N in feeds including Korean rice wine residue (RWR were determined. In Experiment 2, three total mixed ration (TMR diets having different rates of carbohydrate and N release in the rumen were formulated using the in situ degradability of the feeds. All diets were made to contain similar contents of crude protein (CP and neutral detergent fiber (NDF but varied in their hourly pattern of nutrient release. The synchrony index of the three TMRs was 0.51 (LS, 0.77 (MS and 0.95 (HS, respectively. The diets were fed at a restricted level (2% of the animal’s body weight in a 3×3 Latin-square design. Synchronizing the hourly supply of energy and N in the rumen did not significantly alter the digestibility of dry matter, organic matter, crude protein, NDF or acid detergent fiber (ADF (p>0.05. The ruminal NH3-N content of the LS group at three hours after feeding was significantly higher (p0.05. In addition, the purine derivative (PD excretion in urine and microbial-N production (MN among the three groups were not significantly different (p>0.05. In conclusion, synchronizing dietary energy and N supply to the rumen did not have a major effect on nutrient digestion or microbial protein synthesis (MPS in Holstein steers.

  8. Supplementing with non-glycoside hydrolase proteins enhances enzymatic deconstruction of plant biomass.

    Science.gov (United States)

    Su, Xiaoyun; Zhang, Jing; Mackie, Roderick I; Cann, Isaac K O

    2012-01-01

    The glycoside hydrolases (GH) of Caldicellulosiruptor bescii are thermophilic enzymes, and therefore they can hydrolyze plant cell wall polysaccharides at high temperatures. Analyses of two C. bescii glycoside hydrolases, CbCelA-TM1 and CbXyn10A with cellulase and endoxylanase activity, respectively, demonstrated that each enzyme is highly thermostable under static incubation at 70°C. Both enzymes, however, rapidly lost their enzymatic activities when incubated at 70°C with end-over-end shaking. Since crowding conditions, even at low protein concentrations, seem to influence enzymatic properties, three non-glycoside hydrolase proteins were tested for their capacity to stabilize the thermophilic proteins at high temperatures. The three proteins investigated were a small heat shock protein CbHsp18 from C. bescii, a histone MkHistone1 from Methanopyrus kandleri, and bovine RNase A, from a commercial source. Fascinatingly, each of these proteins increased the thermostability of the glycoside hydrolases at 70°C during end-over-end shaking incubation, and this property translated into increases in hydrolysis of several substrates including the bioenergy feedstock Miscanthus. Furthermore, MkHistone1 and RNase A also altered the initial products released from the cello-oligosaccharide cellopentaose during hydrolysis with the cellodextrinase CbCdx1A, which further demonstrated the capacity of the three non-GH proteins to influence hydrolysis of substrates by the thermophilic glycoside hydrolases. The non-GH proteins used in the present report were small proteins derived from each of the three lineages of life, and therefore expand the space from which different polypeptides can be tested for their influence on plant cell wall hydrolysis, a critical step in the emerging biofuel industry.

  9. Supplementing with non-glycoside hydrolase proteins enhances enzymatic deconstruction of plant biomass.

    Directory of Open Access Journals (Sweden)

    Xiaoyun Su

    Full Text Available The glycoside hydrolases (GH of Caldicellulosiruptor bescii are thermophilic enzymes, and therefore they can hydrolyze plant cell wall polysaccharides at high temperatures. Analyses of two C. bescii glycoside hydrolases, CbCelA-TM1 and CbXyn10A with cellulase and endoxylanase activity, respectively, demonstrated that each enzyme is highly thermostable under static incubation at 70°C. Both enzymes, however, rapidly lost their enzymatic activities when incubated at 70°C with end-over-end shaking. Since crowding conditions, even at low protein concentrations, seem to influence enzymatic properties, three non-glycoside hydrolase proteins were tested for their capacity to stabilize the thermophilic proteins at high temperatures. The three proteins investigated were a small heat shock protein CbHsp18 from C. bescii, a histone MkHistone1 from Methanopyrus kandleri, and bovine RNase A, from a commercial source. Fascinatingly, each of these proteins increased the thermostability of the glycoside hydrolases at 70°C during end-over-end shaking incubation, and this property translated into increases in hydrolysis of several substrates including the bioenergy feedstock Miscanthus. Furthermore, MkHistone1 and RNase A also altered the initial products released from the cello-oligosaccharide cellopentaose during hydrolysis with the cellodextrinase CbCdx1A, which further demonstrated the capacity of the three non-GH proteins to influence hydrolysis of substrates by the thermophilic glycoside hydrolases. The non-GH proteins used in the present report were small proteins derived from each of the three lineages of life, and therefore expand the space from which different polypeptides can be tested for their influence on plant cell wall hydrolysis, a critical step in the emerging biofuel industry.

  10. Technical note: Nitrogen isotopic fractionation can be used to predict nitrogen-use efficiency in dairy cows fed temperate pasture.

    Science.gov (United States)

    Cheng, L; Sheahan, A J; Gibbs, S J; Rius, A G; Kay, J K; Meier, S; Edwards, G R; Dewhurst, R J; Roche, J R

    2013-12-01

    The objective of this study was to investigate the relationship between nitrogen isotopic fractionation (δ(15)N) and nitrogen-use efficiency (milk nitrogen/nitrogen intake; NUE) in pasture-fed dairy cows supplemented with increasing levels of urea to mimic high rumen degradable protein pastures in spring. Fifteen cows were randomly assigned to freshly cut pasture and either supplemented with 0, 250, or 336 g urea/d. Feed, milk, and plasma were analyzed for δ(15)N, milk and plasma for urea nitrogen concentration, and plasma for ammonia concentration. Treatment effects were tested using ANOVA and relationships between variables were established by linear regression. Lower dry matter intake (P = 0.002) and milk yield (P = 0.002) occurred with the highest urea supplementation (336 g urea/d) compared with the other two treatments. There was a strong linear relationship between milk δ(15)N - feed δ(15)N and NUE: [NUE (%) = 58.9 - 10.17 × milk δ(15)N - feed δ(15)N (‰) (r(2) = 0.83, P < 0.001, SE = 1.67)] and between plasma δ(15)N - feed δ(15)N and NUE: [NUE (%) = 52.4 - 8.61 × plasma δ(15)N - feed δ(15)N (‰) (r(2) = 0.85, P < 0.001, SE = 1.56)] . This study confirmed the potential use of δ(15)N to predict NUE in cows consuming different levels of rumen degradable protein.

  11. Nitrate signals determine the sensing of nitrogen through differential expression of genes involved in nitrogen uptake and assimilation in finger millet.

    Science.gov (United States)

    Gupta, Alok Kumar; Gaur, Vikram Singh; Gupta, Sanjay; Kumar, Anil

    2013-06-01

    In order to understand the molecular basis of high nitrogen use efficiency of finger millet, five genes (EcHNRT2, EcLNRT1, EcNADH-NR, EcGS, and EcFd-GOGAT) involved in nitrate uptake and assimilation were isolated using conserved primer approaches. Expression profiles of these five genes along with the previously isolated EcDof1 was studied under increased KNO3 concentrations (0.15 to 1,500 μM) for 2 h as well as at 1.5 μM for 24 h in the roots and shoots of 25 days old nitrogen deprived two contrasting finger millet genotypes (GE-3885 and GE-1437) differing in grain protein content (13.76 and 6.15 %, respectively). Time kinetics experiment revealed that, all the five genes except EcHNRT2 in the leaves of GE-3885 were induced within 30 min of nitrate exposure indicating that there might be a greater nitrogen deficit in leaves and therefore quick transportation of nitrate signals to the leaves. Exposing the plants to increasing nitrate concentrations for 2 h showed that in roots of GE-3885, NR was strongly induced while GS was repressed; however, the pattern was found to be reversed in leaves of GE-1437 indicating that in GE-3885, most of the nitrate might be reduced in the roots but assimilated in leaves and vice-versa. Furthermore, compared with the low-protein genotype, expression of HNRT2 was strongly induced in both roots and shoots of high-protein genotype at the least nitrate concentration supplied. This further indicates that GE-3885 is a quick sensor of nitrogen compared with the low-protein genotype. Furthermore, expression of EcDof1 was also found to overlap the expression of NR, GS, and GOGAT indicating that Dof1 probably regulates the expression of these genes under different conditions by sensing the nitrogen fluctuations around the root zone.

  12. Life without double-headed non-muscle myosin II motor proteins

    Science.gov (United States)

    Betapudi, Venkaiah

    2014-07-01

    Non-muscle myosin II motor proteins (myosin IIA, myosin IIB, and myosin IIC) belong to a class of molecular motor proteins that are known to transduce cellular free-energy into biological work more efficiently than man-made combustion engines. Nature has given a single myosin II motor protein for lower eukaryotes and multiple for mammals but none for plants in order to provide impetus for their life. These specialized nanomachines drive cellular activities necessary for embryogenesis, organogenesis, and immunity. However, these multifunctional myosin II motor proteins are believed to go awry due to unknown reasons and contribute for the onset and progression of many autosomal-dominant disorders, cataract, deafness, infertility, cancer, kidney, neuronal, and inflammatory diseases. Many pathogens like HIV, Dengue, hepatitis C, and Lymphoma viruses as well as Salmonella and Mycobacteria are now known to take hostage of these dedicated myosin II motor proteins for their efficient pathogenesis. Even after four decades since their discovery, we still have a limited knowledge of how these motor proteins drive cell migration and cytokinesis. We need to enrich our current knowledge on these fundamental cellular processes and develop novel therapeutic strategies to fix mutated myosin II motor proteins in pathological conditions. This is the time to think how to relieve the hijacked myosins from pathogens in order to provide a renewed impetus for patients’ life. Understanding how to steer these molecular motors in proliferating and differentiating stem cells will improve stem cell based-therapeutics development. Given the plethora of cellular activities non-muscle myosin motor proteins are involved in, their importance is apparent for human life.

  13. Life without double-headed non-muscle myosin II motor proteins

    Directory of Open Access Journals (Sweden)

    Venkaiah eBetapudi

    2014-07-01

    Full Text Available Non-muscle myosin II motor proteins (myosin IIA, myosin IIB, and myosin IIC belong to a class of molecular motor proteins that are known to transduce cellular free-energy into biological work more efficiently than man-made combustion engines. Nature has given a single myosin II motor protein for lower eukaryotes and multiple for mammals but none for plants in order to provide impetus for their life. These specialized nanomachines drive cellular activities necessary for embryogenesis, organogenesis, and immunity. However, these multifunctional myosin II motor proteins are believed to go awry due to unknown reasons and contribute for the onset and progression of many autosomal-dominant disorders, cataract, deafness, infertility, cancer, kidney, neuronal, and inflammatory diseases. Many pathogens like HIV, Dengue, hepatitis C, and Lymphoma viruses as well as Salmonella and Mycobacteria are now known to take hostage of these dedicated myosin II motor proteins for their efficient pathogenesis. Even after four decades since their discovery, we still have a limited knowledge of how these motor proteins drive cell migration and cytokinesis. We need to enrich our current knowledge on these fundamental cellular processes and develop novel therapeutic strategies to fix mutated myosin II motor proteins in pathological conditions. This is the time to think how to relieve the hijacked myosins from pathogens in order to provide a renewed impetus for patients’ life. Understanding how to steer these molecular motors in proliferating and differentiating stem cells will improve stem cell based-therapeutics development. Given the plethora of cellular activities non-muscle myosin motor proteins are involved in, their importance is apparent for human life.

  14. Non-linear feedback control of the p53 protein-mdm2 inhibitor system using the derivative-free non-linear Kalman filter.

    Science.gov (United States)

    Rigatos, Gerasimos G

    2016-06-01

    It is proven that the model of the p53-mdm2 protein synthesis loop is a differentially flat one and using a diffeomorphism (change of state variables) that is proposed by differential flatness theory it is shown that the protein synthesis model can be transformed into the canonical (Brunovsky) form. This enables the design of a feedback control law that maintains the concentration of the p53 protein at the desirable levels. To estimate the non-measurable elements of the state vector describing the p53-mdm2 system dynamics, the derivative-free non-linear Kalman filter is used. Moreover, to compensate for modelling uncertainties and external disturbances that affect the p53-mdm2 system, the derivative-free non-linear Kalman filter is re-designed as a disturbance observer. The derivative-free non-linear Kalman filter consists of the Kalman filter recursion applied on the linearised equivalent of the protein synthesis model together with an inverse transformation based on differential flatness theory that enables to retrieve estimates for the state variables of the initial non-linear model. The proposed non-linear feedback control and perturbations compensation method for the p53-mdm2 system can result in more efficient chemotherapy schemes where the infusion of medication will be better administered.

  15. Nitrogen starvation of cyanobacteria results in the production of β-N-methylamino-L-alanine.

    Science.gov (United States)

    Downing, S; Banack, S A; Metcalf, J S; Cox, P A; Downing, T G

    2011-08-01

    β-N-Methylamino-L-alanine, an unusual amino acid implicated in neurodegenerative disease, has been detected in cultures of nearly all genera of environmentally ubiquitous cyanobacteria tested. The compound is present within cyanobacterial cells in free and protein-associated forms, with large variations occurring in the concentration of these pools between species as well as within single strains. With a lack of knowledge and supporting data on the regulation of BMAA production and the role of this compound in cyanobacteria, the association between BMAA and cyanobacteria is still subject to debate. In this study we investigated the biosynthesis of BMAA in axenic non-diazotrophic cyanobacterial cultures using the stable isotope ¹⁵N. Nitrogen starvation of nutritionally replete cells resulted in an increase in free cellular ¹⁵N BMAA suggesting that BMAA may be the result of catabolism to provide nitrogen or that BMAA is synthesised to serve a functional role in the cell in response to nitrogen deprivation. The addition of NO₃⁻ and NH₄⁺ to the culture medium following starvation resulted in a decrease of free cellular BMAA without a corresponding increase in the protein-associated fraction. The use of ammonia as a nitrogen source resulted in a more rapid reduction of BMAA when compared to nitrate. This study provides the first data regarding the regulation of intracellular BMAA concentrations in cyanobacteria with results conclusively showing the production of ¹⁵N BMAA by an axenic cyanobacterial culture. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Bioavailability of nitrogen from sewage sludge using 15N-labelled ammonium sulphate

    International Nuclear Information System (INIS)

    El-Motaium, R.A.

    2001-01-01

    The high nutrient nitrogen and organic matter contents of sewage sludge (SS) make it a potential organic fertilizer for sandy soil. In this study, 15 N-labelled ammonium sulphate was used to investigate the availability of nitrogen from irradiated and non-irradiated sewage sludge to tomato plants. The application of sewage sludge to sandy soil increased dry matter production (DMP), nitrogen yield (NY) and nitrogen recovery (NR) over two successive years. A positive relationship was found between sludge application rate and DMP and NY. The increase was significantly higher (P=0.05) in irradiated than non-irradiated sewage sludge. Total nitrogen derived from non-irradiated sewage sludge are : 48.0, 63.7, 73.5, 105.2 Kg/ha, whereas, the total nitrogen derived from irradiated sewage sludge are: 55.1, 72.5, 88.9, 141.4 Kg/ha corresponding to application rates of 10 t/ha, 20 t/ha, 30 t/ha, respectively. This was attributed to higher dry matter production in the later than the former. A highly significant correlation (0.945**) was found between dry matter production and sludge nitrogen yield (i.e. nitrogen derived from sewage sludge). Fertilizer nitrogen yield (total nitrogen derived from fertilizer) was high in treatment receiving mineral fertilizer, however, the 15 N recovery by tomato was only 13.8%. Soil did not contribute well towards total nitrogen yield in tomato and most nitrogen was derived from sewage sludge. Percent nitrogen derived from sewage sludge was in the range 88-92%, depending on the application rate

  17. Rumen undegradable protein (RUP) and its intestinal digestibility after steam flaking of cereal grains

    DEFF Research Database (Denmark)

    Chrenková, M; Formelová, Z; Ceresnáková, Z

    2018-01-01

    While it is known that heat treatment of cereal grains generally improves the nutritional value for ruminants, simultaneous information on rumen degradability and intestinal digestibility of the rumen by-pass is scarce, especially for non-starch constituents. The effect of steam flaking at 90°C...... flaking on chemical composition of cereal grains (crude protein, acid detergent fibre, neutral detergent fibre, and starch) were observed. The protein fractions that are relevant to rumen degradability were significantly influenced by the steam flaking: the non-protein nitrogen fraction (A) was reduced (P...... hand, steam flaking markedly increased buffer insoluble but neutral detergent soluble protein fraction (B2) by 15–25% for all three cereal grains, whereas effects on B3 fraction were not significant. Steam flaking was also associated with an increase of the rumen undegradable protein fraction (C...

  18. Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.

    Science.gov (United States)

    Truan, Daphné; Bjelić, Saša; Li, Xiao-Dan; Winkler, Fritz K

    2014-07-29

    The trimeric PII signal transduction proteins regulate the function of a variety of target proteins predominantly involved in nitrogen metabolism. ATP, ADP and 2-oxoglutarate (2-OG) are key effector molecules influencing PII binding to targets. Studies of PII proteins have established that the 20-residue T-loop plays a central role in effector sensing and target binding. However, the specific effects of effector binding on T-loop conformation have remained poorly documented. We present eight crystal structures of the Azospirillum brasilense PII protein GlnZ, six of which are cocrystallized and liganded with ADP or ATP. We find that interaction with the diphosphate moiety of bound ADP constrains the N-terminal part of the T-loop in a characteristic way that is maintained in ADP-promoted complexes with target proteins. In contrast, the interactions with the triphosphate moiety in ATP complexes are much more variable and no single predominant interaction mode is apparent except for the ternary MgATP/2-OG complex. These conclusions can be extended to most investigated PII proteins of the GlnB/GlnK subfamily. Unlike reported for other PII proteins, microcalorimetry reveals no cooperativity between the three binding sites of GlnZ trimers for any of the three effectors under carefully controlled experimental conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Assessment of the distribution of protein in the human body by in-vivo neutron activation analysis

    International Nuclear Information System (INIS)

    Burkinshaw, L.; Hill, G.L.; Morgan, D.B.

    1979-01-01

    Whole-body in-vivo neutron activation analysis has been developed into a clinically acceptable technique for measuring total-body nitrogen. Since most of the nitrogen is in protein, the result gives an estimates of total-body protein, and this has proved very informative in studies of nutritional problems. It would often be useful to know how the total protein is divided between muscle and other lean tissues, and this could be determined if the body content of some other substance, distributed differently between the two types of tissue, were known. Potassium is a suitable substance. The total amount in the body is always measured in the course of the activation analysis procedure, and its concentration relative to nitrogen is more than twice as high in muscle as it is in the other lean tissues. Therefore a high proportion of muscle in the body will be reflected in a high ratio of total-body potassium to total-body nitrogen. Starting with this observation, a mathematical model has been developed which makes it possible to estimate the masses and protein contents of muscle and non-muscle lean tissues from total-body nitrogen and potassium. The errors of estimation are too large to allow conclusions to be drawn from a single measurement of an individual, but they do permit mean values for groups of subjects to be compared. This way of interpreting the results of in-vivo neutron activation analysis is expected to increase the value of the technique for studying nutritional problems. (author)

  20. Membrane re-modelling by BAR domain superfamily proteins via molecular and non-molecular factors.

    Science.gov (United States)

    Nishimura, Tamako; Morone, Nobuhiro; Suetsugu, Shiro

    2018-04-17

    Lipid membranes are structural components of cell surfaces and intracellular organelles. Alterations in lipid membrane shape are accompanied by numerous cellular functions, including endocytosis, intracellular transport, and cell migration. Proteins containing Bin-Amphiphysin-Rvs (BAR) domains (BAR proteins) are unique, because their structures correspond to the membrane curvature, that is, the shape of the lipid membrane. BAR proteins present at high concentration determine the shape of the membrane, because BAR domain oligomers function as scaffolds that mould the membrane. BAR proteins co-operate with various molecular and non-molecular factors. The molecular factors include cytoskeletal proteins such as the regulators of actin filaments and the membrane scission protein dynamin. Lipid composition, including saturated or unsaturated fatty acid tails of phospholipids, also affects the ability of BAR proteins to mould the membrane. Non-molecular factors include the external physical forces applied to the membrane, such as tension and friction. In this mini-review, we will discuss how the BAR proteins orchestrate membrane dynamics together with various molecular and non-molecular factors. © 2018 The Author(s). Published by Portland Press Limited on behalf of the Biochemical Society.

  1. Nitrogen levels and yeast viability during ethanol fermentation of grain sorghum containing condensed tannins

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, J T; NeSmith, C

    1988-01-01

    Selected varieties of sorghum, Sorghum bicolor (L.) Moench, give high crop yields and they also return to favorable energy balance in terms of energy calories produced per cultural energy invested. The brown, condensed-tannin, bird- and mold-resistant varieties illustrate these advantages, but their nutritional value and ability to support the expected rate of ethanol fermentation is significantly lower than that of non-brown sorghums. It has been previously shown that the addition of nitrogen to brown sorghum mash supports a high rate of fermentative metabolism without removing the tannins, and suggested that the basis for the inhibition of ethanol fermentation was nitrogen starvation of the yeast cells. In this investigation, it is demonstrated that the addition of protease enzyme to mash results in an increase in amino nitrogen sufficient to support accelerated rates of ethanol fermentation by yeast cells. Thus, the hypothesis commonly cited in the literature that the presumed inhibitor, condensed tannins, function to reduce fermentative metabolism solely via the binding and precipitation of proteins is rejected.

  2. Mesquite pod meal in sheep diet: intake, apparent digestibility of nutrients and nitrogen balance

    Directory of Open Access Journals (Sweden)

    Edileusa de Jesus do Santos

    2015-02-01

    Full Text Available Eight Santa Ines sheep were assigned to two 4 x 4 Latin squares, to evaluate the effects of replacing elephant grass silage with different levels of mesquite pod meal (MDM (15, 30 and 45% DM on intake, apparent digestibility of dry matter (DM, organic matter (OM, crude protein (CP, ether extract (EE, acid detergent fiber (ADF, neutral detergent fiber (NDF, total carbohydrates (TC and non-fiber carbohydrates (NFC and the nitrogen balance. There was a linear increase (p < 0.05 in the intake of DM, OM, CP, ADF, NDF, NFC and TC according to the addition of MPM to the diet. The digestibility of DM, OM and CP increased (p < 0.05 with the addition of MDM. We observed a positive linear effect (p < 0.05 for the nitrogen intake. The addition of mesquite pod meal up to 45% increased the intake of DM, NDF, ADF, CP, OM, NFC and TC but reduced the digestibility of EE and NDF. MPM at 30 and 45% propitiated a positive nitrogen balance.

  3. cDNA Library Screening Identifies Protein Interactors Potentially Involved in Non-telomeric Roles of Arabidopsis Telomerase

    Directory of Open Access Journals (Sweden)

    Ladislav eDokládal

    2015-11-01

    Full Text Available Telomerase-reverse transcriptase (TERT plays an essential catalytic role in maintaining telomeres. However, in animal systems telomerase plays additional non-telomeric functional roles. We previously screened an Arabidopsis cDNA library for proteins that interact with the C-terminal extension (CTE TERT domain and identified a nuclear-localized protein that contains a RNA recognition motif (RRM. This RRM-protein forms homodimers in both plants and yeast. Mutation of the gene encoding the RRM-protein had no detectable effect on plant growth and development, nor did it affect telomerase activity or telomere length in vivo, suggesting a non-telomeric role for TERT/RRM-protein complexes. The gene encoding the RRM-protein is highly expressed in leaf and reproductive tissues. We further screened an Arabidopsis cDNA library for proteins that interact with the RRM-protein and identified five interactors. These proteins are involved in numerous non-telomere-associated cellular activities. In plants, the RRM-protein, both alone and in a complex with its interactors, localizes to nuclear speckles. Transcriptional analyses in wild-type and rrm mutant plants, as well as transcriptional co-analyses, suggest that TERT, the RRM-protein, and the RRM-protein interactors may play important roles in non-telomeric cellular functions.

  4. A novel protein mixture containing vegetable proteins renders enteral nutrition products non-coagulating after in vitro gastric digestion

    NARCIS (Netherlands)

    Braak, van den C.C.M.; Klebach, M.; Abrahamse, E.; Minor, M.; Knol, J.; Hofman, Z.; Ludwig, T.

    2013-01-01

    Background & aims: Non-coagulation of protein from enteral nutrition (EN) in the stomach is considered to improve gastric emptying and may result in reduced upper gastrointestinal complications such as reflux and aspiration pneumonia. For the development of a new EN protein mixture with reduced

  5. Genetic variability in uptake of nitrogen at various growth stages of barley and wheat under dryland conditions

    International Nuclear Information System (INIS)

    Della, A.; Hadjichristodoulou, A.

    1976-01-01

    Protein and dry matter in a number of high protein and commercial varieties of barley and wheat were tested at various growth stages and at two locations. Large genetic variability was found in uptake of nitrogen, which was taken up generally before heading. High protein yields were not associated with high protein content but with higher dry matter yields. Nitrogen fertilization increased protein content and protein yield at a low protein location only. It was concluded that it is possible to breed for both high grain and high straw protein varieties. (author)

  6. Studies of the nitrogen metabolism in the large intestine of ruminants. 5

    International Nuclear Information System (INIS)

    Bergner, H.; Goetz, K.P.; Simon, O.

    1989-01-01

    Six heifers of a live weight of 215, 227 and 238 kg (experiment 1) and 220, 227 and 233 kg resp. (experiment 2) were supplied with ileocaecal re-entrance cannulae, jugular venal catheters and bladder catheters. The ration consisted of 4 kg maize silage and 4 kg wheat straw pellets per animal and day. Up to 3.5 kg of the straw pellets consisting of 73% wheat straw, 10% barley, 12% molasses, NPN salts and a mineral mixture were consumed per animal and day. In a preliminary period 50% of the digesta flow was collected over 12 h/d on 5 consecutive days and stored in a deep-freeze. During the main trial the re-entrance cannula was disrupted and the flowing digesta was quantitatively collected at the end of the ileum; previously collected digesta was supplemented with 15 N-urea and every hour over 24 h infused into the caecal part of the re-entrance cannula. Between the 24th and 30th hours the digesta was infused without 15 N-urea supplement. In trial 2 the digesta was also supplemented with partly hydrolysed straw meal between the 1st and 30th hours. The 15 N labelling decrease of the plasma urea N shows that the half life is 7.9 h in trial 1 and 7.0 h in trial 2. The NH 3 nitrogen in faeces was distinctly higher labelled in trial 2 after the supplement of straw meal than in trial 1. The total N in faeces was also twice as highly labelled as in trial 1. Atom-% 15 N' in urine was significantly higher in trial 2 than in trial 1 between the 6th and 16th hours after the beginning of 15 N-urea supplementation. In the decrease curve of atom-% 15 N' (after the 26th hour of trial) the values in trial 1 were generally higher than in trial 2. The higher bacterial protein synthesis in the large intestine in trial 2 had the effect that 13.6% of the supplemented 15 N' were excreted in faeces by the 30th hour of trial, in contrast to this only 4.7% in group 1. (author)

  7. Nitrogen and Martian Habitability: Insights from Five Years of Curiosity Measurements

    Science.gov (United States)

    Stern, J. C.; Sutter, B.; Navarro-Gonzalez, R.; McKay, C.; Ming, D. W.; Mahaffy, P. R.; Archer, D., Jr.; Franz, H. B.; Freissinet, C.; Jackson, W. A.; Conrad, P. G.; Glavin, D. P.; Trainer, M. G.; Malespin, C.; McAdam, A.; Eigenbrode, J. L.; Teinturier, S.; Manning, C.

    2017-12-01

    The detection of "fixed" N on Mars in the form of nitrate by the Sample Analysis at Mars (SAM) instrument suite on the Mars Science Laboratory (MSL) Curiosity Rover [1] has major implications for martian habitability. "Follow the nitrogen" has been proposed as a strategy in the search for both extant and extinct life on Mars [e.g., 2]. Nitrogen is so crucial to life on Earth that life developed metabolic pathways to break the triple bond of N2 and "fix" atmospheric nitrogen to more biologically available molecules for use in proteins and informational polymers. Sequestration of nitrate in regolith has long been predicted to contribute to the removal of N from the martian atmosphere [e.g., 3], and our detections confirm that nitrogen fixation was occurring on ancient Mars. Detections of fixed nitrogen, particularly within the context of the habitable environment in Yellowknife Bay characterized by the MSL payload, are an important tool to assess whether life ever could have existed on ancient Mars. We present 5 years of analyses and interpretation of nitrate in solid martian drilled and scooped samples by SAM on MSL. Nitrate abundance reported by SAM in situ measurements ranges from non-detection to 681 ± 304 mg/kg [1,4] in the samples examined to date. The measured abundances are consistent with nitrogen fixation via impact generated thermal shock on ancient Mars and/or dry deposition from photochemistry of thermospheric NO. We review the integration of SAM data with terrestrial Mars analog work in order to better understand the timing of nitrogen fixation and mobility of nitrogen on Mars, and thus its availability to putative biology. In particular, the relationship between nitrate and other soluble salts, such as perchlorate, may help reveal the timing of nitrogen fixation and post-depositional behavior of nitrate on Mars [4]. Finally, we present a comparison of isotopic composition (δ15N) of nitrate with δ15N of atmospheric nitrogen (δ15N ≈ 574‰, [5

  8. Can herbage nitrogen fractionation in Lolium perenne be improved by herbage management?

    NARCIS (Netherlands)

    Hoekstra, N.J.; Struik, P.C.; Lantinga, E.A.; Amburgh, van M.E.; Schulte, R.P.O.

    2008-01-01

    The high degradability of grass protein is an important factor in the low nitrogen (N) utilization of grazing bovines in intensive European grassland systems. We tested the hypothesis that protein degradability as measured by the Cornell Net Carbohydrate and Protein System (CNCPS) protein

  9. MetaGO: Predicting Gene Ontology of Non-homologous Proteins Through Low-Resolution Protein Structure Prediction and Protein-Protein Network Mapping.

    Science.gov (United States)

    Zhang, Chengxin; Zheng, Wei; Freddolino, Peter L; Zhang, Yang

    2018-03-10

    Homology-based transferal remains the major approach to computational protein function annotations, but it becomes increasingly unreliable when the sequence identity between query and template decreases below 30%. We propose a novel pipeline, MetaGO, to deduce Gene Ontology attributes of proteins by combining sequence homology-based annotation with low-resolution structure prediction and comparison, and partner's homology-based protein-protein network mapping. The pipeline was tested on a large-scale set of 1000 non-redundant proteins from the CAFA3 experiment. Under the stringent benchmark conditions where templates with >30% sequence identity to the query are excluded, MetaGO achieves average F-measures of 0.487, 0.408, and 0.598, for Molecular Function, Biological Process, and Cellular Component, respectively, which are significantly higher than those achieved by other state-of-the-art function annotations methods. Detailed data analysis shows that the major advantage of the MetaGO lies in the new functional homolog detections from partner's homology-based network mapping and structure-based local and global structure alignments, the confidence scores of which can be optimally combined through logistic regression. These data demonstrate the power of using a hybrid model incorporating protein structure and interaction networks to deduce new functional insights beyond traditional sequence homology-based referrals, especially for proteins that lack homologous function templates. The MetaGO pipeline is available at http://zhanglab.ccmb.med.umich.edu/MetaGO/. Copyright © 2018. Published by Elsevier Ltd.

  10. Correlation between dietary nitrogen, level of plasma urea and urea excretion in urine of buffalo calves

    International Nuclear Information System (INIS)

    Verma, D.N.; Singh, U.B.

    1978-01-01

    Two experiments were conducted with 6 male buffalo calves of Murrah breed, aged 1.5 years, to determine whether blood urea nitrogen and urea excretion in urine were associated with protein intake. The animals were fed different amounts of crude protein in their diet. The levels of urea-N in the blood, excretion of 14 C from urea and urea-N in the urine were estimated. Close relationships were observed between nitrogen intake, blood urea nitrogen and urea excretion in the urine. The observations indicated that blood urea-N and urea excretion in urine could be quantitated with the protein intake. (author)

  11. Nitrogen detected TROSY at high field yields high resolution and sensitivity for protein NMR

    International Nuclear Information System (INIS)

    Takeuchi, Koh; Arthanari, Haribabu; Shimada, Ichio; Wagner, Gerhard

    2015-01-01

    Detection of 15 N in multidimensional NMR experiments of proteins has sparsely been utilized because of the low gyromagnetic ratio (γ) of nitrogen and the presumed low sensitivity of such experiments. Here we show that selecting the TROSY components of proton-attached 15 N nuclei (TROSY 15 N H ) yields high quality spectra in high field magnets (>600 MHz) by taking advantage of the slow 15 N transverse relaxation and compensating for the inherently low 15 N sensitivity. The 15 N TROSY transverse relaxation rates increase modestly with molecular weight but the TROSY gain in peak heights depends strongly on the magnetic field strength. Theoretical simulations predict that the narrowest line width for the TROSY 15 N H component can be obtained at 900 MHz, but sensitivity reaches its maximum around 1.2 GHz. Based on these considerations, a 15 N-detected 2D 1 H– 15 N TROSY-HSQC ( 15 N-detected TROSY-HSQC) experiment was developed and high-quality 2D spectra were recorded at 800 MHz in 2 h for 1 mM maltose-binding protein at 278 K (τ c  ∼ 40 ns). Unlike for 1 H detected TROSY, deuteration is not mandatory to benefit 15 N detected TROSY due to reduced dipolar broadening, which facilitates studies of proteins that cannot be deuterated, especially in cases where production requires eukaryotic expression systems. The option of recording 15 N TROSY of proteins expressed in H 2 O media also alleviates the problem of incomplete amide proton back exchange, which often hampers the detection of amide groups in the core of large molecular weight proteins that are expressed in D 2 O culture media and cannot be refolded for amide back exchange. These results illustrate the potential of 15 N H -detected TROSY experiments as a means to exploit the high resolution offered by high field magnets near and above 1 GHz

  12. Protein retention assessment of four levels of poultry by-product substitution of fishmeal in rainbow trout (Oncorhynchus mykiss) diets using stable isotopes of nitrogen (δ15N) as natural tracers.

    Science.gov (United States)

    Badillo, Daniel; Herzka, Sharon Z; Viana, Maria Teresa

    2014-01-01

    This is second part from an experiment where the nitrogen retention of poultry by-product meal (PBM) compared to fishmeal (FM) was evaluated using traditional indices. Here a quantitative method using stable isotope ratios of nitrogen (δ(15)N values) as natural tracers of nitrogen incorporation into fish biomass is assessed. Juvenile rainbow trout (Oncorhynchus mykiss) were fed for 80 days on isotopically distinct diets in which 0, 33, 66 and 100% of FM as main protein source was replaced by PBM. The diets were isonitrogenous, isolipidic and similar in gross energy content. Fish in all treatments reached isotopic equilibrium by the end of the experiment. Two-source isotope mixing models that incorporated the isotopic composition of FM and PBM as well as that of formulated feeds, empirically derived trophic discrimination factors and the isotopic composition of fish that had reached isotopic equilibrium to the diets were used to obtain a quantitative estimate of the retention of each source of nitrogen. Fish fed the diets with 33 and 66% replacement of FM by PBM retained poultry by-product meal roughly in proportion to its level of inclusion in the diets, whereas no differences were detected in the protein efficiency ratio. Coupled with the similar biomass gain of fishes fed the different diets, our results support the inclusion of PBM as replacement for fishmeal in aquaculture feeds. A re-feeding experiment in which all fish were fed a diet of 100% FM for 28 days indicated isotopic turnover occurred very fast, providing further support for the potential of isotopic ratios as tracers of the retention of specific protein sources into fish tissues. Stable isotope analysis is a useful tool for studies that seek to obtain quantitative estimates of the retention of different protein sources.

  13. NPR1 protein regulates pathogenic and symbiotic interactions between Rhizobium and legumes and non-legumes.

    Directory of Open Access Journals (Sweden)

    Smadar Peleg-Grossman

    Full Text Available BACKGROUND: Legumes are unique in their ability to establish symbiotic interaction with rhizobacteria from Rhizobium genus, which provide them with available nitrogen. Nodulation factors (NFs produced by Rhizobium initiate legume root hair deformation and curling that entrap the bacteria, and allow it to grow inside the plant. In contrast, legumes and non-legumes activate defense responses when inoculated with pathogenic bacteria. One major defense pathway is mediated by salicylic acid (SA. SA is sensed and transduced to downstream defense components by a redox-regulated protein called NPR1. METHODOLOGY/PRINCIPAL FINDINGS: We used Arabidopsis mutants in SA defense pathway to test the role of NPR1 in symbiotic interactions. Inoculation of Sinorhizobium meliloti or purified NF on Medicago truncatula or nim1/npr1 A. thaliana mutants induced root hair deformation and transcription of early and late nodulins. Application of S. meliloti or NF on M. truncatula or A. thaliana roots also induced a strong oxidative burst that lasted much longer than in plants inoculated with pathogenic or mutualistic bacteria. Transient overexpression of NPR1 in M. truncatula suppressed root hair curling, while inhibition of NPR1 expression by RNAi accelerated curling. CONCLUSIONS/SIGNIFICANCE: We show that, while NPR1 has a positive effect on pathogen resistance, it has a negative effect on symbiotic interactions, by inhibiting root hair deformation and nodulin expression. Our results also show that basic plant responses to Rhizobium inoculation are conserved in legumes and non-legumes.

  14. Large centric diatoms allocate more cellular nitrogen to photosynthesis to counter slower RUBISCO turnover rates

    Directory of Open Access Journals (Sweden)

    Yaping eWu

    2014-12-01

    Full Text Available Diatoms contribute ~40% of primary production in the modern ocean and encompass the largest cell size range of any phytoplankton group. Diatom cell size influences their nutrient uptake, photosynthetic light capture, carbon export efficiency, and growth responses to increasing pCO2. We therefore examined nitrogen resource allocations to the key protein complexes mediating photosynthesis across six marine centric diatoms, spanning 5 orders of magnitude in cell volume, under past, current and predicted future pCO2 levels, in balanced growth under nitrogen repletion. Membrane bound photosynthetic protein concentrations declined with cell volume in parallel with cellular concentrations of total protein, total nitrogen and chlorophyll. Larger diatom species, however, allocated a greater fraction (by 3.5 fold of their total cellular nitrogen to the soluble RUBISCO carbon fixation complex than did smaller species. Carbon assimilation per unit of RUBISCO large subunit (C RbcL-1 s-1 decreased with cell volume, from ~8 to ~2 C RbcL-1 s-1 from the smallest to the largest cells. Whilst a higher allocation of cellular nitrogen to RUBISCO in larger cells increases the burden upon their nitrogen metabolism, the higher RUBISCO allocation buffers their lower achieved RUBISCO turnover rate to enable larger diatoms to maintain carbon assimilation rates per total protein comparable to small diatoms. Individual species responded to increased pCO2, but cell size effects outweigh pCO2 responses across the diatom species size range examined. In large diatoms a higher nitrogen cost for RUBISCO exacerbates the higher nitrogen requirements associated with light absorption, so the metabolic cost to maintain photosynthesis is a cell size-dependent trait.

  15. Nitrogen metabolism in the ruminant

    International Nuclear Information System (INIS)

    Buttery, P.J.; Lewis, D.

    1976-01-01

    Selected aspects of nitrogen metabolism in the ruminant are discussed. Particular attention is paid to the effect of rumen ammonia concentration on protein synthesis in the rumen. In order to judge the suitability of microbial protein as a source of protein for the ruminant, it is necessary to be able to assess the amino-acid requirements of the ruminant accurately. Several methods of doing this are discussed. Available data would indicate that under many conditions methionine is the first limiting amino acid. Possible ways of increasing the supply of methionine at the duodenum are discussed. When the amino-acid requirements are fully met, it is to be expected that protein synthesis in the tissues will proceed at its maximal rate. Ways of determining the extent of tissue protein synthesis in vivo are briefly discussed. (author)

  16. Combined nitrogen limitation and cadmium stress stimulate total carbohydrates, lipids, protein and amino acid accumulation in Chlorella vulgaris (Trebouxiophyceae)

    Energy Technology Data Exchange (ETDEWEB)

    Chia, Mathias Ahii, E-mail: chia28us@yahoo.com [Department of Botany, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Lombardi, Ana Teresa [Department of Botany, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Graça Gama Melão, Maria da [Department of Hydrobiology, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Parrish, Christopher C. [Department of Ocean Sciences, Memorial University of Newfoundland, St. John’s, Newfoundland A1C 5S7 (Canada)

    2015-03-15

    Highlights: • Chlorella vulgaris was exposed to Cd under varying N concentrations. • Growth rate and cell density decreased with increasing Cd stress and N limitation. • Dry weight, chlorophyll a, total lipid, carbohydrate and protein were accumulated. • Amino acids like proline and glutamine were accumulated under N and Cd stress. • Changes in amino acid composition are sensitive biomarkers for Cd and N stress. - Abstract: Metals have interactive effects on the uptake and metabolism of nutrients in microalgae. However, the effect of trace metal toxicity on amino acid composition of Chlorella vulgaris as a function of varying nitrogen concentrations is not known. In this research, C. vulgaris was used to investigate the influence of cadmium (10{sup −7} and 2.0 × 10{sup −8} mol L{sup −1} Cd) under varying nitrogen (2.9 × 10{sup −6}, 1.1 × 10{sup −5} and 1.1 × 10{sup −3} mol L{sup −1} N) concentrations on its growth rate, biomass and biochemical composition. Total carbohydrates, total proteins, total lipids, as well as individual amino acid proportions were determined. The combination of Cd stress and N limitation significantly inhibited growth rate and cell density of C. vulgaris. However, increasing N limitation and Cd stress stimulated higher dry weight and chlorophyll a production per cell. Furthermore, biomolecules like total proteins, carbohydrates and lipids increased with increasing N limitation and Cd stress. Ketogenic and glucogenic amino acids were accumulated under the stress conditions investigated in the present study. Amino acids involved in metal chelation like proline, histidine and glutamine were significantly increased after exposure to combined Cd stress and N limitation. We conclude that N limitation and Cd stress affects the physiology of C. vulgaris by not only decreasing its growth but also stimulating biomolecule production.

  17. Two isotopic methods for estimation of soybean nitrogen fixation

    International Nuclear Information System (INIS)

    Domenach, A.-M.; Chalamet, Alain; Pachiaudi, Christiane

    1979-01-01

    Measurements of rate of nitrogen symbiotic fixation by Soybean were determined by two different methods: variations in the natural abundance of 15 N in plants; use of 'A' value determined from labelled nitrogen applications to the soil. The results from both methods were in good agreement. Rates of fixed nitrogen were similar when using non nodulated Soybean or Ray-Grass as reference [fr

  18. Two isotopic methods for estimation of soybean nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Domenach, A M; Chalamet, A; Pachiaudi, C [Lyon-1 Univ., 69 - Villeurbanne (France)

    1979-07-16

    Measurements of rate of nitrogen symbiotic fixation by Soybean were determined by two different methods: variations in the natural abundance of /sup 15/N in plants; use of 'A' value determined from labelled nitrogen applications to the soil. The results from both methods were in good agreement. Rates of fixed nitrogen were similar when using non nodulated Soybean or Ray-Grass as reference.

  19. Nitrogen nutrition of the grape-vine (Vitis vinifera spp)

    International Nuclear Information System (INIS)

    Conradie, W.J.

    1985-12-01

    A thorough knowledge concerning the nitrogen relationship in the grape-vine is essential in order to appreciate how different patterns of uptake, assimilation, storage and utilisation of nitrogen might be advantageous in particular environmental situations. The 15 N-isotope technique has been used to determine the uptake and distribution of nitrogen absorbed during early spring, early summer and autumn. Apart from the total N fraction, protein N and soluble N were determined as well. The utilisation of labelled N applied in the field, was determined for vineyards on heavier and lighter soils

  20. Improved protein structure reconstruction using secondary structures, contacts at higher distance thresholds, and non-contacts.

    Science.gov (United States)

    Adhikari, Badri; Cheng, Jianlin

    2017-08-29

    Residue-residue contacts are key features for accurate de novo protein structure prediction. For the optimal utilization of these predicted contacts in folding proteins accurately, it is important to study the challenges of reconstructing protein structures using true contacts. Because contact-guided protein modeling approach is valuable for predicting the folds of proteins that do not have structural templates, it is necessary for reconstruction studies to focus on hard-to-predict protein structures. Using a data set consisting of 496 structural domains released in recent CASP experiments and a dataset of 150 representative protein structures, in this work, we discuss three techniques to improve the reconstruction accuracy using true contacts - adding secondary structures, increasing contact distance thresholds, and adding non-contacts. We find that reconstruction using secondary structures and contacts can deliver accuracy higher than using full contact maps. Similarly, we demonstrate that non-contacts can improve reconstruction accuracy not only when the used non-contacts are true but also when they are predicted. On the dataset consisting of 150 proteins, we find that by simply using low ranked predicted contacts as non-contacts and adding them as additional restraints, can increase the reconstruction accuracy by 5% when the reconstructed models are evaluated using TM-score. Our findings suggest that secondary structures are invaluable companions of contacts for accurate reconstruction. Confirming some earlier findings, we also find that larger distance thresholds are useful for folding many protein structures which cannot be folded using the standard definition of contacts. Our findings also suggest that for more accurate reconstruction using predicted contacts it is useful to predict contacts at higher distance thresholds (beyond 8 Å) and predict non-contacts.

  1. Ruminal Nitrogen Recycling and Nitrogen Efficiency in Lactating Dairy Cattle

    OpenAIRE

    Aguilar, Michelle

    2012-01-01

    Excess nitrogen (N) excretion from animal agriculture results in reduced air and water quality, and poses a risk to human health. Although the dairy industry utilizes milk urea N (MUN) to monitor protein feeding and N excretion, phenotypic diversity among cows may influence MUN and thus bias feed management. An initial study using data from 2 previously published research trials and a field trial, observed that cow had a significant effect on MUN variation. Regression models, utilized ...

  2. Combined nitrogen limitation and cadmium stress stimulate total carbohydrates, lipids, protein and amino acid accumulation in Chlorella vulgaris (Trebouxiophyceae).

    Science.gov (United States)

    Chia, Mathias Ahii; Lombardi, Ana Teresa; da Graça Gama Melão, Maria; Parrish, Christopher C

    2015-03-01

    Metals have interactive effects on the uptake and metabolism of nutrients in microalgae. However, the effect of trace metal toxicity on amino acid composition of Chlorella vulgaris as a function of varying nitrogen concentrations is not known. In this research, C. vulgaris was used to investigate the influence of cadmium (10(-7) and 2.0×10(-8)molL(-1) Cd) under varying nitrogen (2.9×10(-6), 1.1×10(-5) and 1.1×10(-3)molL(-1)N) concentrations on its growth rate, biomass and biochemical composition. Total carbohydrates, total proteins, total lipids, as well as individual amino acid proportions were determined. The combination of Cd stress and N limitation significantly inhibited growth rate and cell density of C. vulgaris. However, increasing N limitation and Cd stress stimulated higher dry weight and chlorophyll a production per cell. Furthermore, biomolecules like total proteins, carbohydrates and lipids increased with increasing N limitation and Cd stress. Ketogenic and glucogenic amino acids were accumulated under the stress conditions investigated in the present study. Amino acids involved in metal chelation like proline, histidine and glutamine were significantly increased after exposure to combined Cd stress and N limitation. We conclude that N limitation and Cd stress affects the physiology of C. vulgaris by not only decreasing its growth but also stimulating biomolecule production. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. The importance of protein in leaf selection of folivorous primates.

    Science.gov (United States)

    Ganzhorn, Joerg U; Arrigo-Nelson, Summer J; Carrai, Valentina; Chalise, Mukesh K; Donati, Giuseppe; Droescher, Iris; Eppley, Timothy M; Irwin, Mitchell T; Koch, Flávia; Koenig, Andreas; Kowalewski, Martin M; Mowry, Christopher B; Patel, Erik R; Pichon, Claire; Ralison, Jose; Reisdorff, Christoph; Simmen, Bruno; Stalenberg, Eleanor; Starrs, Danswell; Terboven, Juana; Wright, Patricia C; Foley, William J

    2017-04-01

    Protein limitation has been considered a key factor in hypotheses on the evolution of life history and animal communities, suggesting that animals should prioritize protein in their food choice. This contrasts with the limited support that food selection studies have provided for such a priority in nonhuman primates, particularly for folivores. Here, we suggest that this discrepancy can be resolved if folivores only need to select for high protein leaves when average protein concentration in the habitat is low. To test the prediction, we applied meta-analyses to analyze published and unpublished results of food selection for protein and fiber concentrations from 24 studies (some with multiple species) of folivorous primates. To counter potential methodological flaws, we differentiated between methods analyzing total nitrogen and soluble protein concentrations. We used a meta-analysis to test for the effect of protein on food selection by primates and found a significant effect of soluble protein concentrations, but a non-significant effect for total nitrogen. Furthermore, selection for soluble protein was reinforced in forests where protein was less available. Selection for low fiber content was significant but unrelated to the fiber concentrations in representative leaf samples of a given forest. There was no relationship (either negative or positive) between the concentration of protein and fiber in the food or in representative samples of leaves. Overall our study suggests that protein selection is influenced by the protein availability in the environment, explaining the sometimes contradictory results in previous studies on protein selection. Am. J. Primatol. 79:e22550, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  4. Fatty acid profile and composition of milk protein fraction in dairy cows fed long-chain unsaturated fatty acids during the transition period

    Directory of Open Access Journals (Sweden)

    Francisco Palma Rennó

    2013-11-01

    Full Text Available The objective of this study was to evaluate the utilization of different sources of unsaturated long-chain fatty acids in diets for dairy cows during the transition period and early lactation on the milk fatty acid profile and composition of the protein fraction. Thirty-six Holstein cows were divided into three groups, fed the following diets: control (C; soybean oil (SO; and calcium salts of long-chain unsaturated fatty acids (CS. The milk samples utilized for analysis were obtained weekly from parturition to twelve weeks of lactation; each one of the samples originated from two daily milkings. Milk composition and total nitrogen, non-protein nitrogen and non-casein nitrogen levels were analyzed. The cows receiving the diet with calcium salts had lower concentrations of non-protein nitrogen (%CP in milk compared with the animals fed the diet with soybean oil. There was a decrease in concentration of medium-chain fatty acids C12-C16, and a concomitant increase in concentrations of long-chain fatty acids >C18 in milk fat for the animals fed the diets CS and SO when compared with diet C. Soybean oil and CS diets increased milk-fat concentrations of the acids C18: 1 trans-11, C18: 2 cis-9, trans-11 and C18: 2 trans-10 cis-12 in relation to diet C. The utilization of sources of long-chain fatty acids in the diet of dairy cows increases the biological value of milk in early lactation due to higher concentrations of specific fatty acids such as CLA C18: 2cis-9, trans-11.

  5. Respiratory Tract Infections in Diabetic and Non-Diabetic Individuals are Linked with Serum Surfactant Protein-D

    International Nuclear Information System (INIS)

    Jawed, S.; Parveen, N.

    2015-01-01

    Objective: To find out the rate of respiratory tract infections in diabetic and non-diabetic individuals and their relation with surfactant protein D. Methods: The cross-sectional study was conducted at Dow University of Health Sciences, Karachi, from September 2011 to April 2012, and comprised subjects of both genders between ages of 30 and 60 years. The subjects were divided into four groups: diabetic obese, non-diabetic obese, diabetic non-obese, and non-diabetic-non-obese. A structured questionnaire was used to collect information about respiratory tract infections. Serum surfactant protein D levels were analysed using human surfactant protein D enzyme-linked immunosorbent assay kit. Statistical analysis was performed using SPSS 16. Results: Of the 90 subjects, there were 20(22.2 percent) diabetic obese, 30(33.3 percent) non-diabetic obese, 10(11.1 percent) diabetic non-obese, and 30(33.3 percent) non-diabetic-non-obese. The overall mean age was 36.6±103 years. Among the diabetic obese, 15(75 percent) had respiratory tract infections which was higher than the other study groups, and patients having respiratory tract infections had lower surfactant protein D levels than those who did not have infections (p=0.01). Conclusion: Diabetic obese subjects had greater rate of recurrent respiratory tract infections and had lower concentration of serum surfactant protein D compared to subjects without respiratory tract infections. (author)

  6. Protein metabolism in obese patients during very low-calorie mixed diets containing different amounts of proteins and carbohydrates.

    Science.gov (United States)

    Pasquali, R; Casimirri, F; Melchionda, N

    1987-12-01

    To assess long-term nitrogen sparing capacity of very low-calorie mixed diets, we administered two isoenergetic (2092KJ) liquid formula regimens of different composition for 8 weeks to two matched groups of massively obese patients (group 1: proteins 60 g, carbohydrate 54 g; group 2: proteins 41 g, carbohydrates 81 g). Weight loss was similar in both groups. Daily nitrogen balance (g) during the second month resulted more a negative in group 2 with respect to group 1. However, within the groups individual nitrogen sparing capacity varied markedly; only a few in group 1 and one in group 2 were able to attain nitrogen equilibrium throughout the study. Daily urine excretion of 3-methylhistidine fell significantly in group 1 but did not change in group 2. Unlike total proteins, albumins, and transferrin, serum levels of retinol-binding protein, thyroxin-binding globulin, and complement-C3 fell significantly in both groups but per cent variations of complement-C3 were more pronounced in the first group. Prealbumin levels fell persistently in group 1 and transiently in group 2. The results indicate that even with this type of diet an adequate amount of dietary protein represents the most important factor in minimizing whole body protein catabolism during long-term semistarvation in massively obese patients. Moreover, they confirm the possible role of dietary carbohydrates in the regulation of some visceral protein metabolism.

  7. Bread wheat varieties as influenced by different nitrogen levels.

    Science.gov (United States)

    Hussain, Iqtidar; Khan, Muhammad Ayyaz; Khan, Ejaz Ahmad

    2006-01-01

    Experiment was conducted to determine the effect of different nitrogen levels on four bread wheat varieties (Triticum aestivum L.) viz. Inqilab-91, Daman-98, Dera-98 and Punjab-96 at Gomal University, Dera Ismail Khan (NWFP), Pakistan during 2000 approximatey 2001. The experiment was laid out in split plot design having four replications using a net plot size of 2 m x 5 m. Nitrogen doses used were 0, 50, 100, 150 and 200 kg/ha. The results showed that different nitrogen levels had significant effects on plant height, total number of plants/m(2), number of grains/spike, number of spike/m(2), spike weight, biological yield, grain yield and grain protein content. Maximum plant height, total number of plants/m(2), number of spikes/m(2), spike weight, biological yield and grain protein content were observed at 200 kg N/ha. Among wheat varieties Daman-98 had maximum plant height, spike weight, grains/spike, 1000-grain weight, biological yield and grain yield. Inqilab-91 had heavier grains and the most grain protein content, while Dera-98 had the maximum plant population and spikes/m(2). Grain yield and biological yield were statistically similar at doses of 150 kg N/ha and 200 kg N/ha. However, dose of 200 kg N/ha, compared to dose of 150 Kg N/ha, significantly increased the protein content.

  8. Protein characterization of Roditis Greek grape variety and Sauvignon blanc and changes in certain nitrogen compounds during alcoholic fermentation

    Directory of Open Access Journals (Sweden)

    Z. G. Nakopoulou

    2006-09-01

    Full Text Available Must and wine samples of the Greek grape variety Roditis and the French one Sauvignon blanc were analysed in order to obtain further knowledge of the protein profile of Roditis and to watch the evolution of grape proteins during the alcoholic fermentation of Roditis and Sauvignon blanc musts. For these purposes protein samples were isolated from must and wine samples by ammonium sulphate precipitation and subjected to sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS - PAGE. Eleven and nine bands with molecular weights between 11,1 and 64,4 kDa were detected on the electrophoregramms of Roditis and Sauvignon blanc must and wine samples respectively, using Coomassie Brillant Blue R-250 and silver staining methods. Two protein fractions of must and wine samples with molecular weights of 64,4 kDa and 34,4 kDa were identified as being glycoproteins in the profile of the Greek grape variety, according to the Periodic acid - silver staining, while only one must and wine fraction of 64,4 kDa had positively react with this stain, as far as it concerns Sauvignon blanc. None of the low molecular weight protein fractions found to be responsible for haze formation. A modified (Bradford dye - binding procedure was used for the determination of musts and wines soluble proteins. Free amino nitrogen and the contents of neutral and acidic polysaccharides in the protein fractions after chromatography on Sephadex G - 25, were also analyzed.

  9. Transition Metal Ions Enable the Transition from Electrospun Prolamin Protein Fibers to Nitrogen-Doped Freestanding Carbon Films for Flexible Supercapacitors.

    Science.gov (United States)

    Wang, Yixiang; Yang, Jingqi; Du, Rongbing; Chen, Lingyun

    2017-07-19

    Flexible carbon ultrafine fibers are highly desirable in energy storage and conversion devices. Our previous finding showed that electrospun hordein/zein fibers stabilized by Ca 2+ were successfully transferred into nitrogen-doped carbon ultrafine fibers for supercapacitors. However, their relatively brittle nature needed to be improved. Inspired by this stabilizing effect of Ca 2+ , in this work, four transition metal divalent cations were used to assist the formation of flexible hordein/zein-derived carbon ultrafine fibers. Without alteration of the electrospinnability, adequate amounts of zinc acetate and cobalt acetate supported the fibrous structure during pyrolysis. This resulted in flexible freestanding carbon films consisting of well-defined fibers with nitrogen-doped graphitic layers and hierarchical pores. These carbon films were easily cut into small square pieces and directly applied as working electrode in the three-electrode testing system without the need for polymer binders or conducting agents. Notably, the hz-Zn0.3-p electrode, synthesized with 0.3 mol/L Zn 2+ and post-acid treatment, exhibited a specific capacitance of 393 F/g (at 1 A/g), a large rate capability (72.3% remained at 20 A/g), and a capacitance retention of ∼98% after 2000 charging-discharging cycles at 10 A/g. These superior electrochemical properties were attributed to the synergistic effects of the well-developed graphitic layers induced by Zn 2+ , the nitrogen-decorated carbon structure, and the interconnected channels generated by HCl treatment. This research advances potential applications for prolamin proteins as nitrogen-containing raw materials in developing carbon structures for high-performance supercapacitors.

  10. Dynamic seasonal nitrogen cycling in response to anthropogenic N loading in a tropical catchment, Athi-Galana-Sabaki River, Kenya

    Science.gov (United States)

    Marwick, T. R.; Tamooh, F.; Ogwoka, B.; Teodoru, C.; Borges, A. V.; Darchambeau, F.; Bouillon, S.

    2014-01-01

    produced was rapidly degassed downstream, while the elevated NO3- concentrations steadily decreased to levels observed elsewhere in more pristine African river networks. Low pelagic primary production rates over the same reach suggest that benthic denitrification was the dominant process controlling the removal of NO3-, although large cyanobacterial blooms further downstream highlight the significant role of DIN assimilation by primary producers also. Consequently, the intense nitrification and uptake of N by algae leads to significant enrichment of 15N in the PN pool during the dry season (mean: +16.5 ± 8.2‰ but reaching as high as +31.5‰) compared to the short (+7.3 ± 2.6‰) and long (+7.6 ± 5.9‰) rain seasons. A strong correlation between the seasonal N stable isotope ratios of PN (δ15NPN) and oxygen stable isotope ratios of river water (δ18OH2O; as a proxy of freshwater discharge) presents the possibility of employing a combination of proxies - such as δ15NPN of sediments, bivalves and near-shore corals - to reconstruct how historical land use changes have influenced nitrogen cycling within the catchment, whilst potentially providing foresight on the impacts of future land management decisions.

  11. Effects of Plant Density and Nitrogen Fertilizer on Quantity and Quality of Forage Corn in Daregaz Region (Iran

    Directory of Open Access Journals (Sweden)

    N. Saadatzadeh

    2011-01-01

    Full Text Available In order to evaluate the effects of plant density and nitrogen on quantity and quality of forage corn an experiment was conducted in Daregaz region in cropping season 2008 – 2009. The experimental design was a split – plot based on randomized complete block with three replications. The main plots were four levels of nitrogen (0 , 75, 150 and 225 kg/ha and sub plots were three levels of plant density (75000, 100000 and 125000 plant/ha. The results showed that increasing nitrogen levels and plant density, plant height, percentage crude protein and total protein production (ton/ha were increased. By increasing plant density, stem diameter, leaf and ear weight decreased while they increased with increased nitrogen levels. The highest forage yield obtained at nitrogen level 150 kg/ha (46 ton/ha and 100000 plant per hectare (40.27 ton/ha. The highest total protein production (7 ton/ha obtained at nitrogen level of 150 kg/ha and plant density of 125000 plant/ha.

  12. Assessment of the usefulness of the PIGE method to determine nitrogen in human blood serum

    International Nuclear Information System (INIS)

    Kupila-Rantala, T.; Hyvoenen-Dabek, M.; Raiasanen, J.; Dabek, J.T.

    1995-01-01

    Proton-induced gamma-ray emission (PIGE) analysis has been applied to the determination of total nitrogen concentration of blood sera from hospital patients. Both the reaction 14 N(p,p'γ) 14 N, E γ =2313 keV, and the reaction 15 N(p,αγ) 12 C,E γ =4439keV, have been used. From 37 patients, the range of the nitrogen concentrations obtained was 9.54-16.3 g/l with a mean of 12.0 g/l. The corresponding total protein concentrations varied between 59 and 96 g/l, measured in a clinical laboratory auto analyser using the biuret method. The range of the albumin concentrations was 29-46 g/l. The nitrogen concentrations correlated well with the total protein concentrations (r=0.802). The multiple correlation of nitrogen versus (albumin+ (total protein- albumin)) gives a coefficient of 0.175 for albumin and 0.161 for total protein- albumin. The results agree with expectations and support the potential usefulness of the rapid PIGE method for medical studies. (author). 17 refs., 3 figs

  13. SPRED: A machine learning approach for the identification of classical and non-classical secretory proteins in mammalian genomes

    Energy Technology Data Exchange (ETDEWEB)

    Kandaswamy, Krishna Kumar [Institute for Neuro- and Bioinformatics, University of Luebeck, 23538 Luebeck (Germany); Graduate School for Computing in Medicine and Life Sciences, University of Luebeck, 23538 Luebeck (Germany); Pugalenthi, Ganesan [School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Hartmann, Enno; Kalies, Kai-Uwe [Centre for Structural and Cell Biology in Medicine, Institute of Biology, University of Luebeck, 23538 Luebeck (Germany); Moeller, Steffen [Institute for Neuro- and Bioinformatics, University of Luebeck, 23538 Luebeck (Germany); Suganthan, P.N. [School of Electrical and Electronic Engineering, Nanyang Technological University, Singapore 639798 (Singapore); Martinetz, Thomas, E-mail: martinetz@inb.uni-luebeck.de [Institute for Neuro- and Bioinformatics, University of Luebeck, 23538 Luebeck (Germany)

    2010-01-15

    Eukaryotic protein secretion generally occurs via the classical secretory pathway that traverses the ER and Golgi apparatus. Secreted proteins usually contain a signal sequence with all the essential information required to target them for secretion. However, some proteins like fibroblast growth factors (FGF-1, FGF-2), interleukins (IL-1 alpha, IL-1 beta), galectins and thioredoxin are exported by an alternative pathway. This is known as leaderless or non-classical secretion and works without a signal sequence. Most computational methods for the identification of secretory proteins use the signal peptide as indicator and are therefore not able to identify substrates of non-classical secretion. In this work, we report a random forest method, SPRED, to identify secretory proteins from protein sequences irrespective of N-terminal signal peptides, thus allowing also correct classification of non-classical secretory proteins. Training was performed on a dataset containing 600 extracellular proteins and 600 cytoplasmic and/or nuclear proteins. The algorithm was tested on 180 extracellular proteins and 1380 cytoplasmic and/or nuclear proteins. We obtained 85.92% accuracy from training and 82.18% accuracy from testing. Since SPRED does not use N-terminal signals, it can detect non-classical secreted proteins by filtering those secreted proteins with an N-terminal signal by using SignalP. SPRED predicted 15 out of 19 experimentally verified non-classical secretory proteins. By scanning the entire human proteome we identified 566 protein sequences potentially undergoing non-classical secretion. The dataset and standalone version of the SPRED software is available at (http://www.inb.uni-luebeck.de/tools-demos/spred/spred).

  14. SPRED: A machine learning approach for the identification of classical and non-classical secretory proteins in mammalian genomes

    International Nuclear Information System (INIS)

    Kandaswamy, Krishna Kumar; Pugalenthi, Ganesan; Hartmann, Enno; Kalies, Kai-Uwe; Moeller, Steffen; Suganthan, P.N.; Martinetz, Thomas

    2010-01-01

    Eukaryotic protein secretion generally occurs via the classical secretory pathway that traverses the ER and Golgi apparatus. Secreted proteins usually contain a signal sequence with all the essential information required to target them for secretion. However, some proteins like fibroblast growth factors (FGF-1, FGF-2), interleukins (IL-1 alpha, IL-1 beta), galectins and thioredoxin are exported by an alternative pathway. This is known as leaderless or non-classical secretion and works without a signal sequence. Most computational methods for the identification of secretory proteins use the signal peptide as indicator and are therefore not able to identify substrates of non-classical secretion. In this work, we report a random forest method, SPRED, to identify secretory proteins from protein sequences irrespective of N-terminal signal peptides, thus allowing also correct classification of non-classical secretory proteins. Training was performed on a dataset containing 600 extracellular proteins and 600 cytoplasmic and/or nuclear proteins. The algorithm was tested on 180 extracellular proteins and 1380 cytoplasmic and/or nuclear proteins. We obtained 85.92% accuracy from training and 82.18% accuracy from testing. Since SPRED does not use N-terminal signals, it can detect non-classical secreted proteins by filtering those secreted proteins with an N-terminal signal by using SignalP. SPRED predicted 15 out of 19 experimentally verified non-classical secretory proteins. By scanning the entire human proteome we identified 566 protein sequences potentially undergoing non-classical secretion. The dataset and standalone version of the SPRED software is available at (http://www.inb.uni-luebeck.de/tools-demos/spred/spred).

  15. Characterization of brazilian wheat cultivars in terms of nitrogen use efficiency

    Directory of Open Access Journals (Sweden)

    Cristiano Lemes da Silva

    2014-06-01

    Full Text Available Nitrogen (N management in wheat crop is one of the most studied agricultural practices in Brazil; however, there are few reports on its use efficiency. The objective of this study was to characterize 18 Brazilian wheat cultivars, which are representative and have been recently released to cultivation, for nitrogen use efficiency (NUE. The experiments were carried out in Pato Branco, Paraná, and Coxilha, Rio Grande do Sul, during the 2011 crop season. It was used a randomized block design with three replications, in factorial scheme (2 environments × 18 cultivars. Genetic variability was observed for nitrogen utilization efficiency by grains (NUtEg=47.6 to 81.1 kg kg-1 and nitrogen harvest index (NHI=71.3 to 84.6% with significant effects relating to the environment of cultivation and performance of these traits. The evaluation of the protein concentration of grain by near infrared spectrometry (GPC N produced equivalent results to the direct analytical method of Kjeldahl (GPC K, in Pato Branco (r=0.56 and Coxilha (RS (r=0.80. However the CPG N overestimated the protein values by 16.85%. The GPC and protein yield were positively correlated with NUtEg and NHI. The best performance for the traits associated with NUE was observed for the following cultivars: Mirante, Quartzo, Fundacep Cristalino, Fundacep Raízes and CD 150. This is the first report of differences between Brazilian wheat cultivars for nitrogen use efficiency.

  16. Symbiotic nitrogen fixation and nitrate uptake by the pea crop

    International Nuclear Information System (INIS)

    Jensen, E.S.

    1986-08-01

    Symbiotic nitrogen fixation and nitrate uptake by pea plants (Pisum sativum L.) were studied in field and pot experiments using the 15 N isotope dilution technique and spring barley as a non-fixing reference crop. Barley, although not ideal, seemed to be a suitable reference for pea in the 15 N-technique. Maximum N 2 fixation activity of 10 kg N fixed per ha per day was reached around the flat pod growth stage, and the activity decreased rapidly during pod-filling. The pea crop fixed between 100 and 250 kg N ha -1 , corresponding to from 45 to 80 per cent of total crop N. The amount of symbiotically fixed N 2 depended on the climatic conditions in the experimental year, the level of soil mineral N and the pea cultivar. Field-grown pea took up 60 to 70 per cent of the N-fertilizer supplied. The supply of 50 kg NO 3 -N ha -1 inhibited the N 2 fixation approximately 15 per cent. Small amounts of fertilizer N, supplied at sowing (starter-N), slightly stimulated the vegetative growth of pea, but the yields of seed dry matter and protein were not significantly influenced. In the present field experiments the environmental conditions, especially the distribution of rainfall during the growth season, seemed to be more important in determining the protein and dry matter yield of the dry pea crop, than the ability of pea to fix nitrogen symbiotically. However, fertilizer N supplied to pot-grown pea plants at the flat pod growth stage or as split applications significantly increased the yield of seed dry matter and protein. (author)

  17. Nitrogen metabolism in a grapevine in vitro system

    Directory of Open Access Journals (Sweden)

    Nuria Llorens

    2002-09-01

    Full Text Available Ammonium, nitrate, nitrite, protein and individual and total amino acid contents were determined in grapevine (cv Sauvignon cultured in vitro. The enzyme activities of nitrate and nitrite reductases, glutamine synthetase, glutamate synthetase and dehydrogenase were also determined. The nitrogen taken up by the plants was 70% of the total nitrogen in the medium after 75 days of in vitro culture. Most of the nitrogen taken up was recovered in the leaves, yet only ammonia and amino acid concentrations were significantly higher in leaves. In roots, glutamine was the most abundant amino acid. In leaves, the most abundant amino acids were aspartate, glutamate, glutamine, alanine, arginine and g-aminobutirate. All enzyme activities were higher in roots than in leaves. These results suggest that both roots and leaves incorporate inorganic nitrogen into organic forms.

  18. Utilization of nitrogen fixing trees

    Energy Technology Data Exchange (ETDEWEB)

    Brewbaker, J.L.; Beldt, R. van den; MacDicken, K.; Budowski, G.; Kass, D.C.L.; Russo, R.O.; Escalante, G.; Herrera, R.; Aranguren, J.; Arkcoll, D.B.; Doebereinger, J. (cord.)

    1983-01-01

    Six papers from the symposium are noted. Brewbaker, J.L., Beldt, R. van den, MacDicken, K. Fuelwood uses and properties of nitrogen-fixing trees, pp 193-204, (Refs. 15). Includes a list of 35 nitrogen-fixing trees of high fuelwood value. Budowski, G.; Kass, D.C.L.; Russo, R.O. Leguminous trees for shade, pp 205-222, (Refs. 68). Escalante, G., Herrera, R., Aranguren, J.; Nitrogen fixation in shade trees (Erythrina poeppigiana) in cocoa plantations in northern Venezuela, pp 223-230, (Refs. 13). Arkcoll, D.B.; Some leguminous trees providing useful fruits in the North of Brazil, pp 235-239, (Refs. 13). This paper deals with Parkia platycephala, Pentaclethra macroloba, Swartzia sp., Cassia leiandra, Hymenaea courbaril, dipteryz odorata, Inga edulis, I. macrophylla, and I. cinnamonea. Baggio, A.J.; Possibilities of the use of Gliricidia sepium in agroforestry systems in Brazil, pp 241-243; (Refs. 15). Seiffert, N.F.; Biological nitrogen and protein production of Leucaena cultivars grown to supplement the nutrition of ruminants, pp 245-249, (Refs. 14). Leucaena leucocephala cv. Peru, L. campina grande (L. leucocephala), and L. cunningham (L. leucocephalae) were promising for use as browse by beef cattle in central Brazil.

  19. Protein turnover and 3-methylhistidine excretion in non-pregnant, pregnant and gestational diabetic women

    International Nuclear Information System (INIS)

    Fitch, W.L.; King, J.C.

    1986-01-01

    Protein turnover was studied in nine non-pregnant (NP) women, eight pregnant (P) and two gestational diabetic (GDM) women. Whole body protein turnover, synthesis and catabolism rates were measured using a single oral dose of 15 N-glycine followed by measurement of enrichment of urinary ammonia. Urinary 3-methylhistidine (3MH) excretion was measured for three consecutive days, including the day of the protein turnover study. Whole body protein turnover and synthesis rates did not differ between the P and NP women, although the synthesis rates tended to be higher in the P group. Gestational diabetic women appeared to have considerably higher rates of both turnover and synthesis. Pregnant women excreted significantly more urinary 3MH than did non-pregnant women. GDM women appeared to have lower 3MH excretion than the P women. Correlation between 3MH excretion and protein turnover rates was nearly significant (p = .06) in the NP women, but was poorly correlated (p = .43) in the P women, suggesting that muscles may be a less important site of whole body protein turnover in pregnancy than in the non-pregnant state

  20. Enhanced non-enzymatic glucose sensing based on copper nanoparticles decorated nitrogen-doped graphene.

    Science.gov (United States)

    Jiang, Ding; Liu, Qian; Wang, Kun; Qian, Jing; Dong, Xiaoya; Yang, Zhenting; Du, Xiaojiao; Qiu, Baijing

    2014-04-15

    Copper nanoparticles (NPs) decorated nitrogen-doped graphene (Cu-N-G) was prepared by a facile thermal treatment, and further employed as a novel sensing material for fabricating the sensitive non-enzymatic glucose sensor. Compared with pure Cu NPs, the Cu-N-G showed enhanced electrocatalytic activity to glucose oxidation due to the integration of N-G, which exhibited the oxidation peak current of glucose ca. 23-fold higher than that of pure Cu NPs. The presented sensor showed excellent performances for glucose detection including wide linear range of 0.004-4.5 mM, low detection limit (1.3 μM, S/N=3), high sensitivity (48.13 μA mM(-1)), fast response time (doped graphene as enhanced materials in fabricating sensors for chemical and biochemical analysis. © 2013 Published by Elsevier B.V.

  1. Effects of nitrogen application rate on dry matter redistribution, grain yield, nitrogen use efficiency and photosynthesis in malting barley

    DEFF Research Database (Denmark)

    Cai, J; Jiang, D; Wollenweber, Bernd

    2012-01-01

    The harmonious combination of malting barley yield, quality and nitrogen (N) use-efficiency under nitrogen (N) rates applications was greatly conducive to production in China. The malting barley cultivar Supi 3 was planted during the growing seasons 2005 and 2006 at two contrasting sites in China....... Five nitrogen (N) application rates (0, 75, 150, 225 and 300 kg ha−1) were applied for research of effects of N rates application on grain yield, protein content and N use-efficiency. At both sites and in both years, grain yield increased with increasing N application rates up to 225 kg N ha−1...... with a quadrant model, the optimum N application rates for high grain yield with high nitrogen use-efficiency in malting barley could be indicated. So, the higher yields could be mainly ascribed to the higher accumulation of photoassimilates between anthesis and maturity. In order to achieve high grain yield...

  2. CuO nanoparticles supported on nitrogen and sulfur co-doped graphene nanocomposites for non-enzymatic glucose sensing

    Energy Technology Data Exchange (ETDEWEB)

    Li, Meixia [Hebei University of Engineering, Faculty of Material Science and Engineering (China); Guo, Qingbin, E-mail: guoqingbinhue@163.com [Hebei University of Engineering, Academic Affairs office (China); Xie, Juan; Li, Yongde; Feng, Yapeng [Hebei University of Engineering, Faculty of Material Science and Engineering (China)

    2017-01-15

    Developing highly active catalysts to promote the electrocatalytic glucose oxidation (EGO) is a crucial demand for non-enzymatic glucose sensing. Herein, we reported the use of nitrogen and sulfur co-doped graphene (NSG) as a novel support material for anchoring CuO nanoparticles and obtained CuO/NSG was employed as an efficient EGO catalyst for non-enzymatic glucose sensing. The results showed that the NSG endowed the CuO/NSG with large surface area, increased structural defects, improved conductivity, and strong covalent coupling between NSG and CuO. Owing to the significant contribution of NSG and the synergistic effect of NSG and CuO, the CuO/NSG exhibited a remarkably higher EGO activity than CuO and CuO/reduced graphene oxide. The CuO/NSG-based sensor displayed excellent glucose sensing performances with a considerably low detection limit of 0.07 μM. These findings elucidate that the NSG is a promising support material for non-enzymatic glucose detection.

  3. Modeling nitrogen chemistry in combustion

    DEFF Research Database (Denmark)

    Glarborg, Peter; Miller, James A.; Ruscic, Branko

    2018-01-01

    the accuracy of engineering calculations and thereby the potential of primary measures for NOx control. In this review our current understanding of the mechanisms that are responsible for combustion-generated nitrogen-containing air pollutants is discussed. The thermochemistry of the relevant nitrogen...... via NNH or N2O are discussed, along with the chemistry of NO removal processes such as reburning and Selective Non-Catalytic Reduction of NO. Each subset of the mechanism is evaluated against experimental data and the accuracy of modeling predictions is discussed....

  4. In vivo labelling of proteins associated with folded chromosomes of yeast

    International Nuclear Information System (INIS)

    Litske Petersen, J.G.; Pinon, R.

    1980-01-01

    Proteins associated with the pre-replicative (g 1 ) and post-replicative (g 2 ) folded chromosomes of Saccharomyces cerevisiae can be labelled in vivo by growing cells in acetate vegetative medium containing [ 35 S]methionine. In both sporulating (MATa/MATα) and non-sporulating (MATa/MATa, MATα/MATα) diploids proteins associated with the resting stage genome (g 0 ) can be labelled with [ 35 S]methionine during nitrogen starvation and in sporulation medium. In addition, in MATa/MATα diploids proteins associated with the meiotic replication form (r) can also be labelled. SDS-polyacrylamide gel electrophoresis and autoradiography of the labelled proteins from the various folded genome forms showed that the g 1 and g 2 patterns are, with the exception of one polypeptide band, essentially identical. Several differences distinguished the r and g 0 patterns from those of the g 1 and g 2 structures. At least four polypeptide bands distinguish the r and g 0 patterns. No significant differences were observed between the g 0 proteins of sporulating and non-sporulating diploids. (author)

  5. Selection of single grain seeds by 14N(n,γ)15N nuclear reaction for protein improvement

    International Nuclear Information System (INIS)

    Andras, L.; Csoke, A.; Nagy, A.Z.; Balint, A.

    1979-01-01

    A new non-destructive screening technique was developed for determining the protein (total nitrogen) content of single grain seeds. Here, our first experiment is described where in the case of maize samples, 300 s was used to perform one measurement on a seed with a semiautomatic device. (author)

  6. Effect of different rates of nitrogen fertilizer on durum wheat (Triticum ...

    African Journals Online (AJOL)

    Dr Asefa

    2012-05-03

    May 3, 2012 ... The result showed that nitrogen rates and cultivars had significant effect on yield, yield related traits, nitrogen uptake ... cooking quality [8]. Durum wheat grain protein functionality can be influenced by N fertilization, particularly in the varieties of relatively with less gluten strength [9]. Information on the quality ...

  7. Effects of Different Amounts of Nitrogen and Azotobarvar on Growth Characteristics and Yield of Chickpea (Cicer arietinum L.

    Directory of Open Access Journals (Sweden)

    ghobad mohammadpoor

    2017-09-01

    row. The yield of chickpea was harvested in 6 July 2013. Results and Discussion Results of the experiment showed that the effects of treatments were significant on biological yield, grain yield, harvest index, 100-seed weight, protein content, number of branches, number of pods per branch and number and weight of grains per branch. The highest dry matter and grain yield obtained at %50 nitrogen fertilizer + %100 Azotobarvar with 6730 and 1089 Kg.ha-1, respectively and the lowest in the control treatment with 2420 and 472 Kg.ha-1, respectively. The greatest number of seeds per plant (20.4 were measured in the treatment of %150 nitrogen with Azotobarvar and the lowest (14.4 obtained in the treated %50 of nitrogen and without Azotobarvar. The highest 100-seed weight (46.9 g obtained in the treatment of %50 nitrogen + %150 Azotobarvar and the lowest nitrogen fertilization (22.5 g was at %150 of N + non-inoculated Azotobarvar. Also, the highest (26.1% and lowest (22.7% protein contents were obtained at the treatments of %50 nitrogen + %150 Azotobarvar and control, respectively. The amount of biomass, grain yield and protein content were in the treatments of no nitrogen and Azotobarvar (control.The application of nitrogen to about %50 of the base amount and Azotobarvar equal the base amount or %150 of the base amount maximized grain yield, total dry matter, 100-seed weight and seed protein content. In other words, taking Azotobavar in this condition (rainfed was more effective compared to chemical nitrogen (Urea on the yield. Probably Azotobarvar, because of other mechanisms except the supply of nitrogen, had significant impacts on the growth characteristics of the plant. Finally, based on the results of this experiment, application of the industrial Nitrogen with base dosage, the highest yield is obtained, but its application higher than based amount showed negative reactions. Also increasing the amount of the Azotobarvar (bio-fertilizer more than basic dosage caused yield

  8. Protein as a sole source of nitrogen for in vitro grown tobacco plantlets

    Czech Academy of Sciences Publication Activity Database

    Synková, Helena; Hýsková, V.; Garčeková, K.; Křížová, S.; Ryšlavá, H.

    2016-01-01

    Roč. 60, č. 4 (2016), s. 635-644 ISSN 0006-3134 Institutional support: RVO:61389030 Keywords : glutamate-dehydrogenase * inorganic nitrogen * nitrate transport * organic nitrogen * amino-acids * metabolism * seedlings * leaves * roots * assimilation * ammonium * casein * chlorophyll fluorescence * nitrate * photosynthesis Subject RIV: EF - Botanics Impact factor: 1.551, year: 2016

  9. Expression of Iron-Related Proteins Differentiate Non-Cancerous and Cancerous Breast Tumors

    Directory of Open Access Journals (Sweden)

    Sara Pizzamiglio

    2017-02-01

    Full Text Available We have previously reported hepcidin and ferritin increases in the plasma of breast cancer patients, but not in patients with benign breast disease. We hypothesized that these differences in systemic iron homeostasis may reflect alterations in different iron-related proteins also play a key biochemical and regulatory role in breast cancer. Thus, here we explored the expression of a bundle of molecules involved in both iron homeostasis and tumorigenesis in tissue samples. Enzyme-linked immunosorbent assay (ELISA or reverse-phase protein array (RPPA, were used to measure the expression of 20 proteins linked to iron processes in 24 non-cancerous, and 56 cancerous, breast tumors. We found that cancerous tissues had higher level of hepcidin than benign lesions (p = 0.012. The univariate analysis of RPPA data highlighted the following seven proteins differentially expressed between non-cancerous and cancerous breast tissue: signal transducer and transcriptional activator 5 (STAT5, signal transducer and activator of transcription 3 (STAT3, bone morphogenetic protein 6 (BMP6, cluster of differentiation 74 (CD74, transferrin receptor (TFRC, inhibin alpha (INHA, and STAT5_pY694. These findings were confirmed for STAT5, STAT3, BMP6, CD74 and INHA when adjusting for age. The multivariate statistical analysis indicated an iron-related 10-protein panel effective in separating non-cancerous from cancerous lesions including STAT5, STAT5_pY694, myeloid differentiation factor 88 (MYD88, CD74, iron exporter ferroportin (FPN, high mobility group box 1 (HMGB1, STAT3_pS727, TFRC, ferritin heavy chain (FTH, and ferritin light chain (FTL. Our results showed an association between some iron-related proteins and the type of tumor tissue, which may provide insight in strategies for using iron chelators to treat breast cancer.

  10. High nitrogen availability reduces polyphenol content in Sphagnum peat.

    Science.gov (United States)

    Bragazza, Luca; Freeman, Chris

    2007-05-15

    Peat mosses of the genus Sphagnum constitute the bulk of living and dead biomass in bogs. These plants contain peculiar polyphenols which hamper litter peat decomposition through their inhibitory activity on microbial breakdown. In the light of the increasing availability of biologically active nitrogen in natural ecosystems, litter derived from Sphagnum mosses is an ideal substrate to test the potential effects of increased atmospheric nitrogen deposition on polyphenol content in litter peat. To this aim, we measured total nitrogen and soluble polyphenol concentration in Sphagnum litter peat collected in 11 European bogs under a chronic gradient of atmospheric nitrogen deposition. Our results demonstrate that increasing nitrogen concentration in Sphagnum litter, as a consequence of increased exogenous nitrogen availability, is accompanied by a decreasing concentration of polyphenols. This inverse relationship is consistent with reports that in Sphagnum mosses, polyphenol and protein biosynthesis compete for the same precursor. Our observation of modified Sphagnum litter chemistry under chronic nitrogen eutrophication has implications in the context of the global carbon balance, because a lower content of decay-inhibiting polyphenols would accelerate litter peat decomposition.

  11. Robust biological nitrogen fixation in a model grass-bacterial association.

    Science.gov (United States)

    Pankievicz, Vânia C S; do Amaral, Fernanda P; Santos, Karina F D N; Agtuca, Beverly; Xu, Youwen; Schueller, Michael J; Arisi, Ana Carolina M; Steffens, Maria B R; de Souza, Emanuel M; Pedrosa, Fábio O; Stacey, Gary; Ferrieri, Richard A

    2015-03-01

    Nitrogen-fixing rhizobacteria can promote plant growth; however, it is controversial whether biological nitrogen fixation (BNF) from associative interaction contributes to growth promotion. The roots of Setaria viridis, a model C4 grass, were effectively colonized by bacterial inoculants resulting in a significant enhancement of growth. Nitrogen-13 tracer studies provided direct evidence for tracer uptake by the host plant and incorporation into protein. Indeed, plants showed robust growth under nitrogen-limiting conditions when inoculated with an ammonium-excreting strain of Azospirillum brasilense. (11)C-labeling experiments showed that patterns in central carbon metabolism and resource allocation exhibited by nitrogen-starved plants were largely reversed by bacterial inoculation, such that they resembled plants grown under nitrogen-sufficient conditions. Adoption of S. viridis as a model should promote research into the mechanisms of associative nitrogen fixation with the ultimate goal of greater adoption of BNF for sustainable crop production. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

  12. Differences in quality standards when prescribing nutritional support: Differences between specialist and non-specialist physicians.

    Science.gov (United States)

    Morán López, Jesús Manuel; Piedra León, María; Enciso Izquierdo, Fidel Jesús; Luengo Pérez, Luis Miguel; Amado Señaris, José Antonio

    2016-01-01

    Adequate nutritional support includes many different aspects, but poor understanding of clinical nutrition by health care professionales often results in an inadequate prescription. A study was conducted to compare enteral and parenteral nutritional support plans prescribed by specialist and non-specialist physicians. Non-specialist physicians recorded anthropometric data from only 13.3% of patients, and none of them performed nutritional assessments. Protein amounts provided by non-specialist physicians were lower than estimated based on ESPEN (10.29g of nitrogen vs 14.62; Pspecialist group (14.88g of nitrogen; P=.072). Calorie and glutamine provision and laboratory controls prescribed by specialists were significantly closer to those recommended by clinical guidelines. Nutritional support prescribed by specialists in endocrinology and nutrition at San Pedro de Alcántara Hospital was closer to clinical practice guideline standards and of higher quality as compared to that prescribed by non-specialists. Copyright © 2015 SEEN. Published by Elsevier España, S.L.U. All rights reserved.

  13. Membrane remodeling by amyloidogenic and non-amyloidogenic proteins studied by EPR.

    Science.gov (United States)

    Varkey, Jobin; Langen, Ralf

    2017-07-01

    The advancement in site-directed spin labeling of proteins has enabled EPR studies to expand into newer research areas within the umbrella of protein-membrane interactions. Recently, membrane remodeling by amyloidogenic and non-amyloidogenic proteins has gained a substantial interest in relation to driving and controlling vital cellular processes such as endocytosis, exocytosis, shaping of organelles like endoplasmic reticulum, Golgi and mitochondria, intracellular vesicular trafficking, formation of filopedia and multivesicular bodies, mitochondrial fusion and fission, and synaptic vesicle fusion and recycling in neurotransmission. Misregulation in any of these processes due to an aberrant protein (mutation or misfolding) or alteration of lipid metabolism can be detrimental to the cell and cause disease. Dissection of the structural basis of membrane remodeling by proteins is thus quite necessary for an understanding of the underlying mechanisms, but it remains a formidable task due to the difficulties of various common biophysical tools in monitoring the dynamic process of membrane binding and bending by proteins. This is largely since membranes generally complicate protein structure analysis and this problem is amplified for structural analysis in the presence of different types of membrane curvatures. Recent EPR studies on membrane remodeling by proteins show that a significant structural information can be generated to delineate the role of different protein modules, domains and individual amino acids in the generation of membrane curvature. These studies also show how EPR can complement the data obtained by high resolution techniques such as X-ray and NMR. This perspective covers the application of EPR in recent studies for understanding membrane remodeling by amyloidogenic and non-amyloidogenic proteins that is useful for researchers interested in using or complimenting EPR to gain better understanding of membrane remodeling. We also discuss how a single

  14. Membrane remodeling by amyloidogenic and non-amyloidogenic proteins studied by EPR

    Science.gov (United States)

    Varkey, Jobin; Langen, Ralf

    2017-07-01

    The advancement in site-directed spin labeling of proteins has enabled EPR studies to expand into newer research areas within the umbrella of protein-membrane interactions. Recently, membrane remodeling by amyloidogenic and non-amyloidogenic proteins has gained a substantial interest in relation to driving and controlling vital cellular processes such as endocytosis, exocytosis, shaping of organelles like endoplasmic reticulum, Golgi and mitochondria, intracellular vesicular trafficking, formation of filopedia and multivesicular bodies, mitochondrial fusion and fission, and synaptic vesicle fusion and recycling in neurotransmission. Misregulation in any of these processes due to an aberrant protein (mutation or misfolding) or alteration of lipid metabolism can be detrimental to the cell and cause disease. Dissection of the structural basis of membrane remodeling by proteins is thus quite necessary for an understanding of the underlying mechanisms, but it remains a formidable task due to the difficulties of various common biophysical tools in monitoring the dynamic process of membrane binding and bending by proteins. This is largely since membranes generally complicate protein structure analysis and this problem is amplified for structural analysis in the presence of different types of membrane curvatures. Recent EPR studies on membrane remodeling by proteins show that a significant structural information can be generated to delineate the role of different protein modules, domains and individual amino acids in the generation of membrane curvature. These studies also show how EPR can complement the data obtained by high resolution techniques such as X-ray and NMR. This perspective covers the application of EPR in recent studies for understanding membrane remodeling by amyloidogenic and non-amyloidogenic proteins that is useful for researchers interested in using or complimenting EPR to gain better understanding of membrane remodeling. We also discuss how a single

  15. Tumor deposits counted as positive lymph nodes in TNM staging for advanced colorectal cancer: a retrospective multicenter study.

    Science.gov (United States)

    Li, Jun; Yang, Shengke; Hu, Junjie; Liu, Hao; Du, Feng; Yin, Jie; Liu, Sai; Li, Ci; Xing, Shasha; Yuan, Jiatian; Lv, Bo; Fan, Jun; Leng, Shusheng; Zhang, Xin; Wang, Bing

    2016-04-05

    We investigated the possibility of counting tumor deposits (TDs) as positive lymph nodes (pLNs) in the pN category and evaluated its prognostic value for colorectal cancer (CRC) patients. A new pN category (npN category) was calculated using the numbers of pLNs plus TDs. The npN category included 4 tiers: npN1a (1 tumor node), npN1b (2-3 tumor nodes), npN2a (4-6 tumor nodes), and npN2b (≥7 tumor nodes). We identified 4,121 locally advanced CRC patients, including 717 (11.02%) cases with TDs. Univariate and multivariate analyses were performed to evaluate the disease-free and overall survival (DFS and OS) for npN and pN categories. Multivariate analysis showed that the npN and pN categories were both independent prognostic factors for DFS (HR 1.614, 95% CI 1.541 to 1.673; HR 1.604, 95% CI 1.533 to 1.679) and OS (HR 1.633, 95% CI 1.550 to 1.720; HR 1.470, 95% CI 1.410 to 1.532). However, the npN category was superior to the pN category by Harrell's C statistic. We conclude that it is thus feasible to consider TDs as positive lymph nodes in the pN category when evaluating the prognoses of CRC patients, and the npN category is potentially superior to the TNM (7th edition) pN category for predicting DFS and OS among advanced CRC patients.

  16. Biofilm-specific extracellular matrix proteins of non-typeable Haemophilus influenzae

    Science.gov (United States)

    Wu, Siva; Baum, Marc M.; Kerwin, James; Guerrero-Given, Debbie; Webster, Simon; Schaudinn, Christoph; VanderVelde, David; Webster, Paul

    2014-01-01

    Non-typeable Haemophilus influenzae (NTHi), a human respiratory tract pathogen can form colony biofilms in vitro. Bacterial cells and the amorphous extracellular matrix (ECM) constituting the biofilm can be separated using sonication. The ECM from 24 hr and 96 hr NTHi biofilms contained polysaccharides and proteinaceous components as detected by NMR and FTIR spectroscopy. More conventional chemical assays on the biofilm ECM confirmed the presence of these components and also DNA. Proteomics revealed eighteen proteins present in biofilm ECM that were not detected in planktonic bacteria. One ECM protein was unique to 24 hr biofilms, two were found only in 96 hr biofilms, and fifteen were present in the ECM of both 24 hr and 96 hr NTHi biofilms. All proteins identified were either associated with bacterial membranes or were cytoplasmic proteins. Immunocytochemistry showed two of the identified proteins, a DNA-directed RNA polymerase and the outer membrane protein OMP P2, associated with bacteria and biofilm ECM. Identification of biofilm-specific proteins present in immature biofilms is an important step in understanding the in vitro process of NTHi biofilm formation. The presence of a cytoplasmic protein and a membrane protein in the biofilm ECM of immature NTHi biofilms suggests that bacterial cell lysis may be a feature of early biofilm formation. PMID:24942343

  17. Nitrogen recycling through the gut and the nitrogen economy of ruminants: an asynchronous symbiosis.

    Science.gov (United States)

    Reynolds, C K; Kristensen, N B

    2008-04-01

    The extensive development of the ruminant forestomach sets apart their N economy from that of nonruminants in a number of respects. Extensive pregastric fermentation alters the profile of protein reaching the small intestine, largely through the transformation of nitrogenous compounds into microbial protein. This process is fueled primarily by carbohydrate fermentation and includes extensive recycling of N between the body and gut lumen pools. Nitrogen recycling occurs via blood and gut lumen exchanges of urea and NH(3), as well as endogenous gut and secretory N entry into the gut lumen, and the subsequent digestion and absorption of microbial and endogenous protein. Factors controlling urea transfer to the gut from blood, including the contributions of urea transporters, remain equivocal. Ammonia produced by microbial degradation of urea and dietary and endogenous AA is utilized by microbial fermentation or absorbed and primarily converted to urea. Therefore, microbial growth and carbohydrate fermentation affect the extent of NH(3) absorption and urea N recycling and excretion. The extensive recycling of N to the rumen represents an evolutionary advantage of the ruminant in terms of absorbable protein supply during periods of dietary protein deficiency, or asynchronous carbohydrate and protein supply, but incurs a cost of greater N intakes, especially in terms of excess N excretion. Efforts to improve the efficiency of N utilization in ruminants by synchronizing fermentable energy and N availability have generally met with limited success with regards to production responses. In contrast, imposing asynchrony through oscillating dietary protein concentration, or infrequent supplementation, surprisingly has not negatively affected production responses unless the frequency of supplementation is less than once every 3 d. In some cases, oscillation of dietary protein concentration has improved N retention compared with animals fed an equal amount of dietary protein on

  18. Trifluoperazine inhibits acetaminophen-induced hepatotoxicity and hepatic reactive nitrogen formation in mice and in freshly isolated hepatocytes

    Directory of Open Access Journals (Sweden)

    Sudip Banerjee

    Full Text Available The hepatotoxicity of acetaminophen (APAP occurs by initial metabolism to N-acetyl-p-benzoquinone imine which depletes GSH and forms APAP-protein adducts. Subsequently, the reactive nitrogen species peroxynitrite is formed from nitric oxide (NO and superoxide leading to 3-nitrotyrosine in proteins. Toxicity occurs with inhibited mitochondrial function. We previously reported that in hepatocytes the nNOS (NOS1 inhibitor NANT inhibited APAP toxicity, reactive nitrogen and oxygen species formation, and mitochondrial dysfunction. In this work we examined the effect of trifluoperazine (TFP, a calmodulin antagonist that inhibits calcium induced nNOS activation, on APAP hepatotoxicity and reactive nitrogen formation in murine hepatocytes and in vivo. In freshly isolated hepatocytes TFP inhibited APAP induced toxicity, reactive nitrogen formation (NO, GSNO, and 3-nitrotyrosine in protein, reactive oxygen formation (superoxide, loss of mitochondrial membrane potential, decreased ATP production, decreased oxygen consumption rate, and increased NADH accumulation. TFP did not alter APAP induced GSH depletion in the hepatocytes or the formation of APAP protein adducts which indicated that reactive metabolite formation was not inhibited. Since we previously reported that TFP inhibits the hepatotoxicity of APAP in mice without altering hepatic APAP-protein adduct formation, we examined the APAP treated mouse livers for evidence of reactive nitrogen formation. 3-Nitrotyrosine in hepatic proteins and GSNO were significantly increased in APAP treated mouse livers and decreased in the livers of mice treated with APAP plus TFP. These data are consistent with a hypothesis that APAP hepatotoxicity occurs with altered calcium metabolism, activation of nNOS leading to increased reactive nitrogen formation, and mitochondrial dysfunction. Keywords: Acetaminophen, Neuronal nitric oxide, Oxidative stress, Mitochondria

  19. Molecular aspects of the nitrogen fixing system in pea root nodules

    International Nuclear Information System (INIS)

    Bisseling, T.

    1980-01-01

    The author considers symbiotic nitrogen fixation of Pisum sativum and Rhizobium leguminosarum. Some general aspects of nodule formation and the regulation of the proteins nitrogenase and leghemoglobin (Lb) have been studied. Synthesis of these proteins was studied by 35 SO 4 labelling of intact pea plants. The sequence of appearance of the proteins was determined with specific radioimmunoassays for each protein. (Auth.)

  20. QQS orphan gene regulates carbon and nitrogen partitioning across species via NF-YC interactions.

    Science.gov (United States)

    Li, Ling; Zheng, Wenguang; Zhu, Yanbing; Ye, Huaxun; Tang, Buyun; Arendsee, Zebulun W; Jones, Dallas; Li, Ruoran; Ortiz, Diego; Zhao, Xuefeng; Du, Chuanlong; Nettleton, Dan; Scott, M Paul; Salas-Fernandez, Maria G; Yin, Yanhai; Wurtele, Eve Syrkin

    2015-11-24

    The allocation of carbon and nitrogen resources to the synthesis of plant proteins, carbohydrates, and lipids is complex and under the control of many genes; much remains to be understood about this process. QQS (Qua-Quine Starch; At3g30720), an orphan gene unique to Arabidopsis thaliana, regulates metabolic processes affecting carbon and nitrogen partitioning among proteins and carbohydrates, modulating leaf and seed composition in Arabidopsis and soybean. Here the universality of QQS function in modulating carbon and nitrogen allocation is exemplified by a series of transgenic experiments. We show that ectopic expression of QQS increases soybean protein independent of the genetic background and original protein content of the cultivar. Furthermore, transgenic QQS expression increases the protein content of maize, a C4 species (a species that uses 4-carbon photosynthesis), and rice, a protein-poor agronomic crop, both highly divergent from Arabidopsis. We determine that QQS protein binds to the transcriptional regulator AtNF-YC4 (Arabidopsis nuclear factor Y, subunit C4). Overexpression of AtNF-YC4 in Arabidopsis mimics the QQS-overexpression phenotype, increasing protein and decreasing starch levels. NF-YC, a component of the NF-Y complex, is conserved across eukaryotes. The NF-YC4 homologs of soybean, rice, and maize also bind to QQS, which provides an explanation of how QQS can act in species where it does not occur endogenously. These findings are, to our knowledge, the first insight into the mechanism of action of QQS in modulating carbon and nitrogen allocation across species. They have major implications for the emergence and function of orphan genes, and identify a nontransgenic strategy for modulating protein levels in crop species, a trait of great agronomic significance.

  1. Agricultural non-point source pollution management in a reservoir watershed based on ecological network analysis of soil nitrogen cycling.

    Science.gov (United States)

    Xu, Wen; Cai, Yanpeng; Rong, Qiangqiang; Yang, Zhifeng; Li, Chunhui; Wang, Xuan

    2018-03-01

    The Miyun Reservoir plays a pivotal role in providing drinking water for the city of Beijing. In this research, ecological network analysis and scenario analysis were integrated to explore soil nitrogen cycling of chestnut and Chinese pine forests in the upper basin of the Miyun Reservoir, as well as to seek favorable fertilization modes to reduce agricultural non-point source pollution. Ecological network analysis results showed that (1) the turnover time was 0.04 to 0.37 year in the NH 4 + compartment and were 15.78 to 138.36 years in the organic N compartment; (2) the Finn cycling index and the ratio of indirect to direct flow were 0.73 and 11.92 for the chestnut forest model, respectively. Those of the Chinese pine forest model were 0.88 and 29.23, respectively; and (3) in the chestnut forest model, NO 3 - accounted for 96% of the total soil nitrogen loss, followed by plant N (2%), NH 4 + (1%), and organic N (1%). In the Chinese pine forest, NH 4 + accounted for 56% of the total soil nitrogen loss, followed by organic N (34%) and NO 3 - (10%). Fertilization mode was identified as the main factor affecting soil N export. To minimize NH 4 + and NO 3 - outputs while maintaining the current plant yield (i.e., 7.85e0 kg N/year), a fertilization mode of 162.50 kg N/year offered by manure should be adopted. Whereas, to achieve a maximum plant yield (i.e., 3.35e1 kg N/year) while reducing NH 4 + and NO 3 - outputs, a fertilization mode of 325.00 kg N/year offered by manure should be utilized. This research is of wide suitability to support agricultural non-point source pollution management at the watershed scale.

  2. Nitrogen detected TROSY at high field yields high resolution and sensitivity for protein NMR

    Energy Technology Data Exchange (ETDEWEB)

    Takeuchi, Koh [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan); Arthanari, Haribabu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States); Shimada, Ichio, E-mail: shimada@iw-nmr.f.u-tokyo.ac.jp [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan); Wagner, Gerhard, E-mail: gerhard-wagner@hms.harvard.edu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States)

    2015-12-15

    Detection of {sup 15}N in multidimensional NMR experiments of proteins has sparsely been utilized because of the low gyromagnetic ratio (γ) of nitrogen and the presumed low sensitivity of such experiments. Here we show that selecting the TROSY components of proton-attached {sup 15}N nuclei (TROSY {sup 15}N{sub H}) yields high quality spectra in high field magnets (>600 MHz) by taking advantage of the slow {sup 15}N transverse relaxation and compensating for the inherently low {sup 15}N sensitivity. The {sup 15}N TROSY transverse relaxation rates increase modestly with molecular weight but the TROSY gain in peak heights depends strongly on the magnetic field strength. Theoretical simulations predict that the narrowest line width for the TROSY {sup 15}N{sub H} component can be obtained at 900 MHz, but sensitivity reaches its maximum around 1.2 GHz. Based on these considerations, a {sup 15}N-detected 2D {sup 1}H–{sup 15}N TROSY-HSQC ({sup 15}N-detected TROSY-HSQC) experiment was developed and high-quality 2D spectra were recorded at 800 MHz in 2 h for 1 mM maltose-binding protein at 278 K (τ{sub c} ∼ 40 ns). Unlike for {sup 1}H detected TROSY, deuteration is not mandatory to benefit {sup 15}N detected TROSY due to reduced dipolar broadening, which facilitates studies of proteins that cannot be deuterated, especially in cases where production requires eukaryotic expression systems. The option of recording {sup 15}N TROSY of proteins expressed in H{sub 2}O media also alleviates the problem of incomplete amide proton back exchange, which often hampers the detection of amide groups in the core of large molecular weight proteins that are expressed in D{sub 2}O culture media and cannot be refolded for amide back exchange. These results illustrate the potential of {sup 15}N{sub H}-detected TROSY experiments as a means to exploit the high resolution offered by high field magnets near and above 1 GHz.

  3. Towards understanding the nitrogen signal transduction for nif gene expression in Klebsiella pneumoniae.

    Science.gov (United States)

    Glöer, Jens; Thummer, Robert; Ullrich, Heike; Schmitz, Ruth A

    2008-12-01

    In the diazotroph Klebsiella pneumoniae, the nitrogen sensory protein GlnK mediates the cellular nitrogen status towards the NifL/NifA system that regulates transcription of the nitrogen fixation genes in response to ammonium and molecular oxygen. To identify amino acids of GlnK essential for this signal transduction by protein-protein interaction, we performed random point mutagenesis by PCR amplification under conditions of reduced Taq polymerase fidelity. Three thousand two hundred mutated glnK genes were screened to identify those that would no longer complement a K. pneumoniaeDeltaglnK strain for growth under nitrogen fixing conditions. Twenty-four candidates resulting in a Nif(-) phenotype were identified, carrying 1-11 amino acid changes in GlnK. Based on these findings, as well as structural data, several single mutations were introduced into glnK by site-directed mutagenesis, and the Nif phenotype and the respective effects on NifA-mediated nif gene induction was monitored in K. pneumoniae using a chromosomal nifK'-'lacZ fusion. Single amino acid changes resulting in significant nif gene inhibition under nitrogen limiting conditions were located within the highly conserved T-loop (A43G, A49T and N54D), the body of the protein (G87V and K79E) and in the C-terminal region (I100M, R103S, E106Q and D108G). Complex formation analyses between GlnK (wild-type or derivatives) and NifL or NifA in response to 2-oxoglutarate indicated that: (a) besides the T-loop, the C-terminal region of GlnK is essential for the interaction with NifL and NifA and (b) GlnK binds both proteins in the absence of 2-oxoglutarate, whereas, in the presence of 2-oxoglutarate, NifA is released but NifL remains bound to GlnK.

  4. (Methyl)ammonium Transport in the Nitrogen-Fixing Bacterium Azospirillum brasilense

    Science.gov (United States)

    Van Dommelen, Anne; Keijers, Veerle; Vanderleyden, Jos; de Zamaroczy, Miklos

    1998-01-01

    An ammonium transporter of Azospirillum brasilense was characterized. In contrast to most previously reported putative prokaryotic NH4+ transporter genes, A. brasilense amtB is not part of an operon with glnB or glnZ which, in A. brasilense, encode nitrogen regulatory proteins PII and PZ, respectively. Sequence analysis predicts the presence of 12 transmembrane domains in the deduced AmtB protein and classifies AmtB as an integral membrane protein. Nitrogen regulates the transcription of the amtB gene in A. brasilense by the Ntr system. amtB is the first gene identified in A. brasilense whose expression is regulated by NtrC. The observation that ammonium uptake is still possible in mutants lacking the AmtB protein suggests the presence of a second NH4+ transport mechanism. Growth of amtB mutants at low ammonium concentrations is reduced compared to that of the wild type. This suggests that AmtB has a role in scavenging ammonium at low concentrations. PMID:9573149

  5. Kinetics of Nif gene expression in a nitrogen-fixing bacterium.

    Science.gov (United States)

    Poza-Carrión, César; Jiménez-Vicente, Emilio; Navarro-Rodríguez, Mónica; Echavarri-Erasun, Carlos; Rubio, Luis M

    2014-02-01

    Nitrogen fixation is a tightly regulated trait. Switching from N2 fixation-repressing conditions to the N2-fixing state is carefully controlled in diazotrophic bacteria mainly because of the high energy demand that it imposes. By using quantitative real-time PCR and quantitative immunoblotting, we show here how nitrogen fixation (nif) gene expression develops in Azotobacter vinelandii upon derepression. Transient expression of the transcriptional activator-encoding gene, nifA, was followed by subsequent, longer-duration waves of expression of the nitrogenase biosynthetic and structural genes. Importantly, expression timing, expression levels, and NifA dependence varied greatly among the nif operons. Moreover, the exact concentrations of Nif proteins and their changes over time were determined for the first time. Nif protein concentrations were exquisitely balanced, with FeMo cofactor biosynthetic proteins accumulating at levels 50- to 100-fold lower than those of the structural proteins. Mutants lacking nitrogenase structural genes or impaired in FeMo cofactor biosynthesis showed overenhanced responses to derepression that were proportional to the degree of nitrogenase activity impairment, consistent with the existence of at least two negative-feedback regulatory mechanisms. The first such mechanism responded to the levels of fixed nitrogen, whereas the second mechanism appeared to respond to the levels of the mature NifDK component. Altogether, these findings provide a framework to engineer N2 fixation in nondiazotrophs.

  6. Estimate of symbiotically fixed nitrogen in field grown soybeans using variations in 15N natural abundance

    International Nuclear Information System (INIS)

    Amarger, N.; Durr, J.C.; Bourguignon, C.; Lagacherie, B.; Mariotti, A.; Mariotti, F.

    1979-01-01

    The use of variations in natural abundance of 15 N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower 15 N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C 2 H 2 reduction assay over the growing season. Estimates given by the 15 N measurements were correlated with the C 2 H 2 reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural 15 N abundance should be reliable. The absence of correlation between estimates based on 15 N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans. (Auth.)

  7. Genetic variation shapes protein networks mainly through non-transcriptional mechanisms.

    Directory of Open Access Journals (Sweden)

    Eric J Foss

    2011-09-01

    Full Text Available Networks of co-regulated transcripts in genetically diverse populations have been studied extensively, but little is known about the degree to which these networks cause similar co-variation at the protein level. We quantified 354 proteins in a genetically diverse population of yeast segregants, which allowed for the first time construction of a coherent protein co-variation matrix. We identified tightly co-regulated groups of 36 and 93 proteins that were made up predominantly of genes involved in ribosome biogenesis and amino acid metabolism, respectively. Even though the ribosomal genes were tightly co-regulated at both the protein and transcript levels, genetic regulation of proteins was entirely distinct from that of transcripts, and almost no genes in this network showed a significant correlation between protein and transcript levels. This result calls into question the widely held belief that in yeast, as opposed to higher eukaryotes, ribosomal protein levels are regulated primarily by regulating transcript levels. Furthermore, although genetic regulation of the amino acid network was more similar for proteins and transcripts, regression analysis demonstrated that even here, proteins vary predominantly as a result of non-transcriptional variation. We also found that cis regulation, which is common in the transcriptome, is rare at the level of the proteome. We conclude that most inter-individual variation in levels of these particular high abundance proteins in this genetically diverse population is not caused by variation of their underlying transcripts.

  8. RNA interference can rebalance the nitrogen sink of maize seeds without losing hard endosperm.

    Directory of Open Access Journals (Sweden)

    Yongrui Wu

    Full Text Available BACKGROUND: One of the goals of plant breeding is to create crops to provide better nutrition for humans and livestock. Insufficient intake of protein is one of the most severe factors affecting the growth and development of children in developing countries. More than a century ago, in 1896, Hopkins initiated the well-known Illinois long-term selection for maize seed protein concentration, yielding four protein strains. By continuously accumulating QTLs, Illinois High Protein (IHP reached a protein level 2.5-fold higher than normal maize, with the most increased fraction being the zein protein, which was shown to contain no lysine soon after the long-term selection program initiated. Therefore, IHP is of little value for feeding humans and monogastric animals. Although high-lysine lines of non-vitreous mutants were based on reduced zeins, the kernel soft texture precluded their practical use. Kernel hardness in opaque 2 (o2 could be restored in quality protein maize (QPM with quantitative trait loci called o2 modifiers (Mo2s, but those did not increase total protein levels. METHODS: The most predominant zeins are the 22- and 19-kDa α-zeins. To achieve a combination of desired traits, we used RNA interference (RNAi against both α-zeins in IHP and evaluated the silencing effect by SDS-PAGE. Total protein, amino acid composition and kernel texture were analyzed. CONCLUSIONS: The α-zeins were dramatically reduced, but the high total seed protein level remained unchanged by complementary increase of non-zein proteins. Moreover, the residual zein levels still allowed for a vitreous hard seed. Such dramatic rebalancing of the nitrogen sink could have a major impact in world food supply.

  9. Implications of selection in common bean lines in contrasting environments concerning nitrogen levels

    Directory of Open Access Journals (Sweden)

    Isabela Volpi Furtini

    2014-10-01

    Full Text Available Grain productivities of 100 bean lines were evaluated in the presence and absence of nitrogen fertilizer in order to identify those with high nitrogen use efficiency (NUE and to determine the correlated response observed in a stressed environment following selection in a non-stressed environment. The genetic and phenotypic characteristics of the lines, as well as the response index to applied nitrogen, were determined. The average grain productivities at both locations were 39.5% higher in the presence of nitrogen fertilizer, with 8.3 kg of grain being produced per kg of nitrogen applied. NUE varied greatly between lines. Lines BP-16, CVII-85-11, BP-24, Ouro Negro and MA-IV-15-203 were the most efficient and responsive. The results showed that it is possible to select bean lines in stressed and non-stressed environments. It was inferred that common bean lines for environments with low nitrogen availability should preferably be selected under nitrogen stress.

  10. IMPROVING NITROGEN FERTILIZER ABSORPTION AND ITS EFFECT ON QUALITY AND SEED YIELD OF CORN (Zea mays

    Directory of Open Access Journals (Sweden)

    Kuswanto

    2013-06-01

    Full Text Available Improving nitrogen uptake by pyraclostrobin application in maize under green house and field conditions were investigated. There were three series experiments conducted in dry season, 2011 and 2012. The research conducted using nested design and three replications. Nested design applied to get information as careful as possible about the role of treatment, especially the main factor. The first and second experiments hold at field and green house and the third experiment hold at green house. They had two factors, pyraclostrobin application and nitrogen fertilizer. Vegetative growth, flowering and earing age, chlorophyll content, yield, amylose and protein content evaluated. Application of pyraclostrobin, significantly increase nitrogen fertilizer efficiency. Amylose content and fresh yield were different on nitrogen and pyraclostrobin application. Application of pyraclostrobin 400 ml/ha significantly increase amylose 10.85-18.5%. Both of amylose and protein content were increased by nitrogen fertilizer application. Vegetative growth and chlorophyll content were affected by nitrogen and pyraclostrobin.

  11. Ammonia Nitrogen Added to Diets Deficient in Dispensable Amino Acid Nitrogen Is Poorly Utilized for Urea Production in Growing Pigs.

    Science.gov (United States)

    Mansilla, Wilfredo D; Silva, Kayla E; Zhu, Cuilan L; Nyachoti, Charles M; Htoo, John K; Cant, John P; de Lange, Cornelis Fm

    2017-12-01

    Background: Including ammonia in low-crude protein (CP) diets deficient in dispensable amino acid (DAAs) increases nitrogen retention in growing pigs. Objective: We investigated the absorption and metabolism of dietary ammonia nitrogen in the portal-drained viscera (PDV) and liver of pigs fed a diet deficient in DAA nitrogen. Methods: Eight pigs with an initial mean ± SD body weight (BW) of 26.5 ± 1.4 kg were surgically fitted with 4 catheters each (portal, hepatic and mesenteric veins, and carotid artery). The pigs were fed (2.8 × 191 kcal/kg BW 0.60 ), for 7 d and every 8 h, a diet deficient in DAA nitrogen supplemented with increasing amounts of ammonia nitrogen (CP: 7.76%, 9.27%, and 10.77%; indispensable amino acid nitrogen:total nitrogen ratio: 0.71, 0.59, and 0.50 for control and low- and high-ammonia diets, respectively). The treatment sequence was based on a Latin square design with 3 consecutive periods. On the last day of each period, blood flows in the portal and hepatic veins were determined with a continuous infusion of ρ-amino hippuric acid into the mesenteric vein. Serial blood samples were taken to determine ammonia and urea nitrogen concentration. Net balances of ammonia and urea nitrogen were calculated for the PDV and liver. Results: Cumulative (8 h) ammonia nitrogen appearance in the portal vein increased ( P ≤ 0.05) with ammonia intake (433, 958, and 1629 ± 60 mg ammonia nitrogen/meal for control and low- and high-ammonia diets, respectively). The cumulative hepatic uptake of ammonia nitrogen increased ( P ≤ 0.05) with ammonia nitrogen supply. The cumulative urea nitrogen appearance in the hepatic vein tended to increase ( P ≤ 0.10) only in high-ammonia treatment (-92.5, -59.4, and 209.7 ± 92 mg urea nitrogen/meal for control and low- and high-ammonia diets, respectively) and, relative to the control diet, represented -6.0% and 11% of ammonia nitrogen intake. Conclusion: Dietary ammonia nitrogen is poorly utilized for urea

  12. Protein requirements of finishing paca (Cuniculus paca).

    Science.gov (United States)

    Nogueira-Filho, Sérgio Luiz Gama; Bastos, Ivanise da Hora; Mendes, Alcester; Nogueira, Selene Siqueira da Cunha

    2016-06-01

    We conducted a nitrogen balance digestion trial to determine the crude protein requirements of paca (Cuniculus paca) during the last growth phase. In a 4 × 4 Latin square design, four young captive male pacas, aged 5 months, were fed four isoenergetic diets containing four different levels of nitrogen (N) (11.3, 16.6, 21.4, and 26.6 g N/kg of dry matter). After 15 days of adaptation, we collected all feces and urine for five consecutive days. By regression analysis between N intake and N in feces and urine, the metabolic fecal nitrogen (MFN = 4.2 g/kg of dry matter intake) and daily endogenous urinary N (EUN = 91.6 mg/kg(0.75)) were determined. Likewise, by regression analyses between nitrogen intake and nitrogen retention [NR = N intake-(fecal N + urine N)], we estimated the daily requirement of 280.5 mg N/kg(0.75). Therefore, a minimum of 55 g crude protein per kilogram dry matter and 13 MJ/kg of digestible energy are required by finishing paca on unrestricted diets. Such values are similar to those of other wild frugivores and below those of growing rabbits. The data confirm that farmers overfeed protein, and similar growth can be more economically achieved on lower protein diets.

  13. Studies with nitrogen-15-labelled amino acids for a quantitative description of nitrogen metabolism in man

    International Nuclear Information System (INIS)

    Hartig, W.; Faust, H.; Czarnetzki, H.D.; Winkler, E.; Akademie der Wissenschaften der DDR, Leipzig. Zentralinstitut fuer Isotopen- und Strahlenforschung)

    1977-01-01

    The utilization of glycine in healthy and stressed persons has been studied by continuous infusion or oral administration. The results of our studies show that (1) Breakdown of protein is increased in stress conditions; (2) Amino acids are also synthesized to protein in stress, the percentage of amino acids used for synthesis being smaller in stress conditions; (3) The urea synthesis during stress is increased and accelerated; (4) In the isotopic steady state 23% of the 15 N-glycine administered by infusion to healthy persons and 41% of the amount administered to patients after cholecystectomy is eliminated (urea 16%/26%; ammonia 4%/5%); using a single oral dose 24% is eliminated as total N after 24h (19% as 15 N-urea and 4% as 15 N-ammonia); (5) Depending on the method of gastric surgery the absorption and elimination rate of glycine-N varied; the more rapid intestinal absorption of glycine in comparison with healthy persons leads to a higher 15 N elimination via urine, and causes a disturbance of the nitrogen metabolism and nitrogen balance. (author)

  14. Mineral commodity profiles: nitrogen

    Science.gov (United States)

    Kramer, Deborah A.

    2004-01-01

    Overview -- Nitrogen (N) is an essential element of life and a part of all animal and plant proteins. As a part of the DNA and RNA molecules, nitrogen is an essential constituent of each individual's genetic blueprint. As an essential element in the chlorophyll molecule, nitrogen is vital to a plant's ability to photosynthesize. Some crop plants, such as alfalfa, peas, peanuts, and soybeans, can convert atmospheric nitrogen into a usable form by a process referred to as 'fixation.' Most of the nitrogen that is available for crop production, however, comes from decomposing animal and plant waste or from commercially produced fertilizers. Commercial fertilizers contain nitrogen in the form of ammonium and/or nitrate or in a form that is quickly converted to the ammonium or nitrate form once the fertilizer is applied to the soil. Ammonia is generally the source of nitrogen in fertilizers. Anhydrous ammonia is commercially produced by reacting nitrogen with hydrogen under high temperatures and pressures. The source of nitrogen is the atmosphere, which is almost 80 percent nitrogen. Hydrogen is derived from a variety of raw materials, which include water, and crude oil, coal, and natural gas hydrocarbons. Nitrogen-based fertilizers are produced from ammonia feedstocks through a variety of chemical processes. Small quantities of nitrates are produced from mineral resources principally in Chile. In 2002, anhydrous ammonia and other nitrogen materials were produced in more than 70 countries. Global ammonia production was 108 million metric tons (Mt) of contained nitrogen. With 28 percent of this total, China was the largest producer of ammonia. Asia contributed 46 percent of total world ammonia production, and countries of the former U.S.S.R. represented 13 percent. North America also produced 13 percent of the total; Western Europe, 9 percent; the Middle East, 7 percent; Central America and South America, 5 percent; Eastern Europe, 3 percent; and Africa and Oceania

  15. Hominoid-specific de novo protein-coding genes originating from long non-coding RNAs.

    Directory of Open Access Journals (Sweden)

    Chen Xie

    2012-09-01

    Full Text Available Tinkering with pre-existing genes has long been known as a major way to create new genes. Recently, however, motherless protein-coding genes have been found to have emerged de novo from ancestral non-coding DNAs. How these genes originated is not well addressed to date. Here we identified 24 hominoid-specific de novo protein-coding genes with precise origination timing in vertebrate phylogeny. Strand-specific RNA-Seq analyses were performed in five rhesus macaque tissues (liver, prefrontal cortex, skeletal muscle, adipose, and testis, which were then integrated with public transcriptome data from human, chimpanzee, and rhesus macaque. On the basis of comparing the RNA expression profiles in the three species, we found that most of the hominoid-specific de novo protein-coding genes encoded polyadenylated non-coding RNAs in rhesus macaque or chimpanzee with a similar transcript structure and correlated tissue expression profile. According to the rule of parsimony, the majority of these hominoid-specific de novo protein-coding genes appear to have acquired a regulated transcript structure and expression profile before acquiring coding potential. Interestingly, although the expression profile was largely correlated, the coding genes in human often showed higher transcriptional abundance than their non-coding counterparts in rhesus macaque. The major findings we report in this manuscript are robust and insensitive to the parameters used in the identification and analysis of de novo genes. Our results suggest that at least a portion of long non-coding RNAs, especially those with active and regulated transcription, may serve as a birth pool for protein-coding genes, which are then further optimized at the transcriptional level.

  16. Effect of different nitrogen sources on growth, yield and quality of fodder maize (Zea mays L.

    Directory of Open Access Journals (Sweden)

    Mohamed El-Murtada Hassan Amin

    2011-01-01

    The present data revealed that, the crude protein and crude fiber were significantly affected by nitrogen sources in both seasons. The urea gave the lowest crude protein compared with the other nitrogen sources. On the other hand, the lowest crude fiber content was recorded when plant was treated with (ASN fertilizer, while the highest crude fiber content was recorded only under the control.

  17. Protective effect of a non specific inflammation on bone marrow protein synthesis in irradiated mice

    International Nuclear Information System (INIS)

    Herodin, F.; Roques, P.; Court, L.

    1988-01-01

    Gamma radiations exert a decrease in mouse bone marrow total protein synthesis. A non-specific inflammatory process induced with polyacrylamide microbeads stimulates spleen and marrow protein synthesis and protects the medullar protein synthesis in irradiated mice [fr

  18. Environmental and economic evaluation of selective non-catalytic reduction of nitrogen oxides

    Science.gov (United States)

    Parchevskii, V. M.; Shchederkina, T. E.; Proshina, A. O.

    2017-11-01

    There are two groups of atmosphere protecting measures: technology (primary) and treatment (secondary). When burning high-calorie low-volatile brands of coals in the furnaces with liquid slag removal to achieve emission standards required joint use of these two methods, for example, staged combustion and selective non-catalytic reduction recovery (SNCR). For the economically intelligent combination of these two methods it is necessary to have information not only about the environmental performance of each method, but also the operating costs per unit of reduced emission. The authors of this report are made an environmental-economic analysis of SNCR on boiler Π-50P Kashirskaya power station. The obtained results about the dependence of costs from the load of the boiler and the mass emissions of nitrogen oxides then approximates into empirical formulas, is named as environmental and economic characteristics, which is suitable for downloading into controllers and other control devices for subsequent implementation of optimal control of emissions to ensure compliance with environmental regulations at the lowest cost at any load of the boiler.

  19. Innate Immune Evasion Mediated by Flaviviridae Non-Structural Proteins.

    Science.gov (United States)

    Chen, Shun; Wu, Zhen; Wang, Mingshu; Cheng, Anchun

    2017-10-07

    Flaviviridae-caused diseases are a critical, emerging public health problem worldwide. Flaviviridae infections usually cause severe, acute or chronic diseases, such as liver damage and liver cancer resulting from a hepatitis C virus (HCV) infection and high fever and shock caused by yellow fever. Many researchers worldwide are investigating the mechanisms by which Flaviviridae cause severe diseases. Flaviviridae can interfere with the host's innate immunity to achieve their purpose of proliferation. For instance, dengue virus (DENV) NS2A, NS2B3, NS4A, NS4B and NS5; HCV NS2, NS3, NS3/4A, NS4B and NS5A; and West Nile virus (WNV) NS1 and NS4B proteins are involved in immune evasion. This review discusses the interplay between viral non-structural Flaviviridae proteins and relevant host proteins, which leads to the suppression of the host's innate antiviral immunity.

  20. Heavily nitrogen doped, graphene supercapacitor from silk cocoon

    International Nuclear Information System (INIS)

    Sahu, Vikrant; Grover, Sonia; Tulachan, Brindan; Sharma, Meenakshi; Srivastava, Gaurav; Roy, Manas; Saxena, Manav; Sethy, Niroj; Bhargava, Kalpana; Philip, Deepu; Kim, Hansung; Singh, Gurmeet; Singh, Sushil Kumar; Das, Mainak; Sharma, Raj Kishore

    2015-01-01

    Doping of graphene with nitrogen is of much interest, since it improves the overall conductivity and supercapacitive properties. Besides conductivity, nitrogen doping also enhances the pseudo-capacitance due to fast and reversible surface redox processes. In this work, we have developed a cheap and easy process for synthesizing heavily nitrogen doped graphene (15% nitrogen) from non-mulberry silk cocoon membrane (Tassar, Antheraea mylitta) by pyrolyzing the cocoon at 400 °C in argon atmosphere. Further we have investigated the performance of this heavily ‘nitrogen doped graphene’ (NDG) in a supercapacitor device. Our results suggest that NDG obtained from cocoon has improved supercapacitor performance. The improved performance is due to the high electronegativity of nitrogen that forms dipoles on the graphene surface. These dipoles consequently enhance the tendency of graphene to attract charged species to its surface. This is a green and clean synthesis approach for developing electronic materials for energy applications

  1. Bluetongue virus non-structural protein 1 is a positive regulator of viral protein synthesis

    Directory of Open Access Journals (Sweden)

    Boyce Mark

    2012-08-01

    Full Text Available Abstract Background Bluetongue virus (BTV is a double-stranded RNA (dsRNA virus of the Reoviridae family, which encodes its genes in ten linear dsRNA segments. BTV mRNAs are synthesised by the viral RNA-dependent RNA polymerase (RdRp as exact plus sense copies of the genome segments. Infection of mammalian cells with BTV rapidly replaces cellular protein synthesis with viral protein synthesis, but the regulation of viral gene expression in the Orbivirus genus has not been investigated. Results Using an mRNA reporter system based on genome segment 10 of BTV fused with GFP we identify the protein characteristic of this genus, non-structural protein 1 (NS1 as sufficient to upregulate translation. The wider applicability of this phenomenon among the viral genes is demonstrated using the untranslated regions (UTRs of BTV genome segments flanking the quantifiable Renilla luciferase ORF in chimeric mRNAs. The UTRs of viral mRNAs are shown to be determinants of the amount of protein synthesised, with the pre-expression of NS1 increasing the quantity in each case. The increased expression induced by pre-expression of NS1 is confirmed in virus infected cells by generating a replicating virus which expresses the reporter fused with genome segment 10, using reverse genetics. Moreover, NS1-mediated upregulation of expression is restricted to mRNAs which lack the cellular 3′ poly(A sequence identifying the 3′ end as a necessary determinant in specifically increasing the translation of viral mRNA in the presence of cellular mRNA. Conclusions NS1 is identified as a positive regulator of viral protein synthesis. We propose a model of translational regulation where NS1 upregulates the synthesis of viral proteins, including itself, and creates a positive feedback loop of NS1 expression, which rapidly increases the expression of all the viral proteins. The efficient translation of viral reporter mRNAs among cellular mRNAs can account for the observed

  2. Bluetongue virus non-structural protein 1 is a positive regulator of viral protein synthesis.

    Science.gov (United States)

    Boyce, Mark; Celma, Cristina C P; Roy, Polly

    2012-08-29

    Bluetongue virus (BTV) is a double-stranded RNA (dsRNA) virus of the Reoviridae family, which encodes its genes in ten linear dsRNA segments. BTV mRNAs are synthesised by the viral RNA-dependent RNA polymerase (RdRp) as exact plus sense copies of the genome segments. Infection of mammalian cells with BTV rapidly replaces cellular protein synthesis with viral protein synthesis, but the regulation of viral gene expression in the Orbivirus genus has not been investigated. Using an mRNA reporter system based on genome segment 10 of BTV fused with GFP we identify the protein characteristic of this genus, non-structural protein 1 (NS1) as sufficient to upregulate translation. The wider applicability of this phenomenon among the viral genes is demonstrated using the untranslated regions (UTRs) of BTV genome segments flanking the quantifiable Renilla luciferase ORF in chimeric mRNAs. The UTRs of viral mRNAs are shown to be determinants of the amount of protein synthesised, with the pre-expression of NS1 increasing the quantity in each case. The increased expression induced by pre-expression of NS1 is confirmed in virus infected cells by generating a replicating virus which expresses the reporter fused with genome segment 10, using reverse genetics. Moreover, NS1-mediated upregulation of expression is restricted to mRNAs which lack the cellular 3' poly(A) sequence identifying the 3' end as a necessary determinant in specifically increasing the translation of viral mRNA in the presence of cellular mRNA. NS1 is identified as a positive regulator of viral protein synthesis. We propose a model of translational regulation where NS1 upregulates the synthesis of viral proteins, including itself, and creates a positive feedback loop of NS1 expression, which rapidly increases the expression of all the viral proteins. The efficient translation of viral reporter mRNAs among cellular mRNAs can account for the observed replacement of cellular protein synthesis with viral protein

  3. Influence of irrigation and nitrogen fertilization on grain yield and some baking quality characteristics of spring wheat

    Directory of Open Access Journals (Sweden)

    Paavo Elonen

    1975-05-01

    Full Text Available In the years 1967—70 twelve irrigation experiments of spring wheat were carried out in southern Finland (60-62° N, 22-26° E. Sprinkler irrigation (2 X 30 mm increased the grain yields on an average by 1240±470kg/ha (from 2740 to 3980 kg or 45±17 %. The increases in yield were significant on clay soils (9 trials and loam (1 trial but insignificant on fines and (1 trial and mould (1 trial. Additional nitrogen fertilization (from 76 to 143kg/ha N increased the grain yields on an average by 350± 200 kg/ha or 11±6 %. The ripening of wheat was significantly promoted by irrigation in one year but slightly retarded in three years. Nitrogen fertilization slightly retarded ripening every year The falling number of grains tended to be slightly improved by irrigation (from 285 to 321, on an average, but in most trials irrigation and nitrogen fertilization had no significant influence on the falling number. Irrigation decreased the crude protein content of grains in all trials, on an average by 2.2 ± 0.7 %-units (from 16.3 to 14.1%. This unfavourable effect was, however, avoided with additional nitrogen which increased the protein content by 1.9±0.4%-units (from 14,3 to 16.2 %. The effects of irrigation and nitrogen fertilization on those characteristics of wheat that are correlated with protein, were similar to the effects on the protein content. Thus, irrigation decreased the zeleny value (from 64 to 53 ml, cold viscosity (from 214 to 114 seconds, water absorption (from 66.5 to 64.9 % and the valorimeter value (from 68 to 60, while these characteristics were improved by nitrogen fertilization. Irrigation did not decrease the Pelshenke value but increased significantly the ratio of the Pelshenke value/protein content (from 5,1 to 6.1. This indicates that the quality of protein was improved by irrigation, while the effect of nitrogen fertilization was the reverse. In fact, irrigation and additional nitrogen fertilization affected the quantity and

  4. Assessment of safety and efficiency of nitrogen organic fertilizers from animal-based protein hydrolysates--a laboratory multidisciplinary approach.

    Science.gov (United States)

    Corte, Laura; Dell'abate, Maria Teresa; Magini, Alessandro; Migliore, Melania; Felici, Barbara; Roscini, Luca; Sardella, Roccaldo; Tancini, Brunella; Emiliani, Carla; Cardinali, Gianluigi; Benedetti, Anna

    2014-01-30

    Protein hydrolysates or hydrolysed proteins (HPs) are high-N organic fertilizers allowing the recovery of by-products (leather meal and fluid hydrolysed proteins) otherwise disposed of as polluting wastes, thus enhancing matter and energy conservation in agricultural systems while decreasing potential pollution. Chemical and biological characteristics of HPs of animal origin were analysed in this work to assess their safety, environmental sustainability and agricultural efficacy as fertilizers. Different HPs obtained by thermal, chemical and enzymatic hydrolytic processes were characterized by Fourier transform infrared spectroscopy and sodium dodecyl sulfate polyacrylamide gel electrophoresis, and their safety and efficacy were assessed through bioassays, ecotoxicological tests and soil biochemistry analyses. HPs can be discriminated according to their origin and hydrolysis system by proteomic and metabolomic methods. Three experimental systems, soil microbiota, yeast and plants, were employed to detect possible negative effects exerted by HPs. The results showed that these compounds do not significantly interfere with metabolomic activity or the reproductive system. The absence of toxic and genotoxic effects of the hydrolysates prepared by the three hydrolytic processes suggests that they do not negatively affect eukaryotic cells and soil ecosystems and that they can be used in conventional and organic farming as an important nitrogen source derived from otherwise highly polluting by-products. © 2013 Society of Chemical Industry.

  5. Methods for Using Small Non-Coding RNAs to Improve Recombinant Protein Expression in Mammalian Cells

    Directory of Open Access Journals (Sweden)

    Sarah Inwood

    2018-01-01

    Full Text Available The ability to produce recombinant proteins by utilizing different “cell factories” revolutionized the biotherapeutic and pharmaceutical industry. Chinese hamster ovary (CHO cells are the dominant industrial producer, especially for antibodies. Human embryonic kidney cells (HEK, while not being as widely used as CHO cells, are used where CHO cells are unable to meet the needs for expression, such as growth factors. Therefore, improving recombinant protein expression from mammalian cells is a priority, and continuing effort is being devoted to this topic. Non-coding RNAs are RNA segments that are not translated into a protein and often have a regulatory role. Since their discovery, major progress has been made towards understanding their functions. Non-coding RNA has been investigated extensively in relation to disease, especially cancer, and recently they have also been used as a method for engineering cells to improve their protein expression capability. In this review, we provide information about methods used to identify non-coding RNAs with the potential of improving recombinant protein expression in mammalian cell lines.

  6. Nitrogen-doped graphene: effect of graphite oxide precursors and nitrogen content on the electrochemical sensing properties.

    Science.gov (United States)

    Megawati, Monica; Chua, Chun Kiang; Sofer, Zdenek; Klímová, Kateřina; Pumera, Martin

    2017-06-21

    Graphene, produced via chemical methods, has been widely applied for electrochemical sensing due to its structural and electrochemical properties as well as its ease of production in large quantity. While nitrogen-doped graphenes are widely studied materials, the literature showing an effect of graphene oxide preparation methods on nitrogen quantity and chemical states as well as on defects and, in turn, on electrochemical sensing is non-existent. In this study, the properties of nitrogen-doped graphene materials, prepared via hydrothermal synthesis using graphite oxide produced by various classical methods using permanganate or chlorate oxidants Staudenmaier, Hummers, Hofmann and Brodie oxidation methods, were studied; the resulting nitrogen-doped graphene oxides were labeled as ST-GO, HU-GO, HO-GO and BR-GO, respectively. The electrochemical oxidation of biomolecules, such as ascorbic acid, uric acid, dopamine, nicotinamide adenine nucleotide and DNA free bases, was carried out using cyclic voltammetry and differential pulse voltammetry techniques. The nitrogen content in doped graphene oxides increased in the order ST-GO graphene followed this trend, as shown in the cyclic voltammograms. This is a very important finding that provides insight into the electrocatalytic effect of N-doped graphene. The nitrogen-doped graphene materials exhibited improved sensitivity over bare glassy carbon for ascorbic acid, uric acid and dopamine detection. These studies will enhance our understanding of the effects of graphite oxide precursors on the electrochemical sensing properties of nitrogen-doped graphene materials.

  7. Agronomic Factors Related to the Quality of Wheat for the Starch Industry : Part II, Nitrogen Fertilization and Overall Conclusions

    NARCIS (Netherlands)

    Kelfkens, M.; Hamer, R.J.

    1991-01-01

    In the N.W.-European wheat growing system high levels of nitrogen fertiliser are applied. Especially late nitrogen applications are thought to increase the amount of soluble proteins, leading to extra losses and wastage. On the other hand, protein content is the most important factor determining

  8. Nitrogen use strategies of seedlings from neotropical tree species of distinct successional groups.

    Science.gov (United States)

    Oliveira, Halley Caixeta; da Silva, Ligia Maria Inocêncio; de Freitas, Letícia Dias; Debiasi, Tatiane Viegas; Marchiori, Nidia Mara; Aidar, Marcos Pereira Marinho; Bianchini, Edmilson; Pimenta, José Antonio; Stolf-Moreira, Renata

    2017-05-01

    Few studies have analyzed the strategies of neotropical tree seedlings for absorbing, translocating and assimilating the nitrogen. Here, we compared the nitrogen use strategies of seedlings from six tree species that are native to the Brazilian Atlantic Forest and that belong to different successional groups: Trema micrantha, Heliocarpus popayanensis and Cecropia pachystachya (pioneers), Cariniana estrellensis, Eugenia brasiliensis and Guarea kunthiana (non-pioneers). The effects of cultivating seedlings with nitrate or ammonium on the growth, physiology and nitrogen metabolism were analyzed. Nitrate-grown pioneer species had much higher leaf nitrate reductase activity than non-pioneer ones, but non-pioneer seedlings were also able to use nitrate as a nitrogen source. In addition to this remarkable difference between the groups in the capacity for leaf nitrate assimilation, substantial variations in the nitrogen use strategies were observed within the successional classes. Differently from the other non-pioneers, the canopy species C. estrellensis seemed to assimilate nitrate mainly in the leaves. Morphophysiological analyses showed a gradient of ammonium toxicity response, with E. brasiliensis as the most tolerant species, and T. micrantha and H. popayanensis as the most sensitive ones. Guarea kunthiana showed a relatively low tolerance to ammonium and an unusual high translocation of this cation in the xylem sap. In contrast to the other pioneers, C. pachystachya had a high plasticity in the use of nitrogen sources. Overall, these results suggest that nitrogen use strategies of neotropical tree seedlings were not determined solely by their successional position. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  9. Adsorption properties of BSA and DsRed proteins deposited on thin SiO2 layers: optically non-absorbing versus absorbing proteins

    Science.gov (United States)

    Scarangella, A.; Soumbo, M.; Villeneuve-Faure, C.; Mlayah, A.; Bonafos, C.; Monje, M.-C.; Roques, C.; Makasheva, K.

    2018-03-01

    Protein adsorption on solid surfaces is of interest for many industrial and biomedical applications, where it represents the conditioning step for micro-organism adhesion and biofilm formation. To understand the driving forces of such an interaction we focus in this paper on the investigation of the adsorption of bovine serum albumin (BSA) (optically non-absorbing, model protein) and DsRed (optically absorbing, naturally fluorescent protein) on silica surfaces. Specifically, we propose synthesis of thin protein layers by means of dip coating of the dielectric surface in protein solutions with different concentrations (0.01-5.0 g l-1). We employed spectroscopic ellipsometry as the most suitable and non-destructive technique for evaluation of the protein layers’ thickness and optical properties (refractive index and extinction coefficient) after dehydration, using two different optical models, Cauchy for BSA and Lorentz for DsRed. We demonstrate that the thickness, the optical properties and the wettability of the thin protein layers can be finely controlled by proper tuning of the protein concentration in the solution. These results are correlated with the thin layer morphology, investigated by AFM, FTIR and PL analyses. It is shown that the proteins do not undergo denaturation after dehydration on the silica surface. The proteins arrange themselves in a lace-like network for BSA and in a rod-like structure for DsRed to form mono- and multi-layers, due to different mechanisms driving the organization stage.

  10. Levels of multiple supplements or nitrogen salt for beef heifers in pasture during the dry season

    Directory of Open Access Journals (Sweden)

    Ériton Egidio Lisboa Valente

    2011-09-01

    Full Text Available The study assessed performance, microbial protein synthesis, intake and digestibility of nutrients by beef heifers receiving levels of multiple supplements or nitrogen salt, in a self-controlled intake, on pasture, during the dry season. Thirty-five beef heifers, from 6 to 9 months of age and average initial body weight of 203.4 + 4.5 kg, were used. Study factors were: control - mineral mixture; nitrogen salt - 50% of urea + mineral mixture, at proportion of 1:1, and 50% of corn (75% of crude protein; levels of multiple supplementation - multiple supplements with different percentages of intake controller mixture (urea + mineral mixture, at the proportion of 1:1, corn and soybean meal (45% of crude protein. Supplement consumptions observed were: 115, 173, 572 and 1214 g/animal/day for animals fed on nitrogen salt, low, medium and high levels of multiple supplement, respectively. Supplemented animals had greater average daily gain, evidencing the positive linear effect of the levels of multiple supplementation on average daily gain. Overall, there were no significant differences between average daily gain of animals fed on multiple supplements or nitrogen salt. Supplementation increased the intake and digestibility of nutrients, except for digestibility of neutral detergent fiber, although the intake of digested neutral detergent fiber increased. Supplementation increased the production of microbial nitrogen as well as nitrogen losses in urine, although the quantity of nitrogen assimilated by bacteria, proportionally to intake, was higher. Supplementation improves nutritional parameters and weight gain.

  11. Heat and mass transfer of liquid nitrogen in coal porous media

    Science.gov (United States)

    Lang, Lu; Chengyun, Xin; Xinyu, Liu

    2018-04-01

    Liquid nitrogen has been working as an important medium in fire extinguishing and prevention, due to its efficiency in oxygen exclusion and heat removal. Such a technique is especially crucial for coal industry in China. We built a tunnel model with a temperature monitor system (with 36 thermocouples installed) to experimentally study heat and mass transfer of liquid nitrogen in non-homogeneous coal porous media (CPM), and expected to optimize parameters of liquid nitrogen injection in engineering applications. Results indicate that injection location and amount of liquid nitrogen, together with air leakage, significantly affect temperature distribution in CPM, and non-equilibrium heat inside and outside of coal particles. The injection position of liquid nitrogen determines locations of the lowest CPM temperature and liquid nitrogen residual. In the deeper coal bed, coal particles take longer time to reach thermal equilibrium between their surface and inside. Air leakage accelerates temperature increase at the bottom of the coal bed, which is a major reason leading to fire prevention inefficiency. Measurement fluctuation of CPM temperature may be caused by incomplete contact of coal particles with liquid nitrogen flowing in the coal bed. Moreover, the secondary temperature drop (STD) happens and grows with the more injection of liquid nitrogen, and the STD phenomenon is explained through temperature distributions at different locations.

  12. Nitrogen fixation by free-living organisms in rice soils. Studies with 15N

    International Nuclear Information System (INIS)

    Rao, V.R.; Charyulu, P.B.B.N.; Nayak, D.N.; Ramakrishna, C.

    1979-01-01

    Heterotrophic nitrogen fixation as influenced by water regime, organic matter, combined nitrogen and pesticides was investigated in several Indian rice soils by means of the 15 N 2 tracer technique. Soil submergence accelerated nitrogen fixation. Addition of cellulose to both non-flooded and flooded soils enhanced nitrogen fixation. Under submerged conditions, addition of sucrose, glucose and malate in that order stimulated nitrogen fixation in alluvial soil, while only sucrose enhanced nitrogen fixation in laterite soil. Nitrogen fixation in flooded alluvial and laterite soils decreased with increasing concentration of combined nitrogen. Nitrogen fixation was appreciable in acid sulphate and saline soils under both flooded and non-flooded conditions, despite high salinity and acidity. Application of certain pesticides at rates equivalent to recommended field level greatly influenced nitrogen fixation in flooded rice soils. Additions of benomyl (carbamate fungicide) and carbofuran (methyl carbamate insecticide) to alluvial and laterite soils resulted in significant stimulation of nitrogen fixation. Gamma-BHC stimulated nitrogen fixation only in alluvial soil, with considerable inhibition in a laterite soil. Nitrogen fixation by Azospirillum lipoferum was investigated by 15 N 2 . Large variations in 15 N 2 incorporation by A. lipoferum isolated from the roots of several rice cultivars was observed. Specific lines of rice harbouring A. lipoferum with high nitrogenase activity might be selected. Nitrogen fixed by heterotrophic organisms in a complex system such as soil could not be evaluated precisely. Indigenous nitrogen fixation in a flooded soil would be in the range of 5-10 kg N/ha, increasable 3 to 4-fold by appropriate fertilizers and cultural practices

  13. Enhanced nitrogen deposition over China

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xuejun; Zhang, Ying; Han, Wenxuan; Tang, Aohan; Shen, Jianlin; Cui, Zhenling; Christie, Peter; Zhang, Fusuo [College of Resources and Environmental Sciences, China Agricultural University, Beijing 100193 (China); Vitousek, Peter [Department of Biology, Stanford University, Stanford, California 94305 (United States); Erisman, Jan Willem [VU University Amsterdam, 1081 HV Amsterdam (Netherlands); Goulding, Keith [The Sustainable Soils and Grassland Systems Department, Rothamsted Research, Harpenden AL5 2JQ (United Kingdom); Fangmeier, Andreas [Institute of Landscape and Plant Ecology, University of Hohenheim, 70593 Stuttgart (Germany)

    2013-02-28

    China is experiencing intense air pollution caused in large part by anthropogenic emissions of reactive nitrogen. These emissions result in the deposition of atmospheric nitrogen (N) in terrestrial and aquatic ecosystems, with implications for human and ecosystem health, greenhouse gas balances and biological diversity. However, information on the magnitude and environmental impact of N deposition in China is limited. Here we use nationwide data sets on bulk N deposition, plant foliar N and crop N uptake (from long-term unfertilized soils) to evaluate N deposition dynamics and their effect on ecosystems across China between 1980 and 2010. We find that the average annual bulk deposition of N increased by approximately 8 kilograms of nitrogen per hectare (P < 0.001) between the 1980s (13.2 kilograms of nitrogen per hectare) and the 2000s (21.1 kilograms of nitrogen per hectare). Nitrogen deposition rates in the industrialized and agriculturally intensified regions of China are as high as the peak levels of deposition in northwestern Europe in the 1980s, before the introduction of mitigation measures. Nitrogen from ammonium (NH4+) is the dominant form of N in bulk deposition, but the rate of increase is largest for deposition of N from nitrate (NO3-), in agreement with decreased ratios of NH3 to NOx emissions since 1980. We also find that the impact of N deposition on Chinese ecosystems includes significantly increased plant foliar N concentrations in natural and semi-natural (that is, non-agricultural) ecosystems and increased crop N uptake from long-term-unfertilized croplands. China and other economies are facing a continuing challenge to reduce emissions of reactive nitrogen, N deposition and their negative effects on human health and the environment.

  14. A two-dimensional electrophoretic profile of the proteins secreted by Herbaspirillum seropedicae strain Z78.

    Science.gov (United States)

    Chaves, Daniela Fojo Seixas; de Souza, Emanuel Maltempi; Monteiro, Rose Adele; de Oliveira Pedrosa, Fábio

    2009-11-02

    Herbaspirillum seropedicae is an endophytic bacterium that associates with rice, sugarcane and other economically important crops. Secreted proteins play a key role in the plant-bacterial interaction. Using 2D electrophoresis and peptide mass fingerprint mass spectrometry, 63 protein spots representing 41 different secreted proteins were identified during growth of H. seropedicae under nitrogen-sufficient conditions. In silico analysis showed that 25.4% of the proteins had signal peptides and 15.9% were predicted to be non-classically secreted. Among the most abundant were flagellar components and ABC-type transport system proteins. Nine secreted proteins had also been identified in the cellular proteome, suggesting that they also play a role in the extracellular environment. No type III secreted proteins were detected by comparison of the wild type strain with an hrcN mutant strain.

  15. Simulation on Change Law of Runoff, Sediment and Non-point Source Nitrogen and Phosphorus Discharge under Different Land uses Based on SWAT Model: A Case Study of Er hai Lake Small Watershed

    Science.gov (United States)

    Tong, Xiao Xia; Lai Cui, Yuan; Chen, Man Yu; Hu, Bo; Xu, Wen Sheng

    2018-05-01

    The Er yuan watershed of Er hai district is chosen as the research area, the law of runoff and sediment and non-point source nitrogen and phosphorus discharges under different land uses during 2001 to 2014 are simulated based on SWAT model. Results of simulation indicate that the order of total runoff yield of different land use type from high to low is grassland, paddy fields, dry land. Specifically, the order of surface runoff yield from high to low is paddy fields, dry land, grassland, the order of lateral runoff yield from high to low is paddy fields, dry land, grassland, the order of groundwater runoff yield from high to low is grassland, paddy fields, dry land. The orders of sediment and nitrogen and phosphorus yield per unit area of different land use type are the same, grassland> paddy fields> dry land. It can be seen, nitrogen and phosphorus discharges from paddy fields and dry land are the main sources of agricultural non-point pollution of the irrigated area. Therefore, reasonable field management measures which can decrease the discharge of nitrogen and phosphorus of paddy fields and dry land are the key to agricultural non-point source pollution prevention and control.

  16. Growth and foliar nitrogen concentrations of interplanted native woody legumes and pecan

    Science.gov (United States)

    J.W. Van Sambeek; Nadia E. Navarrete-Tindall; Kenneth L. Hunt

    2008-01-01

    The interplanting and underplanting of nodulated nitrogen-fixing plants in tree plantings can increase early growth and foliage nitrogen content of hardwoods, especially black walnut and pecan. Recent studies have demonstrated that some non-nodulated woody legumes may be capable of fixing significant levels of atmospheric nitrogen. The following nine nurse crop...

  17. The importance of cytosolic glutamine synthetase in nitrogen assimilation and recycling

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, S.M.; Habash, D.Z.

    2009-07-02

    Glutamine synthetase assimilates ammonium into amino acids, thus it is a key enzyme for nitrogen metabolism. The cytosolic isoenzymes of glutamine synthetase assimilate ammonium derived from primary nitrogen uptake and from various internal nitrogen recycling pathways. In this way, cytosolic glutamine synthetase is crucial for the remobilization of protein-derived nitrogen. Cytosolic glutamine synthetase is encoded by a small family of genes that are well conserved across plant species. Members of the cytosolic glutamine synthetase gene family are regulated in response to plant nitrogen status, as well as to environmental cues, such as nitrogen availability and biotic/abiotic stresses. The complex regulation of cytosolic glutamine synthetase at the transcriptional to post-translational levels is key to the establishment of a specific physiological role for each isoenzyme. The diverse physiological roles of cytosolic glutamine synthetase isoenzymes are important in relation to current agricultural and ecological issues.

  18. Metabolism of whole body protein in pregnant and non-pregnant gilts using 15N-glycine single-dose end-product method

    International Nuclear Information System (INIS)

    Wu De; Liu Huifang; Zhou Anguo; Wang Kangning; Yang Feng

    2007-01-01

    The metabolism of whole-body protein for pregnant and non-pregnant gilts was investigated using single-dose of 15 N-glycine end-product method. The results showed that there were no differences (P>0.05) in protein dynamic metabolism, amino acids utilization rate between pregnant and non-pregnant gilts at breeding. However, N flux, protein turnover rate, protein synthesis rate and breakdown rate of pregnant gilts were lower (P<0.05) than those of non-pregnant gilts at 30days after breeding, but the protein aggradiation's rate increased by 25% (P<0.05). During late gestation, N flux, protein turnover rate, protein synthesis rate and breakdown rate of pregnant sows were significantly increased (P<0.01), and protein aggradation's rate increased by 71.1%, compared with that of non-pregnant gilts. (authors)

  19. Increased protein content of chickpea (Cicer arietinum L.) inoculated with arbuscular mycorrhizal fungi and nitrogen-fixing bacteria under water deficit conditions.

    Science.gov (United States)

    Oliveira, Rui S; Carvalho, Patrícia; Marques, Guilhermina; Ferreira, Luís; Nunes, Mafalda; Rocha, Inês; Ma, Ying; Carvalho, Maria F; Vosátka, Miroslav; Freitas, Helena

    2017-10-01

    Chickpea (Cicer arietinum L.) is a widely cropped pulse and an important source of proteins for humans. In Mediterranean regions it is predicted that drought will reduce soil moisture and become a major issue in agricultural practice. Nitrogen (N)-fixing bacteria and arbuscular mycorrhizal (AM) fungi have the potential to improve plant growth and drought tolerance. The aim of the study was to assess the effects of N-fixing bacteria and AM fungi on the growth, grain yield and protein content of chickpea under water deficit. Plants inoculated with Mesorhizobium mediterraneum or Rhizophagus irregularis without water deficit and inoculated with M. mediterraneum under moderate water deficit had significant increases in biomass. Inoculation with microbial symbionts brought no benefits to chickpea under severe water deficit. However, under moderate water deficit grain crude protein was increased by 13%, 17% and 22% in plants inoculated with M. mediterraneum, R. irregularis and M. mediterraneum + R. irregularis, respectively. Inoculation with N-fixing bacteria and AM fungi has the potential to benefit agricultural production of chickpea under water deficit conditions and to contribute to increased grain protein content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  20. Proteins in Soy Might Have a Higher Role in Cancer Prevention than Previously Expected: Soybean Protein Fractions Are More Effective MMP-9 Inhibitors Than Non-Protein Fractions, Even in Cooked Seeds

    Directory of Open Access Journals (Sweden)

    Ana Lima

    2017-02-01

    Full Text Available The search for anticancer MMP-9 inhibitors (MMPIs in food products has become a major goal for research. MMPIs in soy have been related only to saponins and isoflavones, but recently, low specific protein fractions in soybeans were shown to reduce MMP-9 activity as well. The present work aimed at comparing the MMPI potential of protein fractions (P and non-protein fractions (NP isolated from soybean seeds, before and after soaking and cooking, mimicking dietary exposures. Reverse and substrate zymography, as well as a fluoregenic DQ gelatin assay were used to evaluate MMP-9 activities. Colon cancer cell migration and proliferation was also tested in HT29 cells. Regarding MMP-9 inhibition, proteins in soy presented IC50 values 100 times lower than non-protein extracts, and remained active after cooking, suggesting that proteins may be more effective MMP-9 inhibitors than non-protein compounds. Using the determined IC50 concentrations, NP fractions were able to induce higher inhibitions of HT29 cell migration and proliferation, but not through MMP-9 inhibition, whilst protein fractions were shown to specifically inhibit MMP-9 activity. Overall, our results show that protein fractions in soybeans might have a higher role in soy-related cancer prevention as MMPIs than previously expected. Being nontoxic and active at lower concentrations, the discovery of these heat-resistant specific MMPI proteins in soy can be of significant importance for cancer preventive diets, particularly considering the increasing use of soy proteins in food products and the controversy around isoflavones amongst consumers.

  1. Nitrogen-detected TROSY yields comparable sensitivity to proton-detected TROSY for non-deuterated, large proteins under physiological salt conditions

    Energy Technology Data Exchange (ETDEWEB)

    Takeuchi, Koh [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan); Arthanari, Haribabu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States); Imai, Misaki [Japan Biological Informatics Consortium, Research and Development Department (Japan); Wagner, Gerhard, E-mail: gerhard-wagner@hms.harvard.edu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States); Shimada, Ichio, E-mail: shimada@iw-nmr.f.u-tokyo.ac.jp [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan)

    2016-02-15

    Direct detection of the TROSY component of proton-attached {sup 15}N nuclei ({sup 15}N-detected TROSY) yields high quality spectra with high field magnets, by taking advantage of the slow {sup 15}N transverse relaxation. The slow transverse relaxation and narrow line width of the {sup 15}N-detected TROSY resonances are expected to compensate for the inherently low {sup 15}N sensitivity. However, the sensitivity of {sup 15}N-detected TROSY in a previous report was one-order of magnitude lower than in the conventional {sup 1}H-detected version. This could be due to the fact that the previous experiments were performed at low salt (0–50 mM), which is advantageous for {sup 1}H-detected experiments. Here, we show that the sensitivity gap between {sup 15}N and {sup 1}H becomes marginal for a non-deuterated, large protein (τ{sub c} = 35 ns) at a physiological salt concentration (200 mM). This effect is due to the high salt tolerance of the {sup 15}N-detected TROSY. Together with the previously reported benefits of the {sup 15}N-detected TROSY, our results provide further support for the significance of this experiment for structural studies of macromolecules when using high field magnets near and above 1 GHz.

  2. Integration and visualization of non-coding RNA and protein interaction networks

    OpenAIRE

    Junge, Alexander; Refsgaard, Jan Christian; Garde, Christian; Pan, Xiaoyong; Santos Delgado, Alberto; Anthon, Christian; Alkan, Ferhat; von Mering, Christian; Workman, Christopher; Jensen, Lars Juhl; Gorodkin, Jan

    2015-01-01

    Non-coding RNAs (ncRNAs) fulfill a diverse set of biological functions relying on interactions with other molecular entities. The advent of new experimental and computational approaches makes it possible to study ncRNAs and their associations on an unprecedented scale. We present RAIN (RNA Association and Interaction Networks) - a database that combines ncRNA-ncRNA, ncRNA-mRNA and ncRNA-protein interactions with large-scale protein association networks available in the STRING database. By int...

  3. 21 CFR 862.1515 - Nitrogen (amino-nitrogen) test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Nitrogen (amino-nitrogen) test system. 862.1515... Systems § 862.1515 Nitrogen (amino-nitrogen) test system. (a) Identification. A nitrogen (amino-nitrogen) test system is a device intended to measure amino acid nitrogen levels in serum, plasma, and urine...

  4. Effect of Nitrogen Fertilizers on the Lysine Synthesis in Silo-Maize

    Energy Technology Data Exchange (ETDEWEB)

    Cencelj, J.; Jelenic, Dj. [Institute for the Application of Nuclear Energy in Agriculture, Veterinary Medicine and Forestry, Belgrade, Yugoslavia (Serbia)

    1968-07-01

    In investigations on amino acids of silo-maize, different nitrogen fertilizers were studied to determine their effect on amino acid composition and variation during the growth period. The experiment was carried out with silo-maize, hybrid W 464A, grown on sandy soil, which had not been treated for six years with either fertilizers or manure. Before cultivation phosphorus and potassium fertilizers were applied, and the nitrogen fertilizers, ammonium sulphate, ammonium nitrate, calcium cyanamide and urea, were applied at the most appropriate time of application. The first samples were taken at the time of flowering, the second after flowering, and the third, fourth and fifth in the lactic, wax, and full maturity phases, respectively. The percentages of crude protein of the maize gradually decreased while the nitrogen-free extraction matter increased during this period. The protein content of the maize was highest with sodium nitrate and urea fertilization and lowest when calcium cyanamide was used. Investigations to determine whether or not an increase in crude protein content was correlated with an increased content of lysine have shown that there is a correlation when plants are fertilized with calcium cyanamide. The content of essential amino acids was more satisfactory in plants fertilized with urea than with sodium nitrate. According to the statistical analysis, the best improvement in lysine content was obtained with urea (0.23%), the least satisfactory with calcium cyanamide (0.17%), and PK fertilizers without nitrogen (0.15%). (author)

  5. The Bioconcentration and Degradation of Nonylphenol and Nonylphenol Polyethoxylates by Chlorella vulgaris

    Directory of Open Access Journals (Sweden)

    Hong-Wen Sun

    2014-01-01

    Full Text Available Nonylphenol polyethoxylates (NPnEOs, a major class of nonionic surfactants, can easily enter into aquatic environments through various pathways due to their wide applications, which leads to the extensive existence of their relative stable metabolites, namely nonylphenol (NP and mono- to tri-ethoxylates. This study investigated the bioconcentration and degradation of NP and NPnEO oligomers (n = 1–12 by a green algae, Chlorella vulgaris. Experimental results showed that C. vulgaris can remove NP from water phase efficiently, and bioconcentration and degradation accounted for approximately half of its loss, respectively, with a 48 h BCF (bioconcentration factor of 2.42 × 103. Moreover, C. vulgaris could concentrate and degrade NPnEOs, distribution profiles of the series homologues of the NPnEOs in algae and water phase were quite different from the initial homologue profile. The 48 h BCF of the NPnEO homologues increased with the length of the EO chain. Degradation extent of total NPnEOs by C. vulgaris was 95.7%, and only 1.1% remained in water phase, and the other 3.2% remained in the algal cells. The algae removed the NPnEOs mainly through degradation. Due to rapid degradation, concentrations of the long chain NPnEO homologous in both water (n ≥ 2 and the algal phase (n ≥ 5 was quite low at the end of a 48 h experiment.

  6. Temperature Sensitivity of Soil Respiration to Nitrogen Fertilization: Varying Effects between Growing and Non-Growing Seasons

    Science.gov (United States)

    Liu, Qingfang; Wang, Rui; Li, Rujian; Hu, Yaxian; Guo, Shengli

    2016-01-01

    Nitrogen (N) fertilization has a considerable effect on food production and carbon cycling in agro-ecosystems. However, the impacts of N fertilization rates on the temperature sensitivity of soil respiration (Q10) were controversial. Five N rates (N0, N45, N90, N135, and N180) were applied to a continuous winter wheat (Triticum aestivum L.) crop on the semi-arid Loess Plateau, and the in situ soil respiration was monitored during five consecutive years from 2008 to 2013. During the growing season, the mean soil respiration rates increased with increasing N fertilization rates, peaking at 1.53 μmol m−2s−1 in the N135 treatment. A similar dynamic pattern was observed during the non-growing season, yet on average with 7.3% greater soil respiration rates than the growing season. In general for all the N fertilization treatments, the mean Q10 value during the non-growing season was significantly greater than that during the growing season. As N fertilization rates increased, the Q10 values did not change significantly in the growing season but significantly decreased in the non-growing season. Overall, N fertilization markedly influenced soil respirations and Q10 values, in particular posing distinct effects on the Q10 values between the growing and non-growing seasons. PMID:27992576

  7. Uptake of fertilizer nitrogen and soil nitrogen by rice using 15N-labelled nitrogen fertilizer

    International Nuclear Information System (INIS)

    Reddy, K.R.; Patrick, W.H. Jr.

    1980-01-01

    Data from five field experiments using labelled nitrogen fertilizer were used to determine the relative effects of soil nitrogen and fertilizer nitrogen on rice yield. Yield of grain was closely correlated with total aboveground nitrogen uptake (soil + fertilizer), less closely correlated with soil nitrogen uptake and not significantly correlated with fertilizer nitrogen uptake. When yield increase rather than yield was correlated with fertilizer nitrogen uptake, the correlation coefficient was statistically significant. (orig.)

  8. [Progress in inversion of vegetation nitrogen concentration by hyperspectral remote sensing].

    Science.gov (United States)

    Wang, Li-Wen; Wei, Ya-Xing

    2013-10-01

    Nitrogen is the necessary element in life activity of vegetation, which takes important function in biosynthesis of protein, nucleic acid, chlorophyll, and enzyme etc, and plays a key role in vegetation photosynthesis. The technology about inversion of vegetation nitrogen concentration by hyperspectral remote sensing has been the research hotspot since the 70s of last century. With the development of hyperspectral remote sensing technology in recent years, the advantage of spectral bands subdivision in a certain spectral region provides the powerful technology measure for correlative spectral characteristic research on vegetation nitrogen. In the present paper, combined with the newest research production about monitoring vegetation nitrogen concentration by hyperspectral remote sensing published in main geography science literature in recent several years, the principle and correlated problem about monitoring vegetation nitrogen concentration by hyperspectral remote sensing were introduced. From four aspects including vegetation nitrogen spectral index, vegetation nitrogen content inversion based on chlorophyll index, regression model, and eliminating influence factors to inversion of vegetation nitrogen concentration, main technology methods about inversion of vegetation nitrogen concentration by hyperspectral remote sensing were detailedly introduced. Correlative research conclusions were summarized and analyzed, and research development trend was discussed.

  9. Non liquid nitrogen-based-method for isolation of DNA from ...

    African Journals Online (AJOL)

    A simple, efficient, reliable and cost-effective method for isolation of total genomic DNA from fungi, suitable for polymerase chain reaction (PCR) amplification and other molecular applications was described. The main advantages of the method are: (1) does not require the use of liquid nitrogen for preparation of fungi DNA; ...

  10. Prone to fix: Resilience of the active nitrogen-fixing rice root microbiome

    Science.gov (United States)

    Hurek, Thomas; Sabale, Mugdha; Sarkar, Abhijit; Pees, Tobias; Reinhold-Hurek, Barbara

    2016-04-01

    Due to water consumption, many lowland rice areas in Asia are undergoing a transition that involves adoption of new management strategies, with crop rotations encompassing a non-flooded crop, including maize. Shifting from flooded to non-flooded cropping is likely to affect microbial nitrogen cycling. For analysis of the root-associated microbiome of rice and maize in response to flooding or nitrogen fertilizer, we combine methods of microbial ecology (Next-Generation sequencing of amplicons), and a reductionist approach with pure cultures of the endophytic diazotroph Azoarus sp.. Field plots of the ICON project (Introducing non-flooded crops in rice-dominated landscapes: Impact on Carbon, nitrogen and water budgets) at the International Rice Research Institute in the Philippines were analyzed. Root-associated activity of nitrogenase gene expression was assessed by quantitative RT-PCR of nifH. For rice, expression levels were surprisingly stable, in response to non-flooded versus flooded conditions, or in response to conventional nitrogen fertilizer applications versus lack of N-fertilizer. In contrast, the active diazotrophic population of maize roots was not resistant to N-fertilization, nifH expression strongly decreased. Concordant changes in the diazotrophic resident or active communities were detected by nifH amplicon sequence analysis, based on bacterial DNA or mRNA, respectively. For high-resolution analyses of the endobiome in gnotobiotic culture, we developed a dual fluorescence reporter system for Azoarcus sp. BH72 which allows to quantify and visualize epi- and endophytic gene expression by concfocal microscopy (CLSM). This allowed us to demonstrate sites of active nitrogen fixation (gene expression) in association with rice roots. We confirmed that at low nitrogen fertilizer levels, endophytic nifH gene expression persisted in rice roots, while it was repressed in maize roots. This supports our observation of remarkable stability of nitrogen fixation

  11. LiDAR based biomass and crop nitrogen estimates for rapid, non-destructive assessment of wheat nitrogen status

    Science.gov (United States)

    Optical remote sensing of crop nitrogen (N) status is developing into a powerful diagnostic tool that can improve N management decisions. Crop N status is a function of dry mass per unit area (W) and N concentration (%Na), which can be used to calculate N nutrition index (NNI),where NNI is %Na/%Nc (...

  12. Spatial and temporal variations in non-point source losses of nitrogen and phosphorus in a small agricultural catchment in the Three Gorges Region.

    Science.gov (United States)

    Chen, Chenglong; Gao, Ming; Xie, Deti; Ni, Jiupai

    2016-04-01

    Losses of agricultural pollutants from small catchments are a major issue for water quality in the Three Gorges Region. Solutions are urgently needed. However, before pollutant losses can be controlled, information about spatial and temporal variations in pollutant losses is needed. The study was carried out in the Wangjiagou catchment, a small agricultural catchment in Fuling District, Chongqing, and the data about non-point source losses of nitrogen and phosphorus was collected here. Water samples were collected daily by an automatic water sampler at the outlets of two subcatchments from 2012 to 2014. Also, samples of surface runoff from 28 sampling sites distributed through the subcatchments were collected during 12 rainfall events in 2014. A range of water quality variables were analyzed for all samples and were used to demonstrate the variation in non-point losses of nitrogen and phosphorus over a range of temporal and spatial scales and in different types of rainfall in the catchment. Results showed that there was a significant linear correlation between the mass concentrations of total nitrogen (TN) and nitrate (NO3-N) in surface runoff and that the relationship was maintained with changes in time. Concentrations of TN and NO3-N peaked after fertilizer was applied to crops in spring and autumn; concentrations decreased rapidly after the peak values in spring but declined slowly in autumn. N and P concentrations fluctuated more and showed a greater degree of dispersion during the spring crop cultivation period than those in autumn. Concentrations of TN and NO3-N in surface runoff were significantly and positively correlated with the proportion of the area that was planted with corn and mustard tubers, but were negatively correlated with the proportion of the area taken up with rice and mulberry plantations. The average concentrations of TN and NO3-N in surface runoff reached the highest level from the sampling points at the bottom of the land used for corn

  13. Effect of l-glutamic acid supplementation on performance and nitrogen balance of broilers fed low protein diets.

    Science.gov (United States)

    Bezerra, R M; Costa, F G P; Givisiez, P E N; Freitas, E R; Goulart, C C; Santos, R A; Souza, J G; Brandão, P A; Lima, M R; Melo, M L; Rodrigues, V P; Nogueira, E T; Vieira, D V G

    2016-06-01

    The aim of this study was to evaluate the effect of protein reduction and supplementation of l-glutamic acid in male broiler diets. A total of 648 chicks of the Cobb 500 strain were distributed in a completely randomized design with six treatments and six replications with eighteen birds per experimental unit. The study comprised pre-starter (1-7 days), starter (8-21 days), growth (22-35 days) and final (36-45 days) phases. The first treatment consisted of a control diet formulated according to the requirements of essential amino acids for each rearing phase. The second and third treatments had crude protein (CP) reduced by 1.8 and 3.6 percentage points (pp) in relation to the control diet respectively. In the fourth treatment, l-glutamic acid was added to provide the same glutamate level as the control diet, and in the last two treatments, the broilers were supplemented with 1 and 2 pp of glutamate above that of the control diet respectively. The reduction in CP decreased the performance of broilers and the supplementation of l-glutamic acid did not influence performance when supplied in the diets with excess of glutamate. The lowest excreted nitrogen values were observed in the control diet, and treatments 2 and 3, respectively, in comparison with treatments with the use of l-glutamic acid (5 and 6). Retention efficiency of nitrogen was better in the control diet and in the treatment with a reduction of 1.8 pp of CP. It was verified that the serum uric acid level decreased with the CP reduction. A reduction in CP levels of up to 21.3%, 18.8%, 18.32% and 17.57% is recommended in phases from 1 to 7, 8 to 21, 22 to 35 and at 36 to 42 days, respectively, with a level of glutamate at 5.32%, 4.73%, 4.57%, 4.38%, also in these phases. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  14. Proteomic analysis of Herbaspirillum seropedicae reveals ammonium-induced AmtB-dependent membrane sequestration of PII proteins.

    Science.gov (United States)

    Huergo, Luciano F; Noindorf, Lilian; Gimenes, Camila; Lemgruber, Renato S P; Cordellini, Daniela F; Falarz, Lucas J; Cruz, Leonardo M; Monteiro, Rose A; Pedrosa, Fábio O; Chubatsu, Leda S; Souza, Emanuel M; Steffens, Maria B R

    2010-07-01

    This study was aimed at describing the spectrum and dynamics of proteins associated with the membrane in the nitrogen-fixing bacterium Herbaspirillum seropedicae according to the availability of fixed nitrogen. Using two-dimensional electrophoresis we identified 79 protein spots representing 45 different proteins in the membrane fraction of H. seropedicae. Quantitative analysis of gel images of membrane extracts indicated two spots with increased levels when cells were grown under nitrogen limitation in comparison with nitrogen sufficiency; these spots were identified as the GlnK protein and as a conserved noncytoplasmic protein of unknown function which was encoded in an operon together with GlnK and AmtB. Comparison of gel images of membrane extracts from cells grown under nitrogen limitation or under the same regime but collected after an ammonium shock revealed two proteins, GlnB and GlnK, with increased levels after the shock. The P(II) proteins were not present in the membrane fraction of an amtB mutant. The results reported here suggest that changes in the cellular localization of P(II) might play a role in the control of nitrogen metabolism in H. seropedicae.

  15. Nitrogen utilization in pigs fed diets with soybean and rapeseed products leading to different ileal endogenous nitrogen losses

    NARCIS (Netherlands)

    Grala, W.; Verstegen, M.W.A.; Jansman, A.J.M.; Huisman, J.; Wasilewko, J.

    1998-01-01

    Nitrogen (N) balance was determined in 36 pigs (BW 24 to 30 kg) fed diets inducing different ileal endogenous N losses (ENL). We tested the hypothesis that enhanced ENL may be indicative of a higher recycling of endogenous proteins that will induce a greater urinary N loss and a lower efficiency of

  16. Molecular nitrogen fixation and nitrogen cycle in nature

    Energy Technology Data Exchange (ETDEWEB)

    Virtanen, A I

    1952-01-01

    The origin of nitrogen oxides in the atmosphere is discussed. Evidently only a small proportion of the nitrate-and nitrite-nitrogen found in the precipitation is formed through electric discharges from molecular nitrogen, photochemical nitrogen fixation being probably of greater importance. Formation of nitrate nitrogen through atmospheric oxidation of nitrous oxide (N/sub 2/O) evaporating from the soil is also considered likely. Determination of nitrogen compounds at different altitudes is indispensable for gaining information of the N/sub 2/-fixation in the atmosphere and, in general, of the origin of nitrogen oxides and their decomposition. International cooperation is needed for this as well as for the quantitative determination of the nitrogen compounds removed from the soil by leaching and brought by waters into the seas.

  17. Estimate of symbiotically fixed nitrogen in field grown soybeans using variations in /sup 15/N natural abundance

    Energy Technology Data Exchange (ETDEWEB)

    Amarger, N; Durr, J C; Bourguignon, C; Lagacherie, B [INRA Centre de Recherches de Dijon, 21 (France). Lab. de Microbiologie des Sols; Mariotti, A; Mariotti, F [Paris-6 Univ., 75 (France). Lab. de Geologie Dynamique

    1979-07-01

    The use of variations in natural abundance of /sup 15/N between nitrogen fixing and non nitrogen fixing soybeans was investigated for quantitative estimate of symbiotic nitrogen fixation. Isotopic analysis of 4 varieties of inoculated and non-inoculated soybeans growing under field conditions, with and without N-fertilizer was determined. It was found that inoculated soybeans had a significantly lower /sup 15/N content than non-inoculated ones. Estimates of the participation of fixed N to the total nitrogen content of inoculated soybeans were calculated from these differences. They were compared to estimates calculated from differences in N yield between inoculated and non-inoculated plants and to the nitrogenase activity, measured by the C/sub 2/H/sub 2/ reduction assay over the growing season. Estimates given by the /sup 15/N measurements were correlated with the C/sub 2/H/sub 2/ reducing activity but not with the differences in the N yield. This shows that the isotopic composition was dependent on the amount of fixed nitrogen and consequently that the estimates of fixed nitrogen based on natural /sup 15/N abundance should be reliable. The absence of correlation between estimates based on /sup 15/N content and estimates based on N yield was explained by differences in the uptake of soil nitrogen between inoculated and non inoculated soybeans.

  18. The dynamics of single protein molecules is non-equilibrium and self-similar over thirteen decades in time

    Science.gov (United States)

    Hu, Xiaohu; Hong, Liang; Dean Smith, Micholas; Neusius, Thomas; Cheng, Xiaolin; Smith, Jeremy C.

    2016-02-01

    Internal motions of proteins are essential to their function. The time dependence of protein structural fluctuations is highly complex, manifesting subdiffusive, non-exponential behaviour with effective relaxation times existing over many decades in time, from ps up to ~102 s (refs ,,,). Here, using molecular dynamics simulations, we show that, on timescales from 10-12 to 10-5 s, motions in single proteins are self-similar, non-equilibrium and exhibit ageing. The characteristic relaxation time for a distance fluctuation, such as inter-domain motion, is observation-time-dependent, increasing in a simple, power-law fashion, arising from the fractal nature of the topology and geometry of the energy landscape explored. Diffusion over the energy landscape follows a non-ergodic continuous time random walk. Comparison with single-molecule experiments suggests that the non-equilibrium self-similar dynamical behaviour persists up to timescales approaching the in vivo lifespan of individual protein molecules.

  19. Carbon-nitrogen interactions and biomass partitioning of Carex rostrata grown at three levels of nitrogen supply

    Energy Technology Data Exchange (ETDEWEB)

    Saarinen, T [Helsinki Univ. (Finland). Dept. of Ecology and Systematics

    1997-12-31

    Biomass and production of vascular plants constitutes a major source of carbon input in peatlands. As rates of decomposition vary considerably with depth, the vertical distribution of biomass may substantially affect accumulation of carbon in peatlands. Therefore, allocation patterns between shoot and roots are particularly important when considering carbon balance of peatland ecosystems. The stimulatory effect of increasing atmospheric concentration of CO{sub 2} or photosynthesis may increase availability of carbon to most C3 plants. Availability of nitrogen may also alter both due to increased atmospheric deposition and changer in mineralisation rates associated with climate change. Most root-shoot partitioning models predict that allocation of biomass is dependent of the availability and uptake of carbon and nitrogen. A decrease in supply of carbon would favour allocation to shoots and a decrease in supply of nitrogen would increase allocation to roots. At a cellular level, non structural carbohydrates and free amino acids are thought to represent the biochemically available fraction of carbon and nitrogen, respectively. The aim of this work is study the long-term growth responses of Carex rostrata to changes in the availability of nitrogen. Special attention is paid to soluble sugars ant free amino acids, which may control partitioning of biomass. (10 refs.)

  20. Carbon-nitrogen interactions and biomass partitioning of Carex rostrata grown at three levels of nitrogen supply

    Energy Technology Data Exchange (ETDEWEB)

    Saarinen, T. [Helsinki Univ. (Finland). Dept. of Ecology and Systematics

    1996-12-31

    Biomass and production of vascular plants constitutes a major source of carbon input in peatlands. As rates of decomposition vary considerably with depth, the vertical distribution of biomass may substantially affect accumulation of carbon in peatlands. Therefore, allocation patterns between shoot and roots are particularly important when considering carbon balance of peatland ecosystems. The stimulatory effect of increasing atmospheric concentration of CO{sub 2} or photosynthesis may increase availability of carbon to most C3 plants. Availability of nitrogen may also alter both due to increased atmospheric deposition and changer in mineralisation rates associated with climate change. Most root-shoot partitioning models predict that allocation of biomass is dependent of the availability and uptake of carbon and nitrogen. A decrease in supply of carbon would favour allocation to shoots and a decrease in supply of nitrogen would increase allocation to roots. At a cellular level, non structural carbohydrates and free amino acids are thought to represent the biochemically available fraction of carbon and nitrogen, respectively. The aim of this work is study the long-term growth responses of Carex rostrata to changes in the availability of nitrogen. Special attention is paid to soluble sugars ant free amino acids, which may control partitioning of biomass. (10 refs.)

  1. Sequestration of soil nitrogen as tannin-protein complexes may improve the competitive ability of sheep laurel (Kalmia angustifolia) relative to black spruce (Picea mariana).

    Science.gov (United States)

    Joanisse, G D; Bradley, R L; Preston, C M; Bending, G D

    2009-01-01

    The role of litter tannins in controlling soil nitrogen (N) cycling may explain the competitive ability of Kalmia relative to black spruce (Picea mariana), although this has not been demonstrated experimentally. Here, the protein-precipitation capacities of purified tannins and leaf extracts from Kalmia and black spruce were compared. The resistance to degradation of tannin-protein precipitates from both species were compared by monitoring carbon (C) and N dynamics in humus amended with protein, purified tannins or protein-tannin precipitates. The purity of the precipitates was verified using solid-state (13)C nuclear magnetic resonance (NMR) spectra. The ability of mycorrhizal fungi associated with both species to grow on media amended with tannin-protein complexes as the principal N source was also compared. The protein precipitation capacity of Kalmia tannins was superior to those of black spruce. Humus amended with protein increased both mineral and microbial N, whereas humus amended with tannin-protein precipitates increased dissolved organic N. Mycorrhizal fungi associated with Kalmia showed better growth than those associated with black spruce when N was provided as tannin-protein precipitates. These data suggest that Kalmia litter increases the amount of soil N sequestered as tannin-protein complexes, which may improve the competitive ability of Kalmia relative to black spruce by favouring N uptake by mycorrhizas associated with the former.

  2. The effect of nitrogen rate on transgenic corn Cry3Bb1 protein expression.

    Science.gov (United States)

    Marquardt, Paul T; Krupke, Christian H; Camberato, James J; Johnson, William G

    2014-05-01

    Combining herbicide-resistant and Bacillus thuringiensis (Bt) traits in corn (Zea mays L.) hybrids may affect insect resistance management owing to volunteer corn. Some Bt toxins may be expressed at lower levels by nitrogen-deficient corn roots. Corn plants with sublethal levels of Bt expression could accelerate the evolution of Bt resistance in target insects. The present objective was to quantify the concentration of Bt (Cry3Bb1) in corn root tissue with varying tissue nitrogen concentrations. Expression of Cry3Bb1 toxin in root tissue was highly variable, but there were no differences in the overall concentration of Cry3Bb1 expressed between roots taken from Cry3Bb1-positive volunteer and hybrid corn plants. The nitrogen rate did affect Cry3Bb1 expression in the greenhouse, less nitrogen resulted in decreased Cry3Bb1 expression, yet this result was not documented in the field. A positive linear relationship of plant nitrogen status on Cry3Bb1 toxin expression was documented. Also, high variability in Cry3Bb1 expression is potentially problematic from an insect resistance management perspective. This variability could create a mosaic of toxin doses in the field, which does not fit into the high-dose refuge strategy and could alter predictions about the speed of evolution of resistance to Cry3Bb1 in western corn rootworm Diabrotica virgifera virgifera LeConte. © 2013 Society of Chemical Industry.

  3. A high performance non-enzymatic glucose sensor based on nickel hydroxide modified nitrogen-incorporated nanodiamonds.

    Science.gov (United States)

    Ko, Chih-Yu; Huang, Jin-Hua; Raina, Supil; Kang, Weng P

    2013-06-07

    A highly selective, sensitive, and stable non-enzymatic glucose sensor based on Ni hydroxide modified nitrogen-incorporated nanodiamonds (Ni(OH)2-NND) was developed. The sensor was fabricated by e-beam evaporation of a thin Ni film on NND followed by the growth of Ni(OH)2 using an electrochemical process. It was found that the Ni film thickness greatly affects the morphology and electro-catalytic activity of the as-synthesized electrode for non-enzymatic glucose oxidation. Owing to its nanostructure characteristics, the best sensor fabricated by 150 nm Ni deposition showed two wide response ranges, namely, 0.02-1 mM and 1-9 mM, with sensitivities of 3.20 and 1.41 mA mM(-1) cm(-2), respectively, and a detection limit of 1.2 μM (S/N = 3). The sensor also showed good long-term stability as well as high selectivity in the presence of interferences such as ascorbic acid, acetaminophen, and uric acid. This finding reveals the possibility of exploiting the NND as an electrochemical biosensor platform where high performance addressable sensor arrays could be built.

  4. Effects of dietary crude protein and rumen-degradable protein concentrations on urea recycling, nitrogen balance, omasal nutrient flow, and milk production in dairy cows.

    Science.gov (United States)

    Mutsvangwa, T; Davies, K L; McKinnon, J J; Christensen, D A

    2016-08-01

    The objective of this study was to determine how interactions between dietary crude protein (CP) and rumen-degradable protein (RDP) concentrations alter urea-nitrogen recycling, nitrogen (N) balance, omasal nutrient flow, and milk production in lactating Holstein cows. Eight multiparous Holstein cows (711±21kg of body weight; 91±17d in milk at the start of the experiment) were used in a replicated 4×4 Latin square design with a 2×2 factorial arrangement of dietary treatments and 29-d experimental periods. Four cows in one Latin square were fitted with ruminal cannulas to allow ruminal and omasal sampling. The dietary treatment factors were CP (14.9 vs. 17.5%; dry matter basis) and RDP (63 vs. 69% of CP) contents. Dietary RDP concentration was manipulated by including unprocessed or micronized canola meal. Diet adaptation (d 1-20) was followed by 8d (d 21-29) of sample and data collection. Continuous intrajugular infusions of [(15)N(15)N]-urea (220mg/d) were conducted for 4d (d 25-29) with concurrent total collections of urine and feces to estimate N balance and whole-body urea kinetics. Proportions of [(15)N(15)N]- and [(14)N(15)N]-urea in urinary urea, and (15)N enrichment in feces were used to calculate urea kinetics. For the low-CP diets, cows fed the high-RDP diet had a greater DM intake compared with those fed the low-RDP diet, but the opposite trend was observed for cows fed the high-CP diets. Dietary treatment had no effect on milk yield. Milk composition and milk component yields were largely unaffected by dietary treatment; however, on the low-CP diets, milk fat yield was greater for cows fed the low-RDP diet compared with those fed the high-RDP diet, but it was unaffected by RDP concentration on the high-CP diets. On the high-CP diets, milk urea nitrogen concentration was greater in cows fed the high-RDP diet compared with those fed the low-RDP diet, but it was unaffected by RDP concentration on the low-CP diets. Ruminal NH3-N concentration tended to

  5. Chitin: 'Forgotten' Source of Nitrogen: From Modern Chitin to Thermally Mature Kerogen: Lessons from Nitrogen Isotope Ratios

    Science.gov (United States)

    Schimmelmann, A.; Wintsch, R.P.; Lewan, M.D.; DeNiro, M.J.

    1998-01-01

    Chitinous biomass represents a major pool of organic nitrogen in living biota and is likely to have contributed some of the fossil organic nitrogen in kerogen. We review the nitrogen isotope biogeochemistry of chitin and present preliminary results suggesting interaction between kerogen and ammonium during thermal maturation. Modern arthropod chitin may shift its nitrogen isotope ratio by a few per mil depending on the chemical method of chitin preparation, mostly because N-containing non-amino-sugar components in chemically complex chitin cannot be removed quantitatively. Acid hydrolysis of chemically complex chitin and subsequent ion-chromatographic purification of the "deacetylated chitin-monomer" D-glucosamine (in hydrochloride form) provides a chemically well-defined, pure amino-sugar substrate for reproducible, high-precision determination of ??15N values in chitin. ??15N values of chitin exhibited a variability of about one per mil within an individual's exoskeleton. The nitrogen isotope ratio differed between old and new exoskeletons by up to 4 per mil. A strong dietary influence on the ??15N value of chitin is indicated by the observation of increasing ??15N values of chitin from marine crustaceans with increasing trophic level. Partial biodegradation of exoskeletons does not significantly influence ??15N values of remaining, chemically preserved amino sugar in chitin. Diagenesis and increasing thermal maturity of sedimentary organic matter, including chitin-derived nitrogen-rich moieties, result in humic compounds much different from chitin and may significantly change bulk ??15N values. Hydrous pyrolysis of immature source rocks at 330??C in contact with 15N-enriched NH4Cl, under conditions of artificial oil generation, demonstrates the abiogenic incorporation of inorganic nitrogen into carbon-bound nitrogen in kerogen. Not all organic nitrogen in natural, thermally mature kerogen is therefore necessarily derived from original organic matter, but may

  6. Exosomal proteins as prognostic biomarkers in non-small cell lung cancer

    DEFF Research Database (Denmark)

    Sandfeld-Paulsen, B; Aggerholm-Pedersen, N; Bæk, R

    2016-01-01

    BACKGROUND: Use of exosomes as biomarkers in non-small cell lung cancer (NSCLC) is an intriguing approach in the liquid-biopsy era. Exosomes are nano-sized vesicles with membrane-bound proteins that reflect their originating cell. Prognostic biomarkers are needed to improve patient selection...... Bonferroni correction. Results were adjusted for clinico-pathological characteristics, stage, histology, age, sex and performance status. CONCLUSION: We illustrate the promising aspects associated with the use of exosomal membrane-bound proteins as a biomarker and demonstrate that they are a strong...

  7. Combined effect of protein and oxygen on reactive oxygen and nitrogen species in the plasma treatment of tissue

    Science.gov (United States)

    Gaur, Nishtha; Szili, Endre J.; Oh, Jun-Seok; Hong, Sung-Ha; Michelmore, Andrew; Graves, David B.; Hatta, Akimitsu; Short, Robert D.

    2015-09-01

    The influence of protein and molecular, ground state oxygen (O2) on the plasma generation, and transport of reactive oxygen and nitrogen species (RONS) in tissue are investigated. A tissue target, comprising a 1 mm thick gelatin film (a surrogate for real tissue), is placed on top of a 96-well plate; each well is filled with phosphate buffered saline (PBS, pH 7.4) containing one fluorescent or colorimetric reporter that is specific for one of three RONS (i.e., H2O2, NO2-, or OH•) or a broad spectrum reactive oxygen species reporter (2,7-dichlorodihydrofluorescein). A helium cold atmospheric plasma (CAP) jet contacts the top of the gelatin surface, and the concentrations of RONS generated in PBS are measured on a microplate reader. The data show that H2O2, NO2-, or OH• are generated in PBS underneath the target. Independently, measurements are made of the O2 concentration in the PBS with and without the gelatin target. Adding bovine serum albumin protein to the PBS or gelatin shows that protein either raises or inhibits RONS depending upon the O2 concentration. Our results are discussed in the context of plasma-soft tissue interactions that are important in the development of CAP technology for medicine, biology, and food manufacturing.

  8. Photosynthetic and nitrogen fixation capability in several soybean mutant lines

    International Nuclear Information System (INIS)

    Gandanegara, S.; Hendratno, K.

    1987-01-01

    Photosynthetic and nitrogen fixation capability in several soybean mutant lines. A greenhouse experiment has been carried out to study photosynthetic and nitrogen fixation capability of five mutant lines and two soybean varieties. An amount of 330 uCi of 14 CO 2 was fed to the plants including of the non-fixing reference crop (Chippewa non-nodulating isoline). Nitrogen fixation measurements was carried out using 15 N isotope dilution technique according to A-value concept. Results showed that beside variety/mutant lines, plant growth also has important role in photosynthetic and N fixing capability. Better growth and a higher photosynthetic capability in Orba, mutant lines nos. 63 and 65 resulted in a greater amount of N 2 fixed (mg N/plant) than other mutant lines. (author). 12 refs.; 5 figs

  9. Caenorhabditis elegans as a model system for studying non-cell-autonomous mechanisms in protein-misfolding diseases

    Directory of Open Access Journals (Sweden)

    Carmen I. Nussbaum-Krammer

    2014-01-01

    Full Text Available Caenorhabditis elegans has a number of distinct advantages that are useful for understanding the basis for cellular and organismal dysfunction underlying age-associated diseases of protein misfolding. Although protein aggregation, a key feature of human neurodegenerative diseases, has been typically explored in vivo at the single-cell level using cells in culture, there is now increasing evidence that proteotoxicity has a non-cell-autonomous component and is communicated between cells and tissues in a multicellular organism. These discoveries have opened up new avenues for the use of C. elegans as an ideal animal model system to study non-cell-autonomous proteotoxicity, prion-like propagation of aggregation-prone proteins, and the organismal regulation of stress responses and proteostasis. This Review focuses on recent evidence that C. elegans has mechanisms to transmit certain classes of toxic proteins between tissues and a complex stress response that integrates and coordinates signals from single cells and tissues across the organism. These findings emphasize the potential of C. elegans to provide insights into non-cell-autonomous proteotoxic mechanisms underlying age-related protein-misfolding diseases.

  10. Changes in the contents of nitrogen fractions with loosing vital capacity of the Siberian fir Abies sibirica Ledeb. seeds

    Directory of Open Access Journals (Sweden)

    S. G. Prokushkin

    2017-02-01

    Full Text Available Siberian fir seeds often lose their germinating capacity during storage. This results from, among other factors, changing contents of nitrogen compounds in the seeds, especially those of protein fractions. This paper focuses on analyzing changes of these compounds in nonviable seeds of the species depending on ecological and conditions and stand location, as well as on tree growth class (Kraft growth classes I and IV. The contents of the total and protein nitrogen in the nonviable seeds of the trees of growth classes I and IV appeared to vary widely and to depend on stand location and seed location in the tree crown. The maximum contents were in the seeds located in the upper part of the crown. The seeds from the middle and lower crown parts contained much less total and protein nitrogen. The hard-to-solve protein fraction dominated over other protein fraction in the seeds from the upper part of the crowns of the trees of growth classes I and IV. However, this fraction, like prolamines, changed uniformly throughout the crowns, whereas seed glutelin content varied insignificantly among the crown parts. Albumins and globulins showed a uniform crown top-to-bottom decrease. A comparison of viable seed with unviable seeds for contents of the nitrogen forms revealed a marked decrease in the total and protein nitrogen in the latter, especially for the trees of growth class IV. The seeds that lost their germinating capacity exhibited increasingly hard-to-solve protein fraction and drastically decreasing albumins and globulins wherever the seeds were in the crown. Their glutelin and prolamine contents changed inconsiderably.The changes of the quantitative ratio between the protein fractions found by the study cause, along with other physiological and biochemical factors, the loss of viability of Siberian fir seeds during storage.

  11. Process for separating nitrogen from methane using microchannel process technology

    Science.gov (United States)

    Tonkovich, Anna Lee [Marysville, OH; Qiu, Dongming [Dublin, OH; Dritz, Terence Andrew [Worthington, OH; Neagle, Paul [Westerville, OH; Litt, Robert Dwayne [Westerville, OH; Arora, Ravi [Dublin, OH; Lamont, Michael Jay [Hilliard, OH; Pagnotto, Kristina M [Cincinnati, OH

    2007-07-31

    The disclosed invention relates to a process for separating methane or nitrogen from a fluid mixture comprising methane and nitrogen, the process comprising: (A) flowing the fluid mixture into a microchannel separator, the microchannel separator comprising a plurality of process microchannels containing a sorption medium, the fluid mixture being maintained in the microchannel separator until at least part of the methane or nitrogen is sorbed by the sorption medium, and removing non-sorbed parts of the fluid mixture from the microchannel separator; and (B) desorbing the methane or nitrogen from the sorption medium and removing the desorbed methane or nitrogen from the microchannel separator. The process is suitable for upgrading methane from coal mines, landfills, and other sub-quality sources.

  12. Effect of irrigation disruption and biological nitrogen on growth and ...

    African Journals Online (AJOL)

    In addition, the maximum (4.29 %) harvest index was obtained from irrigation disruption at third and second harvest with 9 L/ha of nitroxin application. In conclusion, lower amounts of nitrogen was needed to produced the optimal yield of seed in water deficit situation compared with non stress condition, while the nitrogen ...

  13. Selective autophagy of non-ubiquitylated targets in plants: looking for cognate receptor/adaptor proteins

    Directory of Open Access Journals (Sweden)

    Vasko eVeljanovski

    2014-06-01

    Full Text Available Cellular homeostasis is essential for the physiology of eukaryotic cells. Eukaryotic cells, including plant cells, utilize two main pathways to adjust the level of cytoplasmic components, namely the proteasomal and the lysosomal/vacuolar pathways. Macroautophagy is a lysosomal/vacuolar pathway which, until recently, was thought to be non-specific and a bulk degradation process. However, selective autophagy which can be activated in the cell under various physiological conditions, involves the specific degradation of defined macromolecules or organelles by a conserved molecular mechanism. For this process to be efficient, the mechanisms underlying the recognition and selection of the cargo to be engulfed by the double-membrane autophagosome are critical, and not yet well understood. Ubiquitin (poly-ubiquitin conjugation to the target appears to be a conserved ligand mechanism in many types of selective autophagy, and defined receptors/adaptors recognizing and regulating the autophagosomal capture of the ubiquitylated target have been characterized. However, non-proteinaceous and non-ubiquitylated cargoes are also selectively degraded by this pathway. This ubiquitin-independent selective autophagic pathway also involves receptor and/or adaptor proteins linking the cargo to the autophagic machinery. Some of these receptor/adaptor proteins including accessory autophagy-related (Atg and non-Atg proteins have been described in yeast and animal cells but not yet in plants. In this review we discuss the ubiquitin-independent cargo selection mechanisms in selective autophagy degradation of organelles and macromolecules and speculate on potential plant receptor/adaptor proteins.

  14. Nitrogen

    Science.gov (United States)

    Apodaca, Lori E.

    2013-01-01

    The article presents an overview of the nitrogen chemical market as of July 2013, including the production of ammonia compounds. Industrial uses for ammonia include fertilizers, explosives, and plastics. Other topics include industrial capacity of U.S. ammonia producers CF Industries Holdings Inc., Koch Nitrogen Co., PCS Nitrogen, Inc., and Agrium Inc., the impact of natural gas prices on the nitrogen industry, and demand for corn crops for ethanol production.

  15. Reliable protein folding on non-funneled energy landscapes: the free energy reaction path

    OpenAIRE

    Lois, Gregg; Blawzdziewicz, Jerzy; O'Hern, Corey S.

    2008-01-01

    A theoretical framework is developed to study the dynamics of protein folding. The key insight is that the search for the native protein conformation is influenced by the rate r at which external parameters, such as temperature, chemical denaturant or pH, are adjusted to induce folding. A theory based on this insight predicts that (1) proteins with non-funneled energy landscapes can fold reliably to their native state, (2) reliable folding can occur as an equilibrium or out-of-equilibrium pro...

  16. Exchange of nitrogenous substances between the body pool and the digestive tract in ruminants

    International Nuclear Information System (INIS)

    Boda, K.; Varady, J.; Havassy, I.; Kosta, K.; Fejes, J.; Kowalczyk, J.

    1976-01-01

    For a period of three months the only source of nitrogen in a group of sheep fed on a synthetic protein-free diet was perorally administered urea, and for a further period of three months intravenously administered urea. It was found that there was practically no variation in the weight of the animals and in the nitrogen balance. The total content of nitrogen and amino-nitrogen in the rumen with intravenous nitrogenous feeding showed that the rumen is adequately supplied with endogenous nitrogen. A clear-cut increase - by a factor of 2 - was observed in the endogenous metabolism as a whole. In experiments on sheep with a fistula of the rumen, duodenum or ileum, it was found that nitrogenous matter (total and microbic), synthesized from the 15 N of intravenously administered urea, is transported by the digestive apparatus with the common nitrogenous substances. In the rumen-duodenum part these substances are mainly secreted and in the intestinal part reabsorbed. Of the 15 N that passed through the duodenum, 73-84% was reabsorbed. Of the administered material, 4.8-5.7% was eliminated in the faeces. In experiments on sheep with an isolated intestine, it was observed that the secretion of blood urea, mainly in the forward part of the jejunum, is relatively high (3.4-3.9mg/h, whereas the rate of NH 3 production due to hydrolysis is relatively low (0.28-0.35mg/h). Of the 15 N-urea introduced via the fistula into the forward part of the jejunum, the average amount of 15 N remaining in the organism is 63%. Equal amounts of 15 N were eliminated in the urine, altogether 37%. It is assumed that the exchange of nitrogen between the digestive apparatus and the body pool is an important link in the nitrogen metabolism of ruminants. The blood urea and synthesized nitrogenous substances are important sources of nitrogen for digestive processes and for protein synthesis. The entire digestive apparatus participates in the utilization of ureal nitrogen. (author)

  17. An ab initio chemical reaction model for the direct simulation Monte Carlo study of non-equilibrium nitrogen flows.

    Science.gov (United States)

    Mankodi, T K; Bhandarkar, U V; Puranik, B P

    2017-08-28

    A new ab initio based chemical model for a Direct Simulation Monte Carlo (DSMC) study suitable for simulating rarefied flows with a high degree of non-equilibrium is presented. To this end, Collision Induced Dissociation (CID) cross sections for N 2 +N 2 →N 2 +2N are calculated and published using a global complete active space self-consistent field-complete active space second order perturbation theory N 4 potential energy surface and quasi-classical trajectory algorithm for high energy collisions (up to 30 eV). CID cross sections are calculated for only a selected set of ro-vibrational combinations of the two nitrogen molecules, and a fitting scheme based on spectroscopic weights is presented to interpolate the CID cross section for all possible ro-vibrational combinations. The new chemical model is validated by calculating equilibrium reaction rate coefficients that can be compared well with existing shock tube and computational results. High-enthalpy hypersonic nitrogen flows around a cylinder in the transition flow regime are simulated using DSMC to compare the predictions of the current ab initio based chemical model with the prevailing phenomenological model (the total collision energy model). The differences in the predictions are discussed.

  18. Whole-body protein turnover in malnourished patients with child class B and C cirrhosis on diets low to high in protein energy.

    Science.gov (United States)

    Dichi, J B; Dichi, I; Maio, R; Correa, C R; Angeleli, A Y; Bicudo, M H; Rezende, T A; Burini, R C

    2001-03-01

    The purpose of this study was to determine the rate of whole-body protein turnover in moderately and severely alcoholic, malnourished, cirrhotic patients fed with different amounts of protein or energy. Six male patients (Child classes B and C) and four age- and sex-matched healthy control subjects were studied for 18 d in fasting and feeding states; a single oral dose of [(15)N]glycine was used as a tracer and urinary ammonia was the end product. The kinetic study showed that patients had higher protein catabolism while fasting (patients: 3.14 +/- 1.2 g of lean body mass/9 h; controls: 1.8 +/- 0.3 g of lean body mass/9 h; P hyperproteic/hyperenergetic diet when compared with fasting. Nitrogen retention was consistent with the lower protein-catabolism rate; a statistically significant increase in nitrogen balance was observed when patients were fed with the hyperproteic/hyperenergetic diet compared with fasting (4.3 +/- 3.2 g of nitrogen/d and -2.2 +/- 1.9 g of nitrogen/d, respectively; P hyperproteic/hyperenergetic diet is likely needed to improve their clinical and nutritional status.

  19. Novel European free-living, non-diazotrophic Bradyrhizobium isolates from contrasting soils that lack nodulation and nitrogen fixation genes - a genome comparison

    Science.gov (United States)

    Jones, Frances Patricia; Clark, Ian M.; King, Robert; Shaw, Liz J.; Woodward, Martin J.; Hirsch, Penny R.

    2016-05-01

    The slow-growing genus Bradyrhizobium is biologically important in soils, with different representatives found to perform a range of biochemical functions including photosynthesis, induction of root nodules and symbiotic nitrogen fixation and denitrification. Consequently, the role of the genus in soil ecology and biogeochemical transformations is of agricultural and environmental significance. Some isolates of Bradyrhizobium have been shown to be non-symbiotic and do not possess the ability to form nodules. Here we present the genome and gene annotations of two such free-living Bradyrhizobium isolates, named G22 and BF49, from soils with differing long-term management regimes (grassland and bare fallow respectively) in addition to carbon metabolism analysis. These Bradyrhizobium isolates are the first to be isolated and sequenced from European soil and are the first free-living Bradyrhizobium isolates, lacking both nodulation and nitrogen fixation genes, to have their genomes sequenced and assembled from cultured samples. The G22 and BF49 genomes are distinctly different with respect to size and number of genes; the grassland isolate also contains a plasmid. There are also a number of functional differences between these isolates and other published genomes, suggesting that this ubiquitous genus is extremely heterogeneous and has roles within the community not including symbiotic nitrogen fixation.

  20. Protein (Cyanobacteria): 428309600 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :1418 ... nitrogen fixation protein Microcoleus sp. PCC 7113 MTATNTTTETTTEEILAKPLMQELVKQIRGQDSYGTYRTWSDELLLKPFIVSKERKRKISVDGDVDLVTKARI...MAFYRAIAARIEQETGLLGQVIIDLSHEGFGWALVFCGRLLVVAKTLRDAQRFGFDSFEKLDAEGEKLLQKGIDLAKRYPEVGNI