WorldWideScience

Sample records for nils petter molvaer

  1. Arvustused / Aleks Lange

    Index Scriptorium Estoniae

    Lange, Aleks

    2000-01-01

    Uute heliplaatide Nils Petter Molvaer "Solid Ether", Leona Naess "Comatised", Naivity in Black II "A Tribute to Black Sabbath", Papa Roach "Infest", A Perfect Circle "Mer de Noms", Queens of the Stone Age "Rated R", "Road Trip" (soundtrack) tutvustused

  2. Jean-Jacques Petter. Primates

    Directory of Open Access Journals (Sweden)

    Bruno Simmen

    2010-12-01

    Full Text Available Voici un magnifique ouvrage grand format sur les Primates dont l’auteur principal est le regretté Jean Jacques Petter, l’un des spécialistes historiques des prosimiens de Madagascar. Ce livre, publié à titre posthume, a une histoire que nous découvrons dans la préface d’Yves Coppens. A l’origine pensé et rédigé par Jean-Jacques Petter, qui a été professeur au Muséum National d’Histoire Naturelle, l’ouvrage interrompu à sa mort en 2002 a été remis en chantier sous l’impulsion de sa femme Arlet...

  3. Die Glorifikation des heiligen Wenzels - ein abgelehntes Werk des Wiener Malers Anton Petter aus dem Jahre 1844 für den Olmützer Dom

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    -, č. 2 (2014), s. 148-159 ISSN 1805-3742 Institutional support: RVO:68378033 Keywords : romantic painting * altarpieces * Olomouc cathedral * Anton Petter Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Prévision de la corrosion des coussinets et corrélation avec l'essai sur moteur Petter W1 L Predicting Bearing Wear and Correlation with the Petter W1 L Engine Test

    Directory of Open Access Journals (Sweden)

    Desvard A.

    2006-11-01

    Full Text Available Parmi les essais exigés par les spécifications européennes et américaines pour huiles de moteurs, il existe un essai de résistance à la corrosion des coussinets de bielles en cuivre-plomb (tableau 1. Ces essais sont effectués sur moteurs monocylindre Petter W1 L ou Labeco CLR (tableau 2. Des résultats de corrosion obtenus sur le moteur Petter W1 L, avec des huiles de calibrage, sont donnés (tableau 4 et les courbes de corrosion en fonction du temps d'essai sont représentées figure 1. En utilisant ces mêmes huiles, un groupe de travail du GFC*, chargé de développer des méthodes d'essai laboratoire de présélection, a mis au point un test basé sur le suivi de la corrosion d'une éprouvette de plomb, en présence de cuivre, immergée dans le lubrifiant à évaluer, lorsque celui-ci est soumis à des conditions d'oxydation sévères, en présence d'air, à haute température (fig. 2. Les résultats obtenus sont en parfaite concordance avec les résultats sur moteurs (tableau 5 et fig. 3. Par ailleurs, ces essais mettent en évidence une excellente répétabilité (fig. 4,et une excellente reproductibilité (fig. 5 et 6 de la méthode de laboratoire. * GFC : Groupement Français de Coordination, pour le développement des essais de performance des combustibles, des lubrifiants pour moteurs et autres fluides utilisés dans les transports. Among the tests required by European and American specifications for motor oils, there is a test of the corrosion resistance of copper-lead bearings (Table 1. These tests are performed in single-cylinder Petter W1 L engines or Labeco CLR engines (Table 2. The corrosion results obtained with the Petter W1 L engine, for calibration oils, are given (Table 4, and the corrosion curves as a function of time are shown in Fig. 1. By using the same oils, a GFC working group responsible for developing laboratory preselection test methods has developed a test based on the determining of the corrosion of a lead

  5. Study of nanoimprint lithography (NIL) for HVM of memory devices

    Science.gov (United States)

    Kono, Takuya; Hatano, Masayuki; Tokue, Hiroshi; Kobayashi, Kei; Suzuki, Masato; Fukuhara, Kazuya; Asano, Masafumi; Nakasugi, Tetsuro; Choi, Eun Hyuk; Jung, Wooyung

    2017-03-01

    A low cost alternative lithographic technology is desired to meet the decreasing feature size of semiconductor devices. Nano-imprint lithography (NIL) is one of the candidates for alternative lithographic technologies.[1][2][3] NIL has such advantages as good resolution, critical dimension (CD) uniformity and low line edge roughness (LER). On the other hand, the critical issues of NIL are defectivity, overlay, and throughput. In order to introduce NIL into the HVM, it is necessary to overcome these three challenges simultaneously.[4]-[12] In our previous study, we have reported a dramatic improvement in NIL process defectivity on a pilot line tool, FPA-1100 NZ2. We have described that the NIL process for 2x nm half pitch is getting closer to the target of HVM.[12] In this study, we report the recent evaluation of the NIL process performance to judge the applicability of NIL to memory device fabrications. In detail, the CD uniformity and LER are found to be less than 2nm. The overlay accuracy of the test device is less than 7nm. A defectivity level of below 1pcs./cm2 has been achieved at a throughput of 15 wafers per hour.

  6. nilR is necessary for co-ordinate repression of Xenorhabdus nematophila mutualism genes.

    Science.gov (United States)

    Cowles, Charles E; Goodrich-Blair, Heidi

    2006-11-01

    The bacterial mutualist Xenorhabdus nematophila colonizes a specific region of its nematode host Steinernema carpocapsae. We previously reported the identification of a chromosomal locus encoding three X. nematophila genes of unknown function, nilA, B and C, that are each necessary for colonization. Subsequent work indicated the global regulator Lrp is a repressor of nilC: nilC transcription is elevated in an lrp mutant and Lrp interacts directly with the nilC promoter. In this manuscript, we report the identification of an additional gene, nilR, required for repression of nilC transcription. We show that nilR and lrp mutants also have elevated expression of nilA and nilB, demonstrating that nilA, B and C are co-ordinately regulated. nil gene expression is derepressed most strongly when both nilR and lrp are lacking, suggesting NilR and Lrp synergistically repress nil transcription. NilR contains a helix-turn-helix-type DNA binding domain and likely acts directly at promoters. A comparison of the wild type and nilR proteomes indicates that NilR, unlike Lrp, regulates a small number of genes. Finally, X. nematophila carrying an ectopic copy of nilR colonizes at approximately 60-fold lower levels than the control strain, suggesting that derepression of nil gene expression is necessary for nematode colonization.

  7. Automatic detection of NIL defects using microscopy and image processing

    KAUST Repository

    Pietroy, David

    2013-12-01

    Nanoimprint Lithography (NIL) is a promising technology for low cost and large scale nanostructure fabrication. This technique is based on a contact molding-demolding process, that can produce number of defects such as incomplete filling, negative patterns, sticking. In this paper, microscopic imaging combined to a specific processing algorithm is used to detect numerically defects in printed patterns. Results obtained for 1D and 2D imprinted gratings with different microscopic image magnifications are presented. Results are independent on the device which captures the image (optical, confocal or electron microscope). The use of numerical images allows the possibility to automate the detection and to compute a statistical analysis of defects. This method provides a fast analysis of printed gratings and could be used to monitor the production of such structures. © 2013 Elsevier B.V. All rights reserved.

  8. The role of stamens in ethylene production in Ipomoea nil

    International Nuclear Information System (INIS)

    Kiss, H.G.

    1989-01-01

    Ethylene production inhibits filament and corolla growth during young stages in flower development, and it promotes corolla unfolding and senescence in Ipomoea nil. Initial studies with the in vitro application of gibberellic acid (GA 3 ), demonstrated that decreased filament growth occurred when the anthers remained attached to the filaments during the young stages in development. The removal of the anthers from intact plants did not enhance filament growth until the synthesis of wound ethylene was inhibited by applied aminoethoxyvinylglycine (AVG) or cobalt chloride. It was hypothesized that the anthers were source tissues and that the filaments were transport vectors for the ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC) and indole-3-acetic acid (IAA) to regulate growth events in the various floral organs. To test this hypothesis, endogenous IAA and ACC and ethylene production were measured by enzyme linked immunosorbent assay (ELISA) or gas chromatography. The transport of 14 C-IAA and 14 C-ACC through filament segments and filaments within intact flower buds also was examined during flower development

  9. UV-NIL replication of microlens arrays on flexible fluoropolymer substrates

    DEFF Research Database (Denmark)

    Jucius, Dalius; Lazauskas, Algirdas; Grigaliūnas, Viktoras

    2018-01-01

    This paper describes application of UV-NIL technique for the fabrication of hexagonal OrmoComp microlens arrays on flexible fluoropolymer substrates having exceptional chemical resistance, stability at elevated temperatures and high transmittance in the UV, visible, and infrared regions...... of the spectrum. Uniform and well-defined patterns of close-packed convex microlenses were formed in OrmoComp layers on H2 plasma treated FEP and ETFE substrates by UV-NIL replication of the metalized and liquid paraffin antiadhesive coated negative OrmoComp replicas of the master mold. UV-NIL replication...

  10. Shock wave energy dissipation behavior (SWED) in Network forming ionic liquids (NILs): A Molecular dynamics study

    Science.gov (United States)

    Guda Vishnu, Karthik; Strachan, Alejandro

    2017-06-01

    SWED materials play a crucial role in protecting both personnel and structures in close proximity to blasts or ballistic impact. Exposure to shock waves with intensities as low as 1 MPa can cause brain injury in personnel and, hence, it is extremely important to understand the mechanisms operating in SWED materials and help design improved formulations. Recent experimental studies show that NILs containing di-ammonium cations and citrate anions with glass transition temperatures (Tg) below room temperature exhibit shockwave absorption characteristics that outperform polyurea (PU), a benchmark SWED assessment material. The experimentalists further hypothesized that the increased SWED ability in NILs with longer side chains (in di-ammonium cation) is due to a permanent structural ordering and nano-scale segregation. We use molecular dynamics simulations with the Dreiding force field to study shock propagation mechanisms in NILs. Shock propagation mechanisms in these materials are explored by performing both Hugoniostat and large scale non-equilibrium molecular dynamics (NEMD) simulations at 300 K. The simulation results show that the NIL 5-6 (5 C atoms (back bone) and 6 C atoms (side chain)) attenuates shocks better than NIL 5-3 (3 C atoms (side chain) and higher Tg) and PMMA in agreement with experimental observation. The simulations show that under shock loading the structures lose long range order; we find no evidence of nano-segregation nor or permanent structural changes.

  11. Optimization of droplets for UV-NIL using coarse-grain simulation of resist flow

    Science.gov (United States)

    Sirotkin, Vadim; Svintsov, Alexander; Zaitsev, Sergey

    2009-03-01

    A mathematical model and numerical method are described, which make it possible to simulate ultraviolet ("step and flash") nanoimprint lithography (UV-NIL) process adequately even using standard Personal Computers. The model is derived from 3D Navier-Stokes equations with the understanding that the resist motion is largely directed along the substrate surface and characterized by ultra-low values of the Reynolds number. By the numerical approximation of the model, a special finite difference method is applied (a coarse-grain method). A coarse-grain modeling tool for detailed analysis of resist spreading in UV-NIL at the structure-scale level is tested. The obtained results demonstrate the high ability of the tool to calculate optimal dispensing for given stamp design and process parameters. This dispensing provides uniform filled areas and a homogeneous residual layer thickness in UV-NIL.

  12. Comparison of "Nil by Mouth" Versus Early Oral Intake in Three Different Diet Regimens Following Esophagectomy

    DEFF Research Database (Denmark)

    Eberhard, Kristine Elisabeth; Achiam, Michael Patrick; Rolff, Hans Christian

    2017-01-01

    : regimen 1, nil by mouth until postoperative day (POD) 7 followed by a normal diet; regimen 2, oral intake of clear fluids from POD 1 followed by a normal diet; regimen 3, nil by mouth until POD 7 followed by a slow increase to a blended diet. The outcome endpoints were: (1) anastomotic leakage, (2......) complications [severity and number described using the Dindo-Clavien Classification and Comprehensive Complication Index (CCI)] and (3) length of stay. A multivariate logistic regression model was obtained for CCI and anastomotic leakage using Wald's stepwise selection. RESULTS: CCI was significantly lower...... analyses revealed that high American Society of Anesthesiologist score was a predicting factor for both CCI and anastomotic leakage. CONCLUSION: The study indicates that nil by mouth until postoperative day 7 followed by a slow increase to a blended diet after esophagectomy results in less severe...

  13. Citizenship and Children's Identity in "The Wonderful Adventures of Nils" and "Scouting for Boys"

    Science.gov (United States)

    Sundmark, Bjorn

    2009-01-01

    "The Wonderful Adventures of Nils" (1906-1907) by Selma Lagerlof and "Scouting for Boys" (1908) by Robert Baden-Powell are characteristic of their time and their respective national and cultural contexts--the Swedish nation state of the early twentieth century and the British Empire. Taking its cue from recent theories on…

  14. Viking Line'i lahkuva "kapteni" 9 põhimõtet / Nils-Erik Eklund

    Index Scriptorium Estoniae

    Eklund, Nils-Erik

    2009-01-01

    2009. aasta 1. juunil 50-aastaseks saanud laevakompanii Viking Line ametist lahkuv juht Nils-Erik Eklund vastab küsimustele, mis puudutavad oma isa, Viking Line'i asutaja Gunnar Eklundi jälgedes käimist, ettevõtte võimalikku laienemist teistesse tegevusaladesse, peamisi juhtimispõhimõtteid ning keerulisemaid hetki Viking Line'i ajaloos

  15. Antibacterial Activity of Pharbitin, Isolated from the Seeds of Pharbitis nil, against Various Plant Pathogenic Bacteria.

    Science.gov (United States)

    Nguyen, Hoa Thi; Yu, Nan Hee; Park, Ae Ran; Park, Hae Woong; Kim, In Seon; Kim, Jin-Cheol

    2017-10-28

    This study aimed to isolate and characterize antibacterial metabolites from Pharbitis nil seeds and investigate their antibacterial activity against various plant pathogenic bacteria. The methanol extract of P. nil seeds showed the strongest activity against Xanthomonas arboricola pv. pruni (Xap) with a minimum inhibition concentration (MIC) value of 250 μg/ml. Among the three solvent layers obtained from the methanol extract of P. nil seeds, only the butanol layer displayed the activity with an MIC value of 125 μg/ml against Xap. An antibacterial fraction was obtained from P. nil seeds by repeated column chromatography and identified as pharbitin, a crude resin glycoside, by instrumental analysis. The antibacterial activity of pharbitin was tested in vitro against 14 phytopathogenic bacteria, and it was found to inhibit Ralstonia solanacearum and four Xanthomonas species. The minimum inhibitory concentration values against the five bacteria were 125-500 μg/ml for the n-butanol layer and 31.25-125 μg/ml for pharbitin. In a detached peach leaf assay, it effectively suppressed the development of bacterial leaf spot, with a control value of 87.5% at 500 μg/ml. In addition, pharbitin strongly reduced the development of bacterial wilt on tomato seedlings by 97.4% at 250 μg/ml, 7 days after inoculation. These findings suggest that the crude extract of P. nil seeds can be used as an alternative biopesticide for the control of plant diseases caused by R. solanacearum and Xanthomonas spp. This is the first report on the antibacterial activity of pharbitin against phytopathogenic bacteria.

  16. The effect of exogenous acetylcholine and other cholinergic agents on photoperiodic flower induction of Pharbitis nil

    Directory of Open Access Journals (Sweden)

    Hanna Łukasiewicz-Rutkowska

    2014-01-01

    Full Text Available Exogenous acetylcholine (ACh, acetylcholinesterase (AChE inhibitors, as well as agonists and antagonists of ACh receptors applied on the cotyledons of 5-day-old seedlings of Pharbitis nil during a 16-hour long inductive night or during a 12-hour long subinductive night, do not essentially influence the flower bud formation. Also the application of above mentioned substances to the seedlings growing under the conditions of 72 hours of darkness, 24 hours of light and then 24 hours of darkness does not influence in an essential way flowering of P. nil. On the other hand, applying these substances on the cotyledons of P. nil during 24-hour-long inductive night, preceded by 72 hours of darkness and then 24 hours of light of lowered intensity finished by 15-minute-long impulse of far red light which inhibit flowering, caused the reversion of the effect of far red light irradiation and stimulated the flowering. The obtained results suggest that endogenous system ACh/AChE could participate in the mechanism of a phytochrome controlled flowering of short day plants.

  17. Resistless Fabrication of Nanoimprint Lithography (NIL Stamps Using Nano-Stencil Lithography

    Directory of Open Access Journals (Sweden)

    Juergen Brugger

    2013-10-01

    Full Text Available In order to keep up with the advances in nano-fabrication, alternative, cost-efficient lithography techniques need to be implemented. Two of the most promising are nanoimprint lithography (NIL and stencil lithography. We explore here the possibility of fabricating the stamp using stencil lithography, which has the potential for a cost reduction in some fabrication facilities. We show that the stamps reproduce the membrane aperture patterns within ±10 nm and we validate such stamps by using them to fabricate metallic nanowires down to 100 nm in size.

  18. On the theory of pre- p-nil -rings | Oduwale | Journal of the Nigerian ...

    African Journals Online (AJOL)

    Generalizing the concept of p-rings, Abian and Mcworter [1] call an associative and commutative ring R with characteristic p a pre-p-ring if xyy = xyy for every x and y in R. It was proved in [1] that every pre-p-ring R is a direct sum R = B ⊕ N of a p-ring B and a nil ring N, where even xy+2 = 0 for every χ∈N . It was also proved ...

  19. Effect of the crack-starter weld condition on the nil-ductility transition temperature

    International Nuclear Information System (INIS)

    Satoh, Masanobu; Funada, Tatsuo; Tomimatsu, Minoru

    1985-01-01

    In ASME Code Sec. III, the value of the reference nil-ductility temperature RT sub(EDT) has an important significance to determine the result of the fracture mechanics evaluation. While in the standard both the drop-weight test and Charpy impact test are required to determine the RT sub(NDT), in practice it is normally determined only by the nil-ductility transition temperature (T sub(EDT)) obtained by the drop-weight test. The cases of data scatter in T sub(NDT) were investigated to establish appropriate conditions of crack-starter bead welding. Drop-weight tests were carried out for nuclear vessel steels by changing welding conditions to examine the effects of welding amperage and shapes of welding table on T sub(NDT). The results show that the preparation of crack-starter bead by small welding amperage should not be allowed, because it makes the measured T sub(NDT) non-conservative, and that it is important to use a welding table which increases the cooling rate of specimen. Furthermore, the authors proposed methods for estimating T sub(NDT) of nuclear vessel steels by using Charpy transition temperatures. (author)

  20. Wounding stimulates ALLENE OXIDE SYNTHASE gene and increases the level of jasmonic acid in Ipomoea nil cotyledons

    Directory of Open Access Journals (Sweden)

    Emilia Wilmowicz

    2016-03-01

    Full Text Available Allene oxide synthase (AOS encodes the first enzyme in the lipoxygenase pathway, which is responsible for jasmonic acid (JA formation. In this study we report the molecular cloning and characterization of InAOS from Ipomoea nil. The full-length gene is composed of 1662 bp and encodes for 519 amino acids. The predicted InAOS contains PLN02648 motif, which is evolutionarily conserved and characteristic for functional enzymatic proteins. We have shown that wounding led to a strong stimulation of the examined gene activity in cotyledons and an increase in JA level, which suggest that this compound may be a modulator of stress responses in I. nil.

  1. Identification and characterization of an Ipomoea nil glucosyltransferase which metabolizes some phytohormones

    International Nuclear Information System (INIS)

    Suzuki, Hiroyuki; Hayase, Hiroki; Nakayama, Akira; Yamaguchi, Isomaro; Asami, Tadao; Nakajima, Masatoshi

    2007-01-01

    A glucosyltransferase gene InGTase1 was identified from the immature seeds of morning glory (Ipomoea nil), whose product shows a broad substrate-preference, including that of some phytohormones. When 2-trans-abscisic acid, indole-3-acetic acid, salicylic acid (SA) or (±)-jasmonic acid was reacted with InGTase1 and UDP-[ 14 C]-glucose, each 14 C-labeled compound with high polarity was detected after thin layer chromatography. SA metabolites were identified as SA glucosyl ester by using 1 H NMR and GC/MS. Detailed substrate-preferences of InGTase1 were examined with some analogous compounds, which elucidated that the arm length and/or orientation of a carboxyl group of the compounds or its surrounding electron density severely affected the enzymatic activity. The broad substrate-preference will greatly contribute to the synthesis of various glucoconjugates

  2. Treatment of disseminated granuloma annulare with oral vitamin E: 'primum nil nocere'.

    Science.gov (United States)

    Poppe, Heiko; Poppe, Lidia M; Goebeler, Matthias; Trautmann, Axel

    2013-01-01

    Disseminated granuloma annulare (DGA) is a benign and usually asymptomatic skin disease. However, many patients feel aesthetically disfigured and ask for treatment. Until today, no standard therapy is recommended. To evaluate the safety and efficacy of oral vitamin E treatment compared to the natural course of DGA. This single-centre observational cohort study included 38 consecutive patients with histologically confirmed DGA. 21 patients underwent treatment with oral vitamin E, whereas 17 patients preferred a wait-and-see approach. Complete healing (40%) and improvement (30%) were frequently seen under oral vitamin E therapy. However, DGA also spontaneously disappeared in 31% and improved in 25% of untreated control patients. Vitamin E therapy was very well tolerated. Oral vitamin E treatment is a safe and probably effective therapy for DGA. As the natural course of DGA leads to complete healing or significant improvement in many cases, 'primum nil nocere' should be the maxim.

  3. Nils Silfverskiöld (1888-1957) and gastrocnemius contracture.

    Science.gov (United States)

    Singh, Dishan

    2013-06-01

    Nils Silfverskiöld was an orthopaedic surgeon, Swedish aristocrat, bon vivant, Olympic gymnast, left wing intellectual and anti-Nazi who described that the force required to dorsiflex the ankle in spastic equinus contracture decreased with knee flexion in isolated gastrocnemius contracture. He advocated detaching the origins of the gastrocnemii from the femur and reattaching them to the tibia. The Silfverskiöld knee flexion test has now also been adapted to distinguish between isolated gastrocnemius contracture and combined shortening of the gastrocnemius-soleus complex in non-spastic contracture by measuring the range of ankle dorsiflexion with the knee flexed and the knee straight. Copyright © 2012 European Foot and Ankle Society. Published by Elsevier Ltd. All rights reserved.

  4. Bridging the gap in heart failure prevention: rationale and design of the Nurse-led Intervention for Less Chronic Heart Failure (NIL-CHF) Study

    DEFF Research Database (Denmark)

    Carrington, Melinda J; Stewart, Simon; de Courten, Barbora

    2010-01-01

    AIMS: The primary objective of the Nurse-led Intervention for Less Chronic Heart Failure (NIL-CHF) Study is to develop a programme of care that cost-effectively prevents the development of chronic heart failure (CHF). Methods NIL-CHF is a randomized controlled trial of a hybrid, home- and clinic-...

  5. L-NIL prevents renal microvascular hypoxia and increase of renal oxygen consumption after ischemia-reperfusion in rats

    NARCIS (Netherlands)

    Legrand, Matthieu; Almac, Emre; Mik, Egbert G.; Johannes, Tanja; Kandil, Asli; Bezemer, Rick; Payen, Didier; Ince, Can

    2009-01-01

    Legrand M, Almac E, Mik EG, Johannes T, Kandil A, Bezemer R, Payen D, Ince C. L-NIL prevents renal microvascular hypoxia and increase of renal oxygen consumption after ischemia-reperfusion in rats. Am J Physiol Renal Physiol 296: F1109-F1117, 2009. First published February 18, 2009;

  6. Who is the Little Old Lady of International Crimes? Nils Christie’s concept of the Ideal Victim Reinterpreted

    NARCIS (Netherlands)

    van Wijk, J.

    2013-01-01

    This article discusses to what extent Nils Christie's famous stereotype of the 'ideal victim' is applicable in a context of international crimes. It argues that the characteristics of the ideal victim of genocide, crimes against humanity and war crimes largely overlap with the ideal victim of

  7. Gln3p and Nil1p regulation of invertase activity and SUC2 expression in Saccharomyces cerevisiae.

    Science.gov (United States)

    Oliveira, Edna Maria Morais; Mansure, José João; Bon, Elba Pinto da Silva

    2005-04-01

    In Saccharomyces cerevisiae, sensing and signalling pathways regulate gene expression in response to quality of carbon and nitrogen sources. One such system, the target of rapamycin (Tor) proteins, senses nutrients and uses the GATA activators Gln3p and Nil1p to regulate translation in response to low-quality carbon and nitrogen. The signal transduction, triggered in response to nitrogen nutrition that is sensed by the Tor proteins, operates via a regulatory pathway involving the cytoplasmic factor Ure2p. When carbon and nitrogen are abundant, the phosphorylated Ure2p anchors the also phosphorylated Gln3p and Nil1p in the cytoplasm. Upon a shift from high- to low-quality nitrogen or treatment with rapamycin all three proteins are dephosphorylated, causing Gln3p and Nil1p to enter the nucleus and promote transcription. The genes that code for yeast periplasmic enzymes with nutritional roles would be obvious targets for regulation by the sensing and signalling pathways that respond to quality of carbon and nitrogen sources. Indeed, previous results from our laboratory had shown that the GATA factors Gln3p, Nil1p, Dal80p, Nil2p and also the protein Ure2 regulate the expression of asparaginase II, coded by ASP3. We also had observed that the activity levels of the also periplasmic invertase, coded by SUC2, were 6-fold lower in ure2 mutant cells in comparison to wild-type cells collected at stationary phase. These results suggested similarities between the signalling pathways regulating the expression of ASP3 and SUC2. In the present work we showed that invertase levels displayed by the single nil1 and gln3 and by the double gln3nil1 mutant cells, cultivated in a sucrose-ammonium medium and collected at the exponential phase, were 6-, 10- and 60-fold higher, respectively, in comparison to their wild-type counterparts. RT-PCR data of SUC2 expression in the double-mutant cells indicated a 10-fold increase in the mRNA(SUC2) levels.

  8. Development of 25 near-isogenic lines (NILs) with ten BPH resistance genes in rice (Oryza sativa L.): production, resistance spectrum, and molecular analysis.

    Science.gov (United States)

    Jena, Kshirod K; Hechanova, Sherry Lou; Verdeprado, Holden; Prahalada, G D; Kim, Sung-Ryul

    2017-11-01

    A first set of 25 NILs carrying ten BPH resistance genes and their pyramids was developed in the background of indica variety IR24 for insect resistance breeding in rice. Brown planthopper (Nilaparvata lugens Stal.) is one of the most destructive insect pests in rice. Development of near-isogenic lines (NILs) is an important strategy for genetic analysis of brown planthopper (BPH) resistance (R) genes and their deployment against diverse BPH populations. A set of 25 NILs with 9 single R genes and 16 multiple R gene combinations consisting of 11 two-gene pyramids and 5 three-gene pyramids in the genetic background of the susceptible indica rice cultivar IR24 was developed through marker-assisted selection. The linked DNA markers for each of the R genes were used for foreground selection and confirming the introgressed regions of the BPH R genes. Modified seed box screening and feeding rate of BPH were used to evaluate the spectrum of resistance. BPH reaction of each of the NILs carrying different single genes was variable at the antibiosis level with the four BPH populations of the Philippines. The NILs with two- to three-pyramided genes showed a stronger level of antibiosis (49.3-99.0%) against BPH populations compared with NILs with a single R gene NILs (42.0-83.5%) and IR24 (10.0%). Background genotyping by high-density SNPs markers revealed that most of the chromosome regions of the NILs (BC 3 F 5 ) had IR24 genome recovery of 82.0-94.2%. Six major agronomic data of the NILs showed a phenotypically comparable agronomic performance with IR24. These newly developed NILs will be useful as new genetic resources for BPH resistance breeding and are valuable sources of genes in monitoring against the emerging BPH biotypes in different rice-growing countries.

  9. SEM AutoAnalysis: enhancing photomask and NIL defect disposition and review

    Science.gov (United States)

    Schulz, Kristian; Egodage, Kokila; Tabbone, Gilles; Ehrlich, Christian; Garetto, Anthony

    2017-06-01

    For defect disposition and repair verification regarding printability, AIMS™ is the state of the art measurement tool in industry. With its unique capability of capturing aerial images of photomasks it is the one method that comes closest to emulating the printing behaviour of a scanner. However for nanoimprint lithography (NIL) templates aerial images cannot be applied to evaluate the success of a repair process. Hence, for NIL defect dispositioning scanning, electron microscopy (SEM) imaging is the method of choice. In addition, it has been a standard imaging method for further root cause analysis of defects and defect review on optical photomasks which enables 2D or even 3D mask profiling at high resolutions. In recent years a trend observed in mask shops has been the automation of processes that traditionally were driven by operators. This of course has brought many advantages one of which is freeing cost intensive labour from conducting repetitive and tedious work. Furthermore, it reduces variability in processes due to different operator skill and experience levels which at the end contributes to eliminating the human factor. Taking these factors into consideration, one of the software based solutions available under the FAVOR® brand to support customer needs is the aerial image evaluation software, AIMS™ AutoAnalysis (AAA). It provides fully automated analysis of AIMS™ images and runs in parallel to measurements. This is enabled by its direct connection and communication with the AIMS™tools. As one of many positive outcomes, generating automated result reports is facilitated, standardizing the mask manufacturing workflow. Today, AAA has been successfully introduced into production at multiple customers and is supporting the workflow as described above. These trends indeed have triggered the demand for similar automation with respect to SEM measurements leading to the development of SEM AutoAnalysis (SAA). It aims towards a fully automated SEM image

  10. "Nil per oral after midnight": Is it necessary for clear fluids?

    Directory of Open Access Journals (Sweden)

    Kajal S Dalal

    2010-01-01

    Full Text Available Fasting before general anaesthesia aims to reduce the volume and acidity of stomach contents, thus reducing the risk of regurgitation and aspiration. Recent guidelines have recommended a shift in fasting policies from the standard ′nil per oral from midnight′ to a more relaxed policy of clear fluid intake a few hours before surgery. The effect of preoperative oral administration of 150 ml of water 2 h prior to surgery was studied prospectively in 100 ASA I and II patients, for elective surgery. Patients were randomly assigned to two groups. Group I (n = 50 was fasting overnight while Group II (n = 50 was given 150 ml of water 2 h prior to surgery. A nasogastric tube was inserted after intubation and gastric aspirate was collected for volume and pH. The gastric fluid volume was found to be lesser in Group II (5.5 ± 3.70 ml than Group I (17.1 ± 8.2 ml which was statistically significant. The mean pH values for both groups were similar. Hence, we conclude that patients not at risk for aspiration can be allowed to ingest 150 ml water 2 h prior to surgery.

  11. Experiments towards establishing of design rules for R2R-UV-NIL with polymer working shims

    Science.gov (United States)

    Nees, Dieter; Ruttloff, Stephan; Palfinger, Ursula; Stadlober, Barbara

    2016-03-01

    Roll-to-Roll-UV-nanoimprint lithography (R2R-UV-NIL) enables high resolution large area patterning of flexible substrates and is therefore of increasing industrial interest. We have set up a custom-made R2R-UV-NIL pilot machine which is able to convert 10 inch wide web with velocities of up to 30 m/min. In addition, we have developed self-replicable UV-curable resins with tunable surface energy and Young's modulus for UV-imprint material as well as for polymer working stamp/shim manufacturing. Now we have designed test patterns for the evaluation of the impact of structure shape, critical dimension, pitch, depth, side wall angle and orientation relative to the web movement onto the imprint fidelity and working shim life time. We have used female (recessed structures) silicon masters of that design with critical dimensions between CD = 200 nm and 1600 nm, and structure depths of d = 500 nm and 1000 nm - all with vertical as well as inclined side walls. These entire master patterns have been transferred onto single male (protruding structures) R2R polymer working shims. The polymer working shims have been used for R2R-UV-NIL runs of several hundred meters and the imprint fidelity and process stability of the various test patterns have been compared. This study is intended as a first step towards establishing of design rules and developing of nanoimprint proximity correction strategies for industrial R2R-UV-NIL processes using polymer working shims.

  12. Hausse du niveau des océans et perte de terres dans le delta du Nil ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 juin 2016 ... Au moyen de systèmes d'information géographique (SIG), des chercheurs subventionnés par le CRDI ont déterminé les zones littorales du delta du Nil qui pourraient être touchées par la hausse du niveau des océans. Il pourrait en résulter d'importantes pertes de terres d'ici 2100. Selon les plus récentes ...

  13. Learning from eponyms: Jose Verocay and Verocay bodies, Antoni A and B areas, Nils Antoni and Schwannomas

    Directory of Open Access Journals (Sweden)

    Rajiv Joshi

    2012-01-01

    Full Text Available Schwannomas are benign peripheral nerve sheath neoplasms composed almost entirely of Schwann cells and are diagnosed histopathologically by the presence of singular architectural patterns called Antoni A and Antoni B areas. These were described first in 1920 by the Swedish neurologist Nils Antoni. The Antoni A tissue is highly cellular and made up of palisades of Schwann cell nuclei, a pattern first described in 1910 by the Uruguayan neuro-pathologist Jose Verocay and are known as Verocay bodies. This article describes the structure and appearance of Verocay bodies and Antoni A and B areas with a brief biographical introduction of the men who described these patterns.

  14. Effects of Cotyledon Area and Gibberellin A3 on Photoperiodic Flower Induction in Pharbitis nil Seedlings

    OpenAIRE

    Ogawa, Yukiyoshi; 小川, 幸持

    1993-01-01

    The relationship between the cotyledon area reduced before or after an inductive dark period and its photoperiodic response was examined with Pharbitis nil seedlings. Plants with 0.25- to 1-cm2 cotyledon area flowered, showing almost the same critical length of dark period, 11 or 12 h, as is the case with a single intact cotyledon (about 8.5 cm2), but the floral response of plants with reduced cotyledon area did not increase with dark periods longer than 14 h, but it was far greater per unit ...

  15. Standard test method for conducting drop-weight test to determine nil-ductility transition temperature of ferritic steels

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2006-01-01

    1.1 This test method covers the determination of the nil-ductility transition (NDT) temperature of ferritic steels, 5/8 in. (15.9 mm) and thicker. 1.2 This test method may be used whenever the inquiry, contract, order, or specification states that the steels are subject to fracture toughness requirements as determined by the drop-weight test. 1.3 The values stated in inch-pound units are to be regarded as the standard. 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  16. Bernstein, Nils: „kennen sie mich herren/meine damen und herren”. Phraseologismen in Moderner Lyrik am Beispiel von Ernst Jandl und Nicanor Parra.

    Directory of Open Access Journals (Sweden)

    Urška Valenčič Arh

    2013-12-01

    Full Text Available Bernstein, Nils (2011: „kennen sie mich herren/meine damen und herren”. Phraseologismen in Moderner Lyrik am Beispiel von Ernst Jandl und Nicanor Parra. Würzburg: Königshausen&Neumann. ISBN: 978-3-8260-4699-5, mehka vezava, 262 strani, 38,00 EUR

  17. Radiopharmaceuticals 1994. Nil desperandum

    International Nuclear Information System (INIS)

    Cox, P.H.; Meyer, G.J.

    1995-01-01

    On the basis of the discussions at a symposium held in Duesseldorf and attended by representatives of various interested bodies, European legislation as it affects radiopharmaceuticals is reviewed. Due consideration is given to the new, centralised and decentralised, registration procedures, effective since 1 January 1995. The dossier required to support an application for marketing authorisation is discussed, separate consideration being given to single-photon emitters, therapeutic radio-nuclides and positron-emitting radiopharmaceuticals. The role of the European Pharmacopoiea is also considered. It is concluded that the new, modified procedures for the registration of medicinal products in the European Union may actually inhibit free availability of radiopharmaceuticals within the Community, and that there is a strong case for modification of the European Directives so that radiopharmaceuticals are placed in a separate category to therapeutic drugs, with less stringent registration requirements. (orig.)

  18. Potencialidad de la región costera de Córdoba -Colombia- para el cultivo de tilapia nilótica

    OpenAIRE

    Oviedo P, Misael; Brú C, Samir; Atencio G, Víctor; Pardo C, Sandra

    2013-01-01

    RESUMENObjetivo. Identificar las áreas con alta potencialidad para el cultivo de tilapia nilótica en la región costera de Córdoba, Colombia. Materiales y métodos. Cinco capas de información fueron incorporadas en un sistema de información geográfica: ubicación potencial de estanques, calidad del suelo, calidad del agua, infraestructura vial, población, limitantes y restricciones. Se recopiló información cartográfica, se revisaron los planes de ordenamiento territorial (POT) de los municipios ...

  19. Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene

    International Nuclear Information System (INIS)

    Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yipan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

    2012-01-01

    Use wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2* were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2* have identical contribute on quality. Breeder should attach to 1Ax1 and 1Ax2* identically on wheat breeding. (authors)

  20. Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene

    International Nuclear Information System (INIS)

    Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yifan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

    2011-01-01

    Use wheat 1Ax1 and 1Ax2 * NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2 * were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2 * have identical contribute on quality. Breeder should atlach to 1Ax1 and 1Ax2 * identically on wheat breeding. (authors)

  1. Interferência e nível de dano econômico de Brachiaria plantaginea e Ipomoea nil na cultura do feijão comum Interference and economic threshold of Brachiaria plantaginea and Ipomoea nil in the common bean crop

    Directory of Open Access Journals (Sweden)

    Ribas Antonio Vidal

    2010-08-01

    Full Text Available As pesquisas acerca do impacto da interferência das plantas daninhas sobre as culturas normalmente são realizadas com uma única espécie infestante, quando na realidade podem ocorrer diversas. Os objetivos deste trabalho foram avaliar a interferência de Brachiaria plantaginea e Ipomoea nil sobre o rendimento de grãos do feijoeiro (Phaseolus vulgaris e determinar o nível de dano econômico (NDE de cada espécie na cultura. Foram realizados dois experimentos a campo com as cultivares de feijão 'IPR Graúna' (Grupo Preto e 'UTF-06' (Grupo Carioca em convivência com infestações mistas em diferentes proporções aleatórias das espécies B. plantaginea e I. nil. Modelos de regressão múltiplos foram utilizados para determinar a capacidade de interferência de cada espécie daninha sobre a produtividade da cultura. O impacto de interferência de cada planta de I. nil correspondeu a 2,6 e 0,25 quando comparada a cada planta de B. plantaginea, dependente das proporções relativas na comunidade infestante e das condições de cada experimento. A cultivar 'IPR Graúna' apresentou maior habilidade competitiva do que 'UTF-06'. O NDE foi dependente da proporção relativa de cada espécie daninha na comunidade e foi obtido sob baixas infestações (The researches about the impact of weed interference on crops are usually performed with a single weed species, when in reality there are numerous. The objective of this study was to evaluate the interference of Brachiaria plantaginea and Ipomoea nil on the grain yield of French beans (Phaseolus vulgaris and to determine the economic weed threshold (EWT of each species on the crop. Two field experiments were conducted with bean cultivars 'IPR Graúna' (Black group and 'UTF-06' (Carioca group in coexistence with random proportions of mixed infestations of B. plantaginea and I. nil. Multiple regression models were used to determine the interference abi1lity of each weed species on crop productivity. The

  2. Determinación y prevalencia de Mycobacterium spp., en tilapia nilótica (Oreochromis niloticus cultivada en Campeche, México

    Directory of Open Access Journals (Sweden)

    Maurilio Lara-Flores

    2013-03-01

    Full Text Available Objetivo. Determinar la presencia y prevalencia de Mycobacterium spp., en granjas de tilapia nilótica (Oreochromis niloticus en el Municipio de Champotón, Campeche, México. Materiales y métodos. La colecta de organismos se realizó en tres granjas de cultivo de tilapia nilótica del municipio de Champotón, Campeche, México. Los organismos se examinaron externa e internamente y se tomó una muestra de riñón la cual fue sembrada en forma de estría en medios de cultivo: Löwesntein-Jensen, TCBS, KF y en TSA; las placas fueron incubadas a 35°C de 24 a 48 horas, los órganos fueron fijados en formalina tamponada al 10% para ser procesados para histología de rutina para análisis posteriores. Asimismo, muestras de cultivo bacteriológico y de tejido fueron teñidas con la técnica de Ziel-Neelsen con el fin de observar la presencia de bacilos ácido-alcohol resistentes. Resultados. Los resultados obtenidos sugieren que la presencia de Mycobacterium spp., es constante y en alta prevalencia y puede ser un factor que este mermando la rentabilidad del cultivo. Conclusiones. La presencia de Mycobacterium spp., representa un riesgo para el cultivo de tilapia en el municipio de Champotón, por ser una enfermedad muy persistente y difícil de erradicar una vez ocurrido e brote de infección, por lo cual es importante llevar estudios más detallados de la presencia de este género bacteriano, así como, medidas de prevención y dispersión de este patógeno en los cultivos adyacentes.

  3. Potencialidad de la región costera de Córdoba -Colombia- para el cultivo de tilapia nilótica

    Directory of Open Access Journals (Sweden)

    Misael Oviedo P.

    2013-11-01

    Full Text Available Objetivo. Identificar las áreas con alta potencialidad para el cultivo de tilapia nilótica en la región costera de Córdoba, Colombia. Materiales y métodos. Cinco capas de información fueron incorporadas en un sistema de información geográfica: ubicación potencial de estanques, calidad del suelo, calidad del agua, infraestructura vial, población, limitantes y restricciones. Se recopiló información cartográfica, se revisaron los planes de ordenamiento territorial (POT de los municipios costeros, se obtuvieron imágenes de satélite de la zona y se tomaron muestras de agua y suelo; esta información fue evaluada, organizada e introducida en la base de datos de sistemas de información geográfica (SIG. Se aplicaron herramientas de análisis espacial y se establecieron modelos de análisis que permitieron la generación e integración de los diferentes temas y la construcción final del mapa de aptitud para el cultivo de tilapia. Resultados. El 2% del área de estudio resultó apta para el cultivo de tilapia nilótica. El alto índice de necesidades básicas insatisfechas (NBI y las deficiencias en la infraestructura vial tuvieron efecto negativo sobre la potencialidad para la tilapicultura. Altas concentraciones de hierro y ligera acidez en algunas áreas posibilitan la presencia de suelos sulfatados ácidos. La alta turbidez y sólidos suspendidos afectaron la calidad del agua, además de la reducida capacidad de drenaje que en algunas áreas evidencian los riesgos de inundación. Conclusiones. El municipio de San Antero presentó la mejor aptitud para el cultivo de tilapia; sin embargo el área deltaico-estuarina, los ambientes lacustres y sus alrededores en la cuenca baja del Sinú, no resultaron aptos.

  4. Hikâyet-i Nil-i Mübârek Üzerine The Story Of The Holy Nile

    Directory of Open Access Journals (Sweden)

    Yusuf Ziya SÜMBÜLLÜ

    2012-12-01

    yakın temasa geçmiştir. Bu temas, öncelikle dil ve edebiyat sahasında etkili olmuştur. Tercüme ve adaptasyon faaliyetleri ile ivme kazanan bu kültürel etkileşim döneminde, dini-ahlâki-didaktik nitelikte pek çok eser, Türk Edebiyatı sahasında bu suretle var olabilmiştir. Bahsi geçen eserlerin ana hatlarıyla ideal insan, ideal toplum prensibi ekseninde, ağırlıklı olarak dini ve ahlâki içerikli bir kimlik ile karşımıza çıktığı ifade edilebilir ki bu türden eserlerden bir bölümünü de kıssalar oluşturur. Nîl Nehri���nin kaynağına duyulan merak ve bu merakın giderilmesi adına başlatılan dini-fantastik içerikli maceralı yolculuğu anlatan “Hikâye-i Abdülmecid” adlı kıssa da bahsi geçen türün özelliklerini barındıran bir eser olmakla çalışmamızın genel çerçevesini oluşturmaktadır. Bilinmeyene duyulan merak ve bu merakın giderilmesi adına söylenenler veya icra edilenler, ister istemez etraflarında dini, sihri, mistik olağanüstülüklerin iç içe geçerek işlenmesi sonucunu doğurabilir. “Hikâye-i Abdülmecid” adlı eserde, Abdülmecid’in Nil Nehri’nin kaynağını arayışı, halkın Cennet, Cebrail gibi dini konulardaki algısını yansıtıyor olmanın yanında, Kevser, Nil, Zemzem gibi suların kaynak olarak kutsal bir kökene nasıl bağlanmış olduğuna da işaret etmektedir. Nil Nehri, Fırat Nehri gibi “Mübarek” sıfatı ile yüceltilmiş ve İslâm nehri olarak sayılmıştır. Bu sıfat, nehrin Mısır ve havalisindeki bütün zirai hayatın doğal olarak da insan hayatının can damarı olması münasebetiyle olabileceği gibi, nehrin kaynağının oldukça uzun bir süre tespit edilememesiyle de ilgili olsa gerektir ki Nîl Nehri’nin kaynağının gizeminin oldukça eski ve sık işlenmiş bir tema olduğunu da burada ifade etmek gerekecektir.

  5. Belaja krov : [luuletused] / Nil Nerlin

    Index Scriptorium Estoniae

    Nerlin, Nil, pseud., 1937-2015

    2001-01-01

    Sisu: "Sneg poroshil ijulskim dnjom..." ; "Svet: svet bez plameni (vernulsja li staruhha..." ; Zatvornik ; Pro memoria ; Voronovo krõlo ; Masterskaja metafizitsheskogo realizma ; Monahhi ; Trioditseja ; "etot inei nevessom..." ; Garmonija ; S vostoka na zapad ; Podlog

  6. Comprehensive gene expression analysis of the NAC gene family under normal growth conditions, hormone treatment, and drought stress conditions in rice using near-isogenic lines (NILs) generated from crossing Aday Selection (drought tolerant) and IR64.

    Science.gov (United States)

    Nuruzzaman, Mohammed; Sharoni, Akhter Most; Satoh, Kouji; Moumeni, Ali; Venuprasad, Ramiah; Serraj, Rachid; Kumar, Arvind; Leung, Hei; Attia, Kotb; Kikuchi, Shoshi

    2012-05-01

    The NAC (NAM, ATAF1/2 and CUC2) genes are plant-specific transcriptional factors known to play diverse roles in various plant developmental processes. We describe the rice (Oryza sativa) OsNAC genes expression profiles (GEPs) under normal and water-deficit treatments (WDTs). The GEPs of the OsNAC genes were analyzed in 25 tissues covering the entire life cycle of Minghui 63. High expression levels of 17 genes were demonstrated in certain tissues under normal conditions suggesting that these genes may play important roles in specific organs. We determined that 16 genes were differentially expressed under at least 1 phytohormone (NAA, GA3, KT, SA, ABA, and JA) treatment. To investigate the GEPs in the root, leaf, and panicle of three rice genotypes [e.g., 2 near-isogenic lines (NILs) and IR64], we used two NILs from a common genetic combination backcross developed by Aday Selection and IR64. WDTs were applied using the fraction of transpirable soil water at severe, mild, and control conditions. Transcriptomic analysis using a 44K oligoarray from Agilent was performed on all the tissue samples. We identified common and specific genes in all tissues from the two NILs under both WDTs, and the majority of the OsNAC genes that were activated were in the drought-tolerant IR77298-14-1-2-B-10 line compared with the drought-susceptible IR77298-14-1-2-B-13 or IR64. In IR77298-14-1-2-B-10, seventeen genes were very specific in their expression levels. Approximately 70 % of the genes from subgroups SNAC and NAM/CUC3 were activated in the leaf, but 37 % genes from subgroup SND were inactivated in the root compared with the control under severe stress conditions. These results provide a useful reference for the cloning of candidate genes from the specific subgroup for further functional analysis.

  7. Caracterización de coproductos de la industria del fileteado de tilapia nilótica (oreochromis niloticus) y trucha arcoíris (oncorhynchus mykiss) en colombia

    OpenAIRE

    Osorio, A.; Wills, A.; Muñoz, A. P.

    2013-01-01

    La industria del fileteado de tilapia y trucha genera cantidades significativas de coproductos de los cuales no existe suficiente información disponible sobre su composición y calidad. Esta investigación determinó algunos componentes nutricionales y microbiológicos de coproductos obtenidos en plantas exportadoras de filetes de tilapia nilótica y trucha arcoíris en Colombia. El esqueleto mostró el mayor aporte de cenizas (tilapia: 14,12 ± 0,16%; trucha: 6,18 ± 0,06%), calcio (tilapia: 5,7...

  8. Efecto del procesamiento de la dieta sobre el desempeño productivo de tilapia nilótica (Oreochromis niloticus var. Chitralada en un ciclo comercial de producción

    Directory of Open Access Journals (Sweden)

    F. Aguilar

    2010-06-01

    Full Text Available Este estudio evaluó el efecto del procesamiento de alimento (extruido frente a peletizadosobre el desempeño productivo de tilapia nilótica durante un ciclo comercial deproducción. Se utilizaron 504 alevinos reversados que fueron alimentados con un sistemade alimentación por fases (alevinaje, crecimiento 1, crecimiento 2 y finalizacióncon niveles de proteína cruda para cada fase de 43,10%, 36,40%, 31,50% y 28,65%respectivamente. Las dietas fueron procesadas (extruidas o peletizadas en micro extrusorapara laboratorio Exteec® (Exteec máquinas, Brasil. El análisis de los indicadoresacumulados mostró que el proceso de extrusión generó un mayor crecimiento y unamayor eficiencia en el uso de alimento hasta la fase de crecimiento 2 (P

  9. Kvoodiraha jagati Tambovi konstandi alusel / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2011-01-01

    Riik sai CO₂ kvoodiraha vähemalt 234 enda hoonele ja omavalitsused 239 objektile, see raha jagati aga 106 omavalitsusele ehk vähem kui pooltele kõigist 226 vallast ja linnast. Kaart: CO₂ kvoodiraha jagus vähem kui pooltele omavalitsustele; Diagramm: Riigi ja omavalitsuste objektid maakonniti

  10. Muzõka tshissel : [luuletused] / Nil Nerlin

    Index Scriptorium Estoniae

    Nerlin, Nil, pseud., 1943-

    2000-01-01

    Sisu: "mirokolitsõ kolokol..." ; "vokrug obuglennogo diska..." ; "oblutshajushtshim vinu..." ; "zvjaknut kljutshi o zhelezo..." ; F. I. T. : iz transkriptsi ; A. D. S. ; Sumtshatõi zverjok ; Inferno-final : promezhutotshnõi reportazh ; Fundament ; Reliktovoje izutshenije ; Los Alamos ; "prosti zluju zorkost (pozornõi moi plen)..."

  11. Regio tooted liiguvad maailmaturule / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2005-01-01

    Ilmunud ka: Tartu Postimees 16. mai, lk. 1. Välisriikides Reach-U kaubamärgi all tegutsev Regio laiendab tegevust - Saudi Araabia, Araabia Ühendemiraatide, India ja Rumeenia mobiilsideoperaatorid hakkavad kasutama ettevõtte väljatöötatud tarkvara ja kaarte. Lisa: Regio positsioneerimistooted

  12. Rae nahaalne skeem soosis lemmikuid / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2007-01-01

    Tartu linnavalitsuse maadevahetuse tehingust Reformierakonnaga seotud ettevõtjate Verni Loodmaa, Kalev Kase ja Alar Kroodo firmaga Kvintett Kinnisvara. Skeem: Maadevahetus linnavalitsuse tagatoas. Vt. samas: Lihtinimest ähvardab sundvõõrandamine

  13. Ekskantslerit ei kollita huvide konflikt / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2010-01-01

    Kaitseministeeriumi vastuse kohaselt vaatasid sealsed audiitorid üle teadus-arendustegevususe uurimistoetuste maksmise ja seni sõlmitud lepingud ning selgus, et kahtlustused, nagu oleks kaitseministeeriumi endine kantsler Lauri Almann oma eraäri juba kantslerina ette valmistanud, ei vasta tõele. Autor vabandab Lauri Almanni ees

  14. Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel

  15. Meltsiveski Konsumist saab korteritega supermarket / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2005-01-01

    Meltsiveski Konsumi kõrvale ehitatakse uus hoone, kus saab olema 30 korterit ja supermarket ning viimase katusel mängu- ja puhkeala. Juurdeehituse projekteeris arhitektuuribüroo Pluss arhitekt Indrek Allmann

  16. UEFA ametnik laitis staadionide seisukorda / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    UEFA noorte- ja amatöörjalgpalli projektijuht Claudio Negroni andis Tartu ja selle lähiümbruse staadionidele ebarahuldava hinde. Tamme staadionil tehakse 16 miljonit krooni maksev remont, et seal saaks 2007.a. toimuda 19-aastaste noormeeste Euroopa jalgpalli meistrivõistluste finaalturniir

  17. Vsja tvar zemnaja : [luuletused] / Nil Nerlin

    Index Scriptorium Estoniae

    Nerlin, Nil, pseud., 1943-

    2001-01-01

    Sisu: Ne otrõvaja pera ; Freska ; Psõ ; Vesna-ossen ; "pust nemotoju iskussanõ gubõ..." ; Nepodrazhajemõi ; O vneshnei tme ; "izumrudnuju vodu vnizu (i mazut..." ; Tramvainoje sozhalenije ; Strekoza i muravei ; Ulitka ; Kolonnõi zal ; A. G. : neproshenoje prishestvije ; Vek ritoriki ; notshnõje provodõ rozhdestvenski ledok..."

  18. Maanoored peibutavad vanemaid internetti / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Internetifirma Kernel tegevjuhi Raivo Laatsi hinnangul soovivad internetiühendust eelkõige pere nooremad liikmed, Tartumaal kiiret sideteenust pakkuv ettevõte on kolme aastaga viinud selle mitmesaja maapereni

  19. Mormoonid kopeerivad Eesti arhiive / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2010-01-01

    Mormoonid koguvad genealoogilisi materjale üle maailma, mille põhjenduseks on usuliste talituste tegemine surnute eest. Siseministeerium, Tallinna linnaarhiiv ja ajalooarhiiv sõlmisid lepingu mormoonidega seotud Utah' Genealoogilise Seltsiga läinud kümnendi algul

  20. Avangardi kanalast sai moodne biodiislitehas / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Vennad Ergo ja Elvo Themas on endises Avangardi kolhoosi kanalas sisse seadnud biodiislitehase, mille turuks saavad esialgu Saksamaa ja Rootsi kütuse hulgimüüjad. Kaart: Biodiislitehas alustab märtsis

  1. Final report NIL/HTI: Sectional report 'Inspections'. Eindrapport NIL/HTI: Deelproject 'Inspecties'

    Energy Technology Data Exchange (ETDEWEB)

    Hulshof, H J.M.; Van Gestel, P J; Dufour, L B [KEMA Inspection Technology, Arnhem (Netherlands)

    1994-01-01

    The results of the title project are important for the monitoring of the condition of components in electric power plants that are exposed to high temperatures for a long period. A measuring method (SPICA) has been developed, by which the elongation distribution on the surface of a construction component can be analyzed. The measurement is based on making an optical fingerprint of circa 1 cm[sup 2] of the surface, applying the parameter surface roughness. A photo or video shot can show the differences of the reflected light in the form of light and dark spots (specks). If the surface stretches, the roughness profile changes and so does the pattern of specks. By comparing the takes before and after a load period the deformation can be determined and with that the material fatigue. By means of an image computer the images can easily be manipulated and stored. Statistical methods determine the number, the location and the periodicity, by which replicas must be produced to provide reliable data for the residual service life

  2. Житиейный текст в «Соборнике» Нила Сорского: перевод или пересказ?(The Vitae of Nil Sorskii’s “Sobornik”: Translation or Periphrasis?

    Directory of Open Access Journals (Sweden)

    Tamara Lönngren

    2003-02-01

    Full Text Available This paper attempts to show that Nil Sorskii, the author of the well-known three-volume "Sobornik", in compiling this collection of ancient Greek vitae used Greek texts as well as Slavonic translations. He compared the Slavonic texts with the Greek originals and corrected their difficult archaic language, thus turning it into the understandable simple Russian language of his own time.

  3. Of Climate Change and Crystal Balls: The Future Consequences of Climate Change in Africa

    Science.gov (United States)

    2012-01-01

    Stationarity Is Dead For most of human existence, climate determined where and how we lived. Homo sapiens emerged sometime within the past half million...no. 1 ( January 2012): 35–50. 62. Schuyler Null, “ El Niño, Conflict, and Environmental Determinism: Assessing Climate’s Links to Instability,” New...Security Beat, 5 October 2011, http://www.newsecuritybeat.org/2011/10/ el -nino-conflict- and-environmental.html. 63. Ragnhild Nordås and Nils Petter

  4. Toxicidade aguda e efeitos histopatológicos do herbicida diquat na brânquia e no fígado da tilápia nilótica (Oreochromis niloticus = Acute toxicity and histopathologic effects of diquat herbicide on the gill and liver of nile tilapia (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Matheus Nicolino Peixoto Henares

    2008-01-01

    Full Text Available A concentração letal 50% e os efeitos histopatológicos do herbicida diquat para a tilápia nilótica (Oreochromis niloticus foram avaliados em três experimentos. Os peixes foram expostos às concentrações de 0; 25; 30; 35; 40; 45; 50; 55; e 60 mg de diquat L-1 e a histologia da brânquia e do fígado foi avaliada nos peixes sobreviventes. A CL (I 50-96h do diquat estimada foi de 37,28 mg L-1, com limite inferior de 33,12 mg L-1 e superior de 41,44mg L-1. No tratamento com 30, 35 e 40 mg L-1, ocorreram início de fusão apical das lamelas secundárias; com 45 e 50 mg L-1 ocorreram congestão nas lamelas primárias e no tratamento com 55 mg L-1, ocorreu congestão sangüínea nas lamelas secundárias. O fígado dos peixes dos tratamentos controle, 30 e 35 mg L-1 estavam com organização cordonal dos hepatócitos. Nos tratamentos com 40 e 45 mg L-1, ocorreram hipertrofia dos hepatócitos; com 50 e 55 mg L-1 ocorreram fusão celular e presença de vacúolos. O diquat apresentoubaixo risco de intoxicação à tilápia nilótica e as alterações histopatológicas mais severas ocorreram somente nas concentrações mais elevadas.The lethal concentration of 50% (LC (I 50-96h and the histopathologic effects of diquat herbicide on Nile tilapia (Oreochromis niloticus fish were evaluated in three experiments. The fishes were exposed to concentrations of 0, 25, 30, 35, 40, 45, 50, 55 and 60 mg diquat L-1, and gill and liver histology were evaluated in the surviving fishes. The estimated LC (I (50-96h of diquat was37.28 mg L-1, with lower limits of 33.12 mg L-1 and upper limits of 41.44 mg L-1. In the treatment with 30, 35 and 40 mg L-1, signs of apical fusion of the secondary lamellae were observed; with 45 and 50 mg L-1, congestion of the primary lamellae was observed; in thetreatment with 55 mg L-1, congestion of blood vessels on secondary lamellae took place. The livers of fishes in treatments with 0, 25, 30 and 35 mg L-1 showed cordonal

  5. Automatic detection of NIL defects using microscopy and image processing

    KAUST Repository

    Pietroy, David; Gereige, Issam; Gourgon, Cé cile

    2013-01-01

    patterns, sticking. In this paper, microscopic imaging combined to a specific processing algorithm is used to detect numerically defects in printed patterns. Results obtained for 1D and 2D imprinted gratings with different microscopic image magnifications

  6. Tartu autotootja hakkab Ferrari koopiaid ehitama / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2007-01-01

    Seni Lotus Seveni koopiaid tootnud Võidutehnika AS, Valter Teppani perefirma, hakkab müüma kallimaid autosid - Ford GT40 kui ka Ferrari 330 P4 koopiaid. Ilmunud ka: Postimees, 27. sept. 2007, lk. 9

  7. Laudarobot muudab lehmasõnniku elektriks / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Vt. ka Tartu Postimees 7. märts, lk. 1. Laudarobot lüpsab USAs Pennsylvania osariigis lehma ilma inimese abita, toob sööda ette ja viib sõnniku ära, võtab piimaproovi, toodab biogaasist elektrit. Sama tüüpi masin hakkab tuleval aastal töötama ka Tartumaal

  8. Tarkon pürib Euroopas liidriks / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2008-01-01

    Tarkon laiendab oma ettevõtet, eesmärgiga hõivata valdkonna Euroopa liidri positsioon. Suurem osa firma toodangust läheb telekomi-, tööstus- ja kliimaseadmete tootjatele. Vt. samas: Hanza kontserni osa

  9. Samõje dorogije kostjumõ / Nil Santelman

    Index Scriptorium Estoniae

    Santelman, Nil

    2004-01-01

    Ultramoodsatest ülikondadest ja nende hindadest. Uuritakse tuntud moeloojate YSL, Gucci, Dolce&Gabbana, Valentino, Calvin Kleini valmistooteid ja individuaaltellimuste võimalusi, samuti individuaalõmblejate William Fiovanti (New York), Caraceni (Milano), H. Huntsmani, Anderson&Sheppardi (London) jt. töid

  10. Nil Bohr-sets and almost automorphy of higher order

    CERN Document Server

    Huang, Wen; Ye, Xiangdong

    2016-01-01

    Two closely related topics, higher order Bohr sets and higher order almost automorphy, are investigated in this paper. Both of them are related to nilsystems. In the first part, the problem which can be viewed as the higher order version of an old question concerning Bohr sets is studied: for any d\\in \\mathbb{N} does the collection of \\{n\\in \\mathbb{Z}: S\\cap (S-n)\\cap\\ldots\\cap (S-dn)\

  11. ERA-pankurid võivad pattu kahetseda / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2002-01-01

    Tartu maakohtu kohtunik andis ERA Grupi üheksa eksjuhi suurprotsessil riiklikule süüdistajale ja kohtualustele kaks nädalat aega protsessi lahendamiseks lihtmenetluse teel, kuid selleks peavad endised pankurid end süüdi tunnistama

  12. Perfil lipídico e composição química de tilápias nilóticas em diferentes condições de cultivo Lipid profile and chemical composition of Nile tilapia under different raising conditions

    Directory of Open Access Journals (Sweden)

    Antônio Carlos Silveira Gonçalves

    2011-03-01

    Full Text Available Objetivou-se com este trabalho avaliar o perfil lipídico e a composição química dos filés de tilápia nilótica (Oreochromis niloticus mantida em três condições de cultivo, por um período de 120 dias. Foram utilizados 2075 machos sexados de tilápia, distribuídos em dois tanques de terra e um tanque de alvenaria. Os tratamentos aplicados foram: dieta base em tanque de alvenaria; dieta base em tanque de terra e alimentação natural por meio de fertilização química e orgânica em tanque de terra. O delineamento experimental foi inteiramente casualizado, com três tratamentos e dez repetições. Os parâmetros avaliados foram: identificação do plâncton, perfil de ácidos graxos e teores de umidade, proteína bruta, extrato etéreo e cinzas dos filés. Os dados obtidos foram submetidos à análise de variância e as médias dos tratamentos foram comparadas pelo teste de Tukey (5% de significância. Foram encontrados cinco gêneros distintos de zooplâncton e quatro gêneros de fitoplâncton predominantes. Os resultados demonstraram não haver diferença estatística para o teor de umidade e cinzas dos filés. Porém, os animais mantidos no sistema fertilizado apresentaram filés com maior teor de proteína bruta e menor teor lipídico, além de uma melhor relação ômega-3/ômega-6, com maiores quantidades de DHA (ácido graxo docosahexaenóico.This study aimed to evaluate the lipid profile and the chemical composition of the fillets of Nile tilapia (Oreochromis niloticus maintained under three raising conditions, for a period of 120 days. A total of 2075 sexed males of tilapia were utilized, allotted into two ponds and one alvenaria pond. The applied treatments were: feeding with a basal diet in the alvenaria pond; feeding with the basal diet in the earthen pond and natural feeding through chemical and organic fertilization. The experimental design was in a completely randomized design, with three treatments and ten replicates

  13. Uus mõtlemine algab koolipingist / David White ; interv. Nils Niitra

    Index Scriptorium Estoniae

    White, David

    2006-01-01

    Ilmunud ka: Postimees 2. okt. lk. 5. Euroopa Komisjoni tööstuse peadirektoraadi innovatsioonipoliitika direktor käis Tartus Euroopa tehnoloogiasiirde IRC võrgustiku aastakonverentsil ja vastas küsimustele innovatsiooni kohta Euroopas, USA-s ja Eestis

  14. Maailma farmaatsiatööstus saab Tartust topeltkiirenduse / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Tänavu sügisel valmib Tartu Ülikoolis Euroopa Liidu rahastatud molekulaardisaini süsteem, mis kahandab uute ravimite väljatöötamise kestust maailmas seniselt 15 aastalt 7-8 aastani. Lisad: Mis on molekulaardisain?, Mis on grid? Vt. ka Postimehes pealk. all: Tartu Ülikool aitab ravimitootjaid

  15. Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

    Index Scriptorium Estoniae

    Häniläne,, pseud.

    2008-01-01

    Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

  16. Bekkerist võib saada sõjalaevastiku baas / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2000-01-01

    Teede- ja sideministeeriumis ja siseministeeriumis arutatakse Tallinna miinisadama müüki ja Eesti sõjalavastiku koondamist Bekkeri sadamasse. Vastuseks vt. Äripäev Feb/1 lk. 27 Tiit Maidre artiklit

  17. Vanausulised vahetavad võrgud sae ja haamri vastu / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Kallaste Kaluri juhi Fjodor Pleshankovi sõnul võib praegune kalanduspoliitika tuua ausate kalandusfirmade krahhi, sest kalurid lahkuvad ehitustöödele, mis on tulusam. Põllumajandusministeeriumi ametnike arvamusi

  18. Kõrgeimad tipud on kättesaadavad vaid valituile / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Tartu linnavalitsuse planeeringuteenistuse ja volikogu arengu- ja planeerimiskomisjoni erinevast suhtumisest ehitusfirmade Linnaehitus ja Lion House ehitusplaanidesse püstitada kõrghooneid. Vt. samas: Jüri Saare intervjuud endise abilinnapea Kaarel Sahaga: Tigutorn lisandub mitmete õigusvastaste ehitiste ritta; Jüri Saar. Linnavolinikud toimuvaga rahul

  19. Tartumaa väledad gasellfirmad on Eesti tipus / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Tartumaa ettevõtetest OÜ-st Viljavedaja, AS-ist EBÖ Eesti, OÜ-st Total Eesti ja OÜ-st Soone Farm, kes kuuluvad ajalehe Äripäev gasellide TOPi esiviisikusse. Lisa: Gaselli TOP. Soovitusi jagavad Tartu Teaduspargi esimees Toomas Noorem, OÜ Viljavedaja asutaja Rainer Puhk ja Nõo valla Soone farmi omanik Andres Tamm

  20. Rotaryst lahkunud Valev Platot ümbritsevad segased rahaasjad / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Endine kaitseministri nõunik Valev Plato lahkus Rotary klubi liikmete ridadest. 2003. aastal kõrvaldati ta Tartu Ülikooli Kääriku spordibaasi direktori ametikohalt segaduste tõttu rahaasjades. Tartu Rotary klubi presidendi Andrus Ansipi arvamus Plato klubist lahkumise kohta

  1. Varsti põrutab rong saja kahekümnega Riiga / Juhan Parts ; interv. Nils Niitra

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2007-01-01

    Majandus- ja kommunikatsiooniminister vastab küsimustele, mis puudutavad Tallinn-Tartu maantee ehitust, Rail Baltica rajamist, rahvusvahelist reisi- ja kaubarongiühendust, Tartu lennujaama investeeringuid ja doteerimist, Ahhaa teaduskeskuse rahastamist

  2. Kvoodiäri remondib riigi dividendilehma kaunimaid maju / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2011-01-01

    CO₂ kvoodirahaga hoonete energiasäästvaks muutmise objektide valik: raha saavad RMK kontorid. Kirikud jäid rahata. Valikutingimused: CO₂ sääst, kasusaajate arv, regionaalsed piirsummad, järjekord

  3. El sagrado codo nilótico en las iglesias alejandrinas del siglo IV

    OpenAIRE

    Aja Sánchez, José Ramón

    2015-01-01

    ABSTRACT: Some later Roman sources placed the “nilotic cubit” inside some Christian churches and pagan sanctuaries of Alexandria during the fourth century. The sacred device was the ritual archetype of the unit of measure used by the Egyptians for measuring height of Nile flood every year. The aim of this paper is to check the reliability of those sources closely related to the Alexandrian cubit.

  4. Eesti Energia ehtis end võõraste kuresulgedega / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2007-01-01

    Lõuna-Eesti traadita internetituru liider Kernel on üllatunud, et Eesti Energia tütarfirma Televõrk traadita internetivõrk Kõu kasutas reklaamiks nende kurepilti. Lisa: Eilseks kadunud kurejutt. Ilmunud ka: Postimees, 20. juuni 2007, lk. 4

  5. Analgesia, nil or placebo to babies, in trials that test new analgesic treatments for procedural pain.

    Science.gov (United States)

    Bellieni, Carlo V; Johnston, C Celeste

    2016-02-01

    This review assessed how often neonates in control groups experienced unnecessary pain during clinical trials involving procedural pain. We retrieved 45 studies in the 30 months up to June 2015 and found that in 29 (64%) the control babies received either placebos or no treatment. Placebos were used in 15/25 (60%) studies involving heel pricks and in 6/8 (75%) involving venepuncture. Despite international guidelines, neonates included in control groups during painful procedures do not receive analgesia in the majority of cases. Several historical reasons can explain this, but in the light of present knowledge, this should not continue. Ethical committees are thereof invited since now to not permit clinical trials that do not explicitly rule out pain during treatments and journals are invited to not publish them. ©2015 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.

  6. Haiglavoodisse sattunud patsiendid küsivad internetti / Nils Niitra, Sandra Maasalu

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2006-01-01

    Vt. ka Tartu Postimees 16. juuni, lk. 1 ; Postimees : na russkom jazõke 19. juuni, lk. 9. Pärnu haiglas saavad kõik patsiendid, kel tervis lubab, palatis sülearvutiga traadita internetti kasutada. Tartu ja Tallinna haiglates levib WiFi esialgu tagasihoidlikumalt - kui üldse, siis ainult osas ruumidest

  7. Redescription, systematic status and molecular characterisation of Multicaecum heterotis Petter, Vassiliadès et Marchand, 1979 (Nematoda: Heterocheilidae), an intestinal parasite of Heterotis niloticus (Osteichthyes: Arapaimidae) in Africa

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Moravec, František; Baruš, V.; Seifertová, M.

    2010-01-01

    Roč. 57, č. 4 (2010), s. 280-288 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Grant - others:GA ČR(CZ) GD526/09/H025 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Brevimulticaecum * Multicaecum * Senegal * Sudan * Africa * Heterotis * barcoding * 18S rDNA sequences * ITS2 sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  8. Contract formation and mistake in European contract law : a genetic comparison of transnational model rules / Nils Jansen, Reinhard Zimmermann

    Index Scriptorium Estoniae

    Jansen, Nils

    2011-01-01

    Euroopa lepinguõiguse normide analüüs ja võrdlus. PECL - The Principles of European Cntract Law ; CISG - United Nations Convention on Contracts for the International Sale of Goods ; DCFR - Draft Common Frame of Reference ; UNIDROIT - Principles of International Commercial Contracts

  9. Faire face à la marée : comment protéger le littoral du delta du Nil ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 nov. 2011 ... En plus de faire la lumière sur les effets physiques probables, ils examinent les facteurs de vulnérabilité sociale et économique des populations locales ainsi que les avantages et les inconvénients des différentes solutions d'adaptation. Leurs travaux ont été financés dans le cadre du programme ...

  10. Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2005-01-01

    ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu

  11. Faire face à la marée : comment protéger le littoral du delta du Nil ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    empêche pas l'infiltration d'eau de mer, qui menace l'approvisionnement en ... de recherche fait face est la communication du danger imminent aux responsables des politiques, dont beaucoup croient que le risque d'inondation ...

  12. The development of 8 inch roll-to-plate nanoimprint lithography (8-R2P-NIL) system

    Science.gov (United States)

    Lee, Lai Seng; Mohamed, Khairudin; Ooi, Su Guan

    2017-07-01

    Growth in semiconductor and integrated circuit industry was observed in the past decennium of years for industrial technology which followed Moore's law. The line width of nanostructure to be exposed was influenced by the essential technology of photolithography. Thus, it is crucial to have a low cost and high throughput manufacturing process for nanostructures. Nanoimprint Lithography technique invented by Stephen Y. Chou was considered as major nanolithography process to be used in future integrated circuit and integrated optics. The drawbacks of high imprint pressure, high imprint temperature, air bubbles formation, resist sticking to mold and low throughput of thermal nanoimprint lithography on silicon wafer have yet to be solved. Thus, the objectives of this work is to develop a high throughput, low imprint force, room temperature UV assisted 8 inch roll to plate nanoimprint lithography system capable of imprinting nanostructures on 200 mm silicon wafer using roller imprint with flexible mold. A piece of resist spin coated silicon wafer was placed onto vacuum chuck drives forward by a stepper motor. A quartz roller wrapped with a piece of transparent flexible mold was used as imprint roller. The imprinted nanostructures were cured by 10 W, 365 nm UV LED which situated inside the quartz roller. Heat generated by UV LED was dissipated by micro heat pipe. The flexible mold detaches from imprinted nanostructures in a 'line peeling' pattern and imprint pressure was measured by ultra-thin force sensors. This system has imprinting speed capability ranging from 0.19 mm/s to 5.65 mm/s, equivalent to imprinting capability of 3 to 20 pieces of 8 inch wafers per hour. Speed synchronization between imprint roller and vacuum chuck was achieved by controlling pulse rate supplied to stepper motor which drive the vacuum chuck. The speed different ranging from 2 nm/s to 98 nm/s is achievable. Vacuum chuck height was controlled by stepper motor with displacement of 5 nm/step.

  13. At være eller ikke at være

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2010-01-01

    ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner......ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner...

  14. Dicty_cDB: VSF787 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil...snyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlps agvgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkg nil

  15. Tartu Ülikooli robot päästab tenniseväljaku koristaja öötööst / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2010-01-01

    Tartu Tähtvere tennisekeskuse juht Egert Ivask tegi EAS-ile projekti innovatsiooniosaku saamiseks, et selle abil saaks teha koostööd Tartu Ülikooliga, mille üliõpilased on nüüdseks tennisekeskuse jaoks vajaliku koristusroboti peaaegu valmis saanud

  16. Élévation du niveau de la mer dans la zone côtière du delta du Nil

    International Development Research Centre (IDRC) Digital Library (Canada)

    l'eau, l'Institut d'études supérieures de l'Université d'Alexandrie et le Center for Development Services, une équipe de ... Selon un indice élaboré par l'équipe, les villes de Gamasa, ... La qualité du logement, des infrastructures et des services.

  17. Pop / Mart Kalvet

    Index Scriptorium Estoniae

    Kalvet, Mart, 1975-

    2008-01-01

    Heliplaatidest: Aeon Aethereal "Parasite Halls", The Bug "London Zoo", Dirty Pretty Things "Romance At Short Notice", Guillemots "Red", Four Tet "Ringer", The Fratellis "Here We Stand", Petter & The Pix "Easily Tricked", Ashanti "The Declaration", Joan as Police Woman "To Survive"

  18. Effect of Iron Deficiency Anemia on Intellectual Performance of ...

    African Journals Online (AJOL)

    Results: Seventy six of these children had iron deficiency anemia based on their .... Anorexia. 09. Nil. Pica. 07. 03. Dizziness. 04. Nil. Headache. 03. Nil. Table 4: Laboratory investigation ... environment on intelligence, the effect of nutrition.

  19. Le cône sous-marin du Nil et son réseau de chenaux profonds : nouveaux résultats (campagne Fanil)The Nile Cone and its channel system: new results after the Fanil cruise

    Science.gov (United States)

    Bellaiche, Gilbert; Loncke, Lies; Gaullier, Virginie; Mascle, Jean; Courp, Thierry; Moreau, Alain; Radan, Silviu; Sardou, Olivier

    2001-10-01

    The meandrous leveed channels of the Nile Cone show clear evidence of avulsions. Their sedimentary architecture is founded on numerous stacked lens-shaped acoustic units. In the areas of the distal fan, lobe deposits are apparent from multichannel imagery. Huge debris flow deposits, sometimes associated with pockmarks, are recognized. Mud volcanoes and gas seeping are closely associated with faulting. In the East, a very long north-trending channel, originating from the Egyptian coast, merges with a network of channels, very probably originating from the Levantine coasts. Both networks outlet in the sedimentary basin located south of Cyprus.

  20. Key to the South African Leporidae (Mammalia: Lagomorpha)

    African Journals Online (AJOL)

    A taxonomic and autecological study of the genus Pronolagus in southern Africa. M.Sc. thesis, University of. Rhodesia, Salisbury. PETTER, F. 1972. Order Lagomorpha, Part 5. In: The mammals of. South Africa: an identification manual. Eds. Meester, J. &. Setzer, H. W. Smithsonian Inst. Press, Washington, D.C.. ROBERTS ...

  1. Moneneheo and Naheverien: Cheyenne and Mennonite Sewing Circles, Convergences and Conflicts, 1890-1970

    Science.gov (United States)

    Schmidt, Kimberly D.

    2011-01-01

    Swiss emigres and Mennonite missionaries Marie and Rodolphe Petter were welcomed into Cheyenne Chief Red Moon's band in Oklahoma. Away from the interference of other whites, they decided to live like their new neighbors and pitched a tipi before building a more substantial structure. There they continued their studies of the Cheyenne language and…

  2. Echolocation caBs of twenty southern African bat species

    African Journals Online (AJOL)

    all species, and added that intensity and harmonic information. (not available through ANABAT recordings) would have proved useful for identification. The aim of this study is to present new echolocation data for. 20 southern African species using a time-expansion Petters- son D980 bat detector, particularly with the view to ...

  3. Computational Vision Based on Neurobiology

    Science.gov (United States)

    1994-08-10

    34 Journal of Personality and 71. M. Seibert and A.M. Waxman "Learning and Social Psychology, Vol. 37, pp. 2049-2058, 1979. recognizing 3D objects from...coherence. Nature. 358:412-414, 1992. 18. Petter, G. Nuove ricerche sperimentali sulla totalizzazione percettiva. Rivista di psicologia . 50: 213-227

  4. Revolutsionäärid, kes ei pääsenud külma käest / Linda Kaljundi

    Index Scriptorium Estoniae

    Kaljundi, Linda, 1979-

    2006-01-01

    PÖFFil linastunud Põhjamaade filmidest: "Tüütu mees" ("Den Brysomme mannen", režissöör Jens Lien, Norra, 2006), "Seltsimees Pedersen" ("Gymnaslaerer Pedersen", režissöör Hans Petter Moland, Norra, 2006), "Kelle ridades seisad" ("Kenen joukoissa seisot", režissöör Jouko Aaltonen, Soome, 2006)

  5. Staarid nagu jumalused Olümposel / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2004-01-01

    Berliini filmifestivalil toimunust. Nähtud mängufilme - "Kaunis maa" ("Beautiful Country") : režissöör Hans Petter Moland : Norra - Ameerika Ühendriigid; "Grimm" : režissöör Alex van Warmerdam : Holland; "Koletis" ("Monster") : režissöör Patty Jenkins : Ameerika Ühendriigid

  6. Prospective audit of perinatal mortality among inborn babies in a ...

    African Journals Online (AJOL)

    2010-05-05

    May 5, 2010 ... ... on Tuesday, April 12, 2011, IP: 41.185.171.107] || Click here to download free Android application for this journal ..... toxemia of pregnancy, and the mature, cause unknown, .... Source of Support: Nil, Conflict of Interest: Nil.

  7. GmSALT3, which Confers Improved Soybean Salt Tolerance in the Field, Increases Leaf Cl– Exclusion prior to Na+ Exclusion but does not Improve Early Vigour under Salinity

    Directory of Open Access Journals (Sweden)

    Ying Liu

    2016-09-01

    Full Text Available Soil salinity reduces soybean growth and yield. The recently identified GmSALT3 (Glycine max salt Tolerance-associated gene on chromosome 3 has the potential to improve soybean yields in salinized conditions. To evaluate the impact of GmSALT3 on soybean performance under saline or non-saline conditions, three sets of near isogenic lines (NILs, with genetic similarity 95.6-99.3% between each pair of NIL-T and NIL-S, were generated from a cross between two varieties, 85-140 (salt-sensitive, S and Tiefeng 8 (salt-tolerant, T by using marker-assisted selection. Each NIL; 782-T, 820-T and 860-T, contained a common ~1000 kb fragment on chromosome 3 where GmSALT3 was located. We show that GmSALT3 does not contribute to an improvement in seedling emergence rate or early vigour under salt stress. However, when 12-day-old seedlings were exposed to NaCl stress, the NIL-T lines accumulated significantly less leaf Na+ compared with their corresponding NIL-S, while no significant difference of K+ concentration was observed between NIL-T and NIL-S; the magnitude of Na+ accumulation within each NIL-T set was influenced by the different genetic backgrounds. In addition, NIL-T lines accumulated less Cl– in the leaf and more in the root prior to any difference in Na+; in the field they accumulated less pod wall Cl– than the corresponding NIL-S lines. Under non-saline field conditions, no significant differences were observed for yield related traits within each pair of NIL-T and NIL-S lines, indicating there was no yield penalty for having the GmSALT3 gene. In contrast, under saline field conditions the NIL-T lines had significantly greater plant seed weight and 100-seed weight than the corresponding NIL-S lines, meaning GmSALT3 conferred a yield advantage to soybean plants in salinized fields. Our results indicated that GmSALT3 mediated regulation of both Na+ and Cl– accumulation in soybean, and contributes to improved soybean yield through maintaining a

  8. Producción de tilapia nilótica (Oreochromis niloticus L. utilizando hojas de chaya (Cnidoscolus chayamansa McVaugh como sustituto parcial del alimento balanceado Nile tilapia production (Oreochromis niloticus L. using tree spinach leaves (Cnidoscolus chayamansa McVaugh as a partial substitute for balanced feed

    Directory of Open Access Journals (Sweden)

    Gaspar R Poot-López

    2012-11-01

    Full Text Available La acuicultura es una alternativa para la producción de proteína de alta calidad a bajo precio, particularmente en países en desarrollo y desabasto de alimentos. En zonas rurales, la disponibilidad de insumos alternativos es clave para mejorar la producción en el cultivo de peces, sobre todo si dichos insumos se usan en forma cruda. Una opción son las hojas de chaya (Cnidoscolus chayamansa, arbusto que crece en México, Centroamérica y Sudamérica. En este estudio se evaluó durante dos épocas climáticas (cálida y fría la supervivencia, tasa de crecimiento y tasa de conversión alimenticia de juveniles de tilapia (7-4,5 g, al sustituir parcialmente la ración de alimento balanceado (25 y 50% con hojas crudas de chaya (ad libitum, en un diseno experimental completamente al azar, con dos tratamientos y un control (00% de la ración a base de alimento balanceado, con tres réplicas cada uno por época climática. Las densidades fueron de 36 peces m-3 por réplica en la época fría y de 44 peces m-3 por réplica en la época cálida. Los resultados indican que los tratamientos con 50 y 75% de alimento balanceado y chaya, en ambas épocas climáticas, tuvieron una ganancia de peso similar a la de los organismos que se alimentaron con la dieta control. Durante la época fría se observaron efectos adversos en la supervivencia, peso ganado y tasa de conversión alimenticia en todos los tratamientos, lo cual no ocurrió en la época cálida. Al incluir hojas de chaya en la dieta de las tilapias, la tasa de conversión alimenticia de alimento balanceado se redujo de 9,7 a 33,62% en la época fría y de 5,38 a 40,23% en la época cálida. Los resultados muestran que el uso de insumos complementarios disponibles regionalmente como la chaya, puede favorecer el desarrollo de cultivos de tilapia a pequena escala en los trópicos.Aquaculture is an alternative for the production of high-quality, low-cost protein, particularly in developing countries with a limited food supply. In rural areas, the availability of alternative inputs is key to improving fish farming production, especially if these inputs are unprocessed. The leaves of tree spinach (Cnidoscolus chayamansa, a bush that grows in Mexico and Central and South America, are one such option. In this work, juvenile tilapia (7-4.5 g survival, growth rates, and food conversion rates were studied during two seasons (warm and cold, substituting 25 and 50% of the balanced feed rations with raw tree spinach leaves (ad libitum. The experimental design was completely random, with two treatments and one control (00% of the balanced feed ration; three replicates were done in each season. The densities were 36 fish m-per replica in the cold season and 44 fish m-3 per replica in the warm season. The weight gain in the treatments with 50 and 75% balanced feed and tree spinach leaves was similar to that of the control group in both seasons. The cold season adversely affected survival, weight gain, and feed conversion rates in all treatments, but the warm season did not. When tree spinach leaves were included in the tilapia diet, the feed conversion rate for the balanced feed was reduced from 9.7 to 33.62% in the cold season and from 5.38 to 40.23% in the warm season. The results show that the use of locally available complementary inputs such as tree spinach leaves may favor the development of small-scale tilapia cultures in the tropics.

  9. Redescription of four species of Mehdiella from Testudinidae, with a key to the species and discussion on the relationships among the species of this genus

    Directory of Open Access Journals (Sweden)

    Bouamer S.

    2003-12-01

    Full Text Available Four species of the genus Mehdiella Seurat, 1918 are redescribed: M. cristata Petter, 1966 and M. stylosa dollfusi Petter, 1966, parasite of Pyxix arachnoides Bell, 1827 from Madagascar, M. s. stylosa (Thapar, 1 925 and M. uncinata (Drasche, 1884, parasite of Testudo graeca Linneaus, 1758, Testudo hermanni Gmelin, 1789 and Testudo horsfieldii (Gray, 1844 from Palaearctic region. Light microscopy and scanning electron microscopy (SEM studies revealed new informations on the morphology of these species. On the basis of this morphological study, the sub-species Mehdiella stylosa dollfusi and M. s. stylosa are raised to level of species. The position of Mehdiella cristata among the species of the genus Mehdiella and the relationships among the species of the genus Mehdiella are discussed. A key to the eight valid species Mehdiella is given.

  10. Redescription of four species of Mehdiella from Testudinidae, with a key to the species and discussion on the relationships among the species of this genus.

    Science.gov (United States)

    Bouamer, S; Morand, S; Kara, M

    2003-12-01

    Four species of the genus Mehdiella Seurat, 1918 are redescribed: M. cristata Petter, 1966 and M. stylosa dollfusi Petter, 1966, parasite of Pyxix arachnoides Bell, 1827 from Madagascar, M. s. stylosa (Thapar, 1925) and M. uncinata (Drasche, 1884), parasite of Testudo graeca Linneaus, 1758, Testudo hermanni Gmelin, 1789 and Testudo horsfieldii (Gray, 1844) from Palaearctic region. Light microscopy and scanning electron microscopy (SEM) studies revealed new informations on the morphology of these species. On the basis of this morphological study, the sub-species Mehdiella stylosa dollfusi and M. s. stylosa are raised to level of species. The position of Mehdiella cristata among the species of the genus Mehdiella and the relationships among the species of the genus Mehdiella are discussed. A key to the eight valid species Mehdiella is given.

  11. Description of Alaeuris stehlini n. sp. and Alaeuris numidica canariensis n. ssp. (Nematoda, Pharyngodonidae), parasite of Gallotia stehlini, lacertid of Grand Canary Island (Spain).

    Science.gov (United States)

    Zapatero, C; Castaño, C; Zapatero, L M

    1999-03-01

    Pharyngodonid nematodes (Oxyuroidea) belonging to the genus Alaeuris Thapar, 1925, were collected from the posterior gut of Gallotia stehlini (Lacertidae) from Grand Canary Island. Two species Alaeuris stehlini n. sp. and Alaeuris numidica canariensis n. ssp. were identified. The new species is described in which the long thin males are characterized by narrow caudal alae, a rounded first pair of adanal papillae non pedunculate, the second pair attached and elongate, the three pair teated; a short narrow V plate and a relatively long caudal appendage. The females are also long and thin with a slightly salient vulva, a conical pointed caudal appendage, oesophageal length approximately one third of body, excretory pore below the oesophageal bulb. The new subspecies most closely resembles Alaeuris numidica numidica. (Seurat, 1918) Petter, 1966 and Alaeuris numidica madagascariensis Petter, 1966.

  12. Gross and fine motor function in fibromyalgia and chronic fatigue syndrome

    OpenAIRE

    Rasouli, Omid; Fors, Egil Andreas; Borchgrevink, Petter Chr.; Öhberg, Fredrik; Stensdotter, Ann-Katrin

    2017-01-01

    Omid Rasouli,1,2 Egil A Fors,3 Petter Chr Borchgrevink,4,5 Fredrik Öhberg,6 Ann-Katrin Stensdotter1 1Department of Neuromedicine and Movement Science, Faculty of Medicine and Health Sciences, Norwegian University of Science and Technology, Trondheim, Norway; 2Department of Public Health and Nursing, Faculty of Medicine and Health Sciences, Norwegian University of Science and Technology, Trondheim, Norway; 3Department of Public Health and Nursing, General Practice Research Unit, Norwe...

  13. When in Doubt...?

    DEFF Research Database (Denmark)

    Bubandt, Nils Ole

    2016-01-01

    Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press.......Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press....

  14. Double-layer imprint lithography on wafers and foils from the submicrometer to the millimeter scale

    NARCIS (Netherlands)

    Moonen, P.F.; Yakimets, I.; Peter, M.; Meinders, E.R.; Huskens, J.

    2011-01-01

    In this paper, a thermal imprint technique, double-layer nanoimprint lithography (dlNIL), is introduced, allowing complete filling of features in the dimensional range of submicrometer to millimeter. The imprinting and filling quality of dlNIL was studied on Si substrates as a model system and

  15. An assessment of the process capabilities of nanoimprint lithography

    Science.gov (United States)

    Balla, Tobias; Spearing, S. Mark; Monk, Andrew

    2008-09-01

    Nanoimprint lithography (NIL) is an emerging nanofabrication tool, able to replicate imprint patterns quickly and at high volumes. The present study was performed in order to define the capabilities of NIL, based on a study of published research and to identify the application areas where NIL has the greatest potential. The process attributes of different NIL process chains were analysed, and their process capabilities were compared to identify trends and process limitations. The attributes chosen include the line width, relief height, initial resist thickness, residual layer thickness, imprint area and line width tolerances. In each case well-defined limits can be identified, which are a direct result of the mechanisms involved in the NIL process. These quantitative results were compared with the assessments of individuals in academia and within the microfabrication industry. The results suggest NIL is most suited to producing photonic, microfluidic and patterned media applications, with photonic applications the closest to market. NIL needs to address overlay alignment issues for wider use, while an analysis is needed for each market, as to whether NIL adds value.

  16. Effect of Ppd-1 on the expression of flowering-time genes in vegetative and reproductive growth stages of wheat.

    Science.gov (United States)

    Kitagawa, Satoshi; Shimada, Sanae; Murai, Koji

    2012-01-01

    The photoperiod sensitivity gene Ppd-1 influences the timing of flowering in temperate cereals such as wheat and barley. The effect of Ppd-1 on the expression of flowering-time genes was assessed by examining the expression levels of the vernalization genes VRN1 and VRN3/WFT and of two CONSTANS-like genes, WCO1 and TaHd1, during vegetative and reproductive growth stages. Two near-isogenic lines (NILs) were used: the first carried a photoperiod-insensitive allele of Ppd-1 (Ppd-1a-NIL), the other, a photoperiod-sensitive allele (Ppd-1b-NIL). We found that the expression pattern of VRN1 was similar in Ppd-1a-NIL and Ppd-1b-NIL plants, suggesting that VRN1 is not regulated by Ppd-1. Under long day conditions, VRN3/WFT showed similar expression patterns in Ppd-1a-NIL and Ppd-1b-NIL plants. However, expression differed greatly under short day conditions: VRN3/WFT expression was detected in Ppd-1a-NIL plants at the 5-leaf stage when they transited from vegetative to reproductive growth; very low expression was present in Ppd-1b-NIL throughout all growth stages. Thus, the Ppd-1b allele acts to down-regulate VRN3/WFT under short day conditions. WCO1 showed high levels of expression at the vegetative stage, which decreased during the phase transition and reproductive growth stages in both Ppd-1a-NIL and Ppd-1b-NIL plants under short day conditions. By contrast to WCO1, TaHd1 was up-regulated during the reproductive stage. The level of TaHd1 expression was much higher in Ppd-1a-NIL than the Ppd-1b-NIL plants, suggesting that the Ppd-1b allele down-regulates TaHd1 under short day conditions. The present study indicates that down-regulation of VRN3/WFT together with TaHd1 is the cause of late flowering in the Ppd-1b-NIL plants under short day conditions.

  17. Novel magnetic wire fabrication process by way of nanoimprint lithography for current induced magnetization switching

    Directory of Open Access Journals (Sweden)

    Tsukasa Asari

    2017-05-01

    Full Text Available Nanoimprint lithography (NIL is an effective method to fabricate nanowire because it does not need expensive systems and this process is easier than conventional processes. In this letter, we report the Current Induced Magnetization Switching (CIMS in perpendicularly magnetized Tb-Co alloy nanowire fabricated by NIL. The CIMS in Tb-Co alloy wire was observed by using current pulse under in-plane external magnetic field (HL. We successfully observed the CIMS in Tb-Co wire fabricated by NIL. Additionally, we found that the critical current density (Jc for the CIMS in the Tb-Co wire fabricated by NIL is 4 times smaller than that fabricated by conventional lift-off process under HL = 200Oe. These results indicate that the NIL is effective method for the CIMS.

  18. Status of Standardization Projects, Quarter Ending 30 June 1992

    Science.gov (United States)

    1992-06-30

    N 8940 A724 NIL H XXX GL HAM AND CHEESE FONDUE POW GL B4 922 932 932 A GL NS 8940 A725 NIL P XXX GL POTATOES LYONNAISE POW GL 84 922 932 932 A GL N...922 932 932 A GL N 8940 A699 NIL P 44182GL NOT 2 POTATOES MASHED POW GL F2 922 932 932 A GL N 8940 A700 MJIL A XXX GL APPLE BROWN BETTY POWDER GL B4...932 A GL N 8940 A708 NIL P 44182GL NOT 1 POTATOES MASHED POW GL B5 922 932 932 A GL N 8940 A709 NIL S 44170 GL NOT 1 SPAGHETTI SAUCE GL 85 922 923 923

  19. Novel magnetic wire fabrication process by way of nanoimprint lithography for current induced magnetization switching

    Science.gov (United States)

    Asari, Tsukasa; Shibata, Ryosuke; Awano, Hiroyuki

    2017-05-01

    Nanoimprint lithography (NIL) is an effective method to fabricate nanowire because it does not need expensive systems and this process is easier than conventional processes. In this letter, we report the Current Induced Magnetization Switching (CIMS) in perpendicularly magnetized Tb-Co alloy nanowire fabricated by NIL. The CIMS in Tb-Co alloy wire was observed by using current pulse under in-plane external magnetic field (HL). We successfully observed the CIMS in Tb-Co wire fabricated by NIL. Additionally, we found that the critical current density (Jc) for the CIMS in the Tb-Co wire fabricated by NIL is 4 times smaller than that fabricated by conventional lift-off process under HL = 200Oe. These results indicate that the NIL is effective method for the CIMS.

  20. Fine mapping of S37, a locus responsible for pollen and embryo sac sterility in hybrids between Oryza sativa L. and O. glaberrima Steud.

    Science.gov (United States)

    Shen, Yumin; Zhao, Zhigang; Ma, Hongyang; Bian, Xiaofeng; Yu, Yang; Yu, Xiaowen; Chen, Haiyuan; Liu, Linglong; Zhang, Wenwei; Jiang, Ling; Zhou, Jiawu; Tao, Dayun; Wan, Jianmin

    2015-11-01

    Hybrid sterility locus S37 between Oryza glaberrima and Oryza sativa results in both pollen and embryo sac sterility. Interspecific crossing between African cultivated rice Oryza glaberrima and Oryza sativa cultivars is hindered by hybrid sterility. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL)-S37 using Dianjingyou1 (DJY1) as the recipient parent and an African cultivated rice variety as the donor parent. Empty pollen and embryo sac sterility were observed in F1 hybrids between DJY1 and NIL-S37. Cytological analyses showed that pollen abortion in the F1 hybrids occurred at the late binucleate stage due to a failure of starch accumulation in pollen grains. In addition, partial abortion of the embryo sac in the F1 hybrid was observed during function megaspore developing into mature embryo sac. Molecular analysis revealed that the semi-sterility was largely caused by the abortion of male and female gametophytes carrying the S37 allele from DJY1. A population of 25,600 plants derived from the hybrid DJY1/NIL-S37 was developed to fine map S37. Based on the physical location of molecular markers, S37 locus was finally delimited to a region of 205 kb on the short arm of chromosome 1 in terms of reference sequences of cv. Nipponbare. Interestingly, an about 97-kb DNA segment was deleted in the NIL-S37 based on BAC clone information of O. glaberrima. Fifty-four open reading frames (ORF) were predicted in this 205-kb region of DJY1, whereas only 31 ORFs were in that of NIL-S37. These results are valuable for cloning of S37 gene and further breaking reproductive isolation between Oryza glaberrima and Oryza sativa cultivars, as well as marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

  1. The Enterobiinae subfam. Nov. (Nematoda, Oxyurida) pinworm parasites of primates and rodents.

    Science.gov (United States)

    Hugot, J P; Gardner, S L; Morand, S

    1996-02-01

    Recent redescriptions of most members of the Oxyuridae Cobbold, 1864 parasitic in primates revealed that they share following derived characters: sexual dimorphism of lateral alae (single-crested in the males, double-crested in the females); in males a second pair of genital papillae always surrounded by strongly cuticularized rings; in females, uterine tube divided into 2 parts by a cellular wall forming a diaphragm. These characters are interpreted as synapomorphies, providing evidence that these taxa represent a monophyletic group, and we propose to classify them in a new subfamily of the Oxyuridae: the Enterobiinae subfam.nov. The Enterobiinae as recognized herein occurs in both Old World and New World Primates and rodents of the family Sciuridae (tribe Sciurini in the Holarctic region and tribe Xerini in the Ethiopian region). The new subfamily includes the following genera: Enterobius Leach, 1853; Colobenterobius Quentin, Betterton & Krishnasamy, 1979; Rodentoxyuris Quentin & Tenora 1974; Xeroxyuris Hugot, 1995; Lemuricola Chabaud & Petter, 1959; Protenterobius Inglis, 1961; Madoxyuris Chabaud, Brygoo & Petter, 1965; Trypanoxyuris Vevers, 1923; Hapaloxyuris Inglis & Cosgrove, 1965 and Paraoxyuronema Artigas, 1936. The genus Paraoxyuronema is revalidated as a subgenus of Trypanoxyuris due to its specialized buccal structures. This genus groups all pinworm nematodes specific for primates of the family Atelidae, including: P. brachytelesi Artigas, 1937 occurring in Brachyteles arachnoides; P. atelis (Cameron, 1929) occurring in Ateles spp., and P. duplicidens (Buckley, 1931) and P. lagothricis (Buckley, 1931), which are parasites of Lagothrix spp. Inglisoxyuris inglisi Chabaud, Petter & Golvan, 1961, included in the monospecific genus Inglisoxyuris and previously classified as a subgenus of the Lemuricola, does not share the characters of the new subfamily and, until its precise classification can be considered with more information, it is proposed to refer to

  2. När autenticiteten utmanas : En föremålsundersökning och dess tänkbara konsekvenser för museiobjektet

    OpenAIRE

    Backman, Anna

    2010-01-01

    This paper deals with an object donated by a group of members of the public to the Royal Armoury in Stockholm, Sweden. The donators claimed to own a horse bit that had been used by King Gustav II Adolf's mount in the battle of Lützen, where the King was killed. The bit was a gift to the donators' ancestor, the farmer and politician Petter Jönsson, from the King of Sweden, Oscar I, in the 1850's. In this paper, the donated bit is examined and found unlikely to be the bit used at Lützen. The ex...

  3. "Berlinale" esimene poolaeg / Endel Link

    Index Scriptorium Estoniae

    Link, Endel

    2004-01-01

    Berliini filmifestivali mängufilme - "Tunnistaja" ("Svjedoci") : režissöör Vinko Breshan : Horvaatia, "Country of My Skull" : režissöör John Boorman : Suurbritannia, "Koletis" ("Monster") : režissöör Patty Jenkins : Ameerika Ühendriigid, "Kadunud" ("The Missing") : režissöör Ron Howard : Ameerika Ühendriigid, "Mida süda soovib" ("Something's Gotta Give") : režissöör Nancy Meyer ja "Ilus maa" ("Beautiful Country") : režissöör Hans Petter Moland : Ameerika Ühendriigid - Norra

  4. Does low stomatal conductance or photosynthetic capacity enhance growth at elevated CO2 in Arabidopsis?

    Science.gov (United States)

    Easlon, Hsien Ming; Carlisle, Eli; McKay, John K; Bloom, Arnold J

    2015-03-01

    The objective of this study was to determine if low stomatal conductance (g) increases growth, nitrate (NO3 (-)) assimilation, and nitrogen (N) utilization at elevated CO2 concentration. Four Arabidopsis (Arabidopsis thaliana) near isogenic lines (NILs) differing in g were grown at ambient and elevated CO2 concentration under low and high NO3 (-) supply as the sole source of N. Although g varied by 32% among NILs at elevated CO2, leaf intercellular CO2 concentration varied by only 4% and genotype had no effect on shoot NO3 (-) concentration in any treatment. Low-g NILs showed the greatest CO2 growth increase under N limitation but had the lowest CO2 growth enhancement under N-sufficient conditions. NILs with the highest and lowest g had similar rates of shoot NO3 (-) assimilation following N deprivation at elevated CO2 concentration. After 5 d of N deprivation, the lowest g NIL had 27% lower maximum carboxylation rate and 23% lower photosynthetic electron transport compared with the highest g NIL. These results suggest that increased growth of low-g NILs under N limitation most likely resulted from more conservative N investment in photosynthetic biochemistry rather than from low g. © 2015 American Society of Plant Biologists. All Rights Reserved.

  5. Deep rooting conferred by DEEPER ROOTING 1 enhances rice yield in paddy fields.

    Science.gov (United States)

    Arai-Sanoh, Yumiko; Takai, Toshiyuki; Yoshinaga, Satoshi; Nakano, Hiroshi; Kojima, Mikiko; Sakakibara, Hitoshi; Kondo, Motohiko; Uga, Yusaku

    2014-07-03

    To clarify the effect of deep rooting on grain yield in rice (Oryza sativa L.) in an irrigated paddy field with or without fertilizer, we used the shallow-rooting IR64 and the deep-rooting Dro1-NIL (a near-isogenic line homozygous for the Kinandang Patong allele of DEEPER ROOTING 1 (DRO1) in the IR64 genetic background). Although total root length was similar in both lines, more roots were distributed within the lower soil layer of the paddy field in Dro1-NIL than in IR64, irrespective of fertilizer treatment. At maturity, Dro1-NIL showed approximately 10% higher grain yield than IR64, irrespective of fertilizer treatment. Higher grain yield of Dro1-NIL was mainly due to the increased 1000-kernel weight and increased percentage of ripened grains, which resulted in a higher harvest index. After heading, the uptake of nitrogen from soil and leaf nitrogen concentration were higher in Dro1-NIL than in IR64. At the mid-grain-filling stage, Dro1-NIL maintained higher cytokinin fluxes from roots to shoots than IR64. These results suggest that deep rooting by DRO1 enhances nitrogen uptake and cytokinin fluxes at late stages, resulting in better grain filling in Dro1-NIL in a paddy field in this study.

  6. Table_S7.xls

    Indian Academy of Sciences (India)

    Arnold Emerson

    ... k=6, k=7, k=8. 4, 1, 1a2yA, Igg1-kappa d1.3 fv (light chain), PO4, 100, 100, 100, 100, 100, 100. 5, 2, 1a4sA, Betaine aldehyde dehydrogenase, Nil. 6, 3, 1a5cA, Fructose-1,6-bisphosphate aldolase, Nil. 7, 4, 1a8mA, Tumor necrosis factor alpha, Nil. 8, 5, 1a30A, Hiv-1 protease, GLU-ASP-LEU, 100, 100, 100, 100, 62.5, 62.5.

  7. Cuticular wax accumulation is associated with drought tolerance in wheat near-isogenic lines

    Directory of Open Access Journals (Sweden)

    Jianmin Song

    2016-11-01

    Full Text Available Previous studies have shown that wheat grain yield is seriously affected by drought stress, and leaf cuticular wax is reportedly associated with drought tolerance. However, most studies have focused on cuticular wax biosynthesis and model species. The effects of cuticular wax on wheat drought tolerance have rarely been studied. The aims of the current study were to study the effects of leaf cuticular wax on wheat grain yield under drought stress using the above-mentioned wheat NILs and to discuss the possible physiological mechanism of cuticular wax on high grain yield under drought stress. Compared to water-irrigated (WI conditions, the cuticular wax content (CWC in glaucous and non-glaucous NILs under drought-stress (DS conditions both increased; mean increase values were 151.1% and 114.4%, respectively, which was corroborated by scanning electronic microscopy images of large wax particles loaded on the surfaces of flag leaves. The average yield of glaucous NILs was higher than that of non-glaucous NILs under DS conditions in 2014 and 2015; mean values were 7368.37 kg·ha-1 and 7103.51 kg·ha-1. This suggested that glaucous NILs were more drought-tolerant than non-glaucous NILs (P = 0.05, which was supported by the findings of drought tolerance indices TOL and SSI in both years, the relatively high water potential and relative water content, and the low ELWL. Furthermore, the photosynthesis rate (Pn of glaucous and non-glaucous wheat NILs under DS conditions decreased by 7.5% and 9.8%, respectively; however, glaucous NILs still had higher mean values of Pn than those of non-glaucous NILs, which perhaps resulted in the higher yield of glaucous NILs. This could be explained by the fact that glaucous NILs had a smaller Fv/Fm reduction, a smaller PI reduction and a greater ABS/RC increase than non-glaucous NILs under DS conditions. This is the first report to show that wheat cuticular wax accumulation is associated with drought tolerance. Moreover

  8. Using an electron paramagnetic resonance method for testing motor oils

    Energy Technology Data Exchange (ETDEWEB)

    Krais, S; Tkac, T

    1982-01-01

    Using an ER-9 spectrometer from the Karl Zeiss company, the relative effectiveness is studied of antioxidation additives. Motor oils of the E group, M6AD, 465, M6AD, 466, M6AD 467, 15 W/40, S-3/2 M/4, R-950, which contain the antioxidation additive were tested in Petter AV-1 motors at a temperature of 50 degrees for 120 hours and Petter AVB at a temperature of 90 degrees for 53 hours. To measure the concentration of free radicals of the antioxidation additives one part of 2,2-diphenyl-1-picrylhydrazine (I), which forms stable dimagnetic products with the radicals of the antioxidation additives was introduced into each three parts of the oil. The reduction in the intensity of the signal of I was the measure of the radical concentration. The spectrum was taken for 1 to 2 minutes. The graphs of the dependence of the electron paramagnetic resonance on the test time and the concentration of I are built. The beginning and end of the induction period of oxidation of the oils and the change in the hourly activity of the PP was recorded.

  9. Evaluation of Chemical Properties in Wells in Ghana (A Case Study ...

    African Journals Online (AJOL)

    ADOWIE PERE

    blue-baby” ... None of the samples had nil value of nitrates and nitrites. ... drinking water should therefore be the effective management and operation of water ..... determine whether the water supply chain (from ... Pathogens in the United States.

  10. The range of abdominal surgical emergencies in children older than ...

    African Journals Online (AJOL)

    2010-02-08

    Feb 8, 2010 ... survey of all children older than 1 year undergoing an emergency abdominal surgery was carried out. ..... that affect the small bowel leading to perforations are ..... Source of Support: Nil, Con.ict of Interest: None declared.

  11. High-resolution imprint and soft lithography for patterning self-assembling systems

    NARCIS (Netherlands)

    Duan, X.

    2010-01-01

    This thesis contributes to the continuous development of patterning strategies in several different areas of unconventional nanofabrication. A series of soft lithography approaches (microcontact printing, nanomolding in capillaries), nanoimprint lithography (NIL), and capillary force lithography

  12. Post‑Operative Complications and Visual Outcome in Eye Camp ...

    African Journals Online (AJOL)

    Background: Cataract is the principal cause of blindness in India, accounting for 62.6%. This problem can be .... base hospital, 413 patients met the inclusion criteria and were enrolled in ..... Financial support and sponsorship. Nil. Conflicts of ...

  13. Utilization of Teeth Replacement Service Among the Elderly ...

    African Journals Online (AJOL)

    hanumantp

    Dentistry, College of Medicine, University of Lagos, Lagos, Nigeria. Abstract ... needs, among geriatric patient in a tertiary hospital in Nigeria ..... Ann. Med Health Sci Res 2014;4:57-60. Source of Support: Nil. Conflict of Interest: None declared.

  14. Download this PDF file

    African Journals Online (AJOL)

    SERVER

    2007-07-18

    Jul 18, 2007 ... The near isogenic lines (NILs) of non-susceptible to DNV-Z were bred through backcrossing .... bor nsd-Z and had been selected to generation next generation were ... 30400327), High Technology Research Program of.

  15. Bank consolidation expected as crisis creates opportunities

    Index Scriptorium Estoniae

    2009-01-01

    Lätis ja Leedus asuvad pangad vajavad uut kapitali. Nordea panga hinnang Baltimaade majandustele. Nordea panga plaanidest. Parex panga presidendi Nils Melngailise sõnul vajab pank oodatust suuremat riigiabi

  16. Enefit gaining Latvian customers

    Index Scriptorium Estoniae

    2011-01-01

    3. märtsil toimunud Riia linnapea Nils Usakovsi ja Enefiti esindajate kohtumisel räägiti firma tariifidest, mida nad võiks munitsipaalettevõtetele ja -organisatsioonidele pakkuda. Latvenergo tõstab hindu 1. aprillil

  17. Incorporation du coprah et des cuticules de cacao et d'arachide ...

    African Journals Online (AJOL)

    Incorporation du coprah et des cuticules de cacao et d'arachide dans l'aliment du ( tilapia du nil( ( Oreohromis niloticus , linné, 1758) eleve en etang : Effet sur la croissance et la composition biochimique.

  18. Reference intervals for serum cystatin C and creatinine of an ...

    African Journals Online (AJOL)

    2014-09-25

    Sep 25, 2014 ... Some studies suggest that GFR estimated from serum cystatin C (Cys C) is more accurate than ... Current clinical practice guidelines[1,2] recommend the use of ..... Source of Support: Nil, Conflict of Interest: None declared.

  19. Some leaders, despite reputations, offer Latvians hope through crisis / Arta Ankrava

    Index Scriptorium Estoniae

    Ankrava, Arta

    2009-01-01

    DnB Nord Latvia Barometer küsitlusest selgus, et kõige enam usaldatakse ekspresident Vaira Vike-Freiberga, Riia linnapea Nils Usakovsi ja Ventspilsi endise linnapea Aivars Lembergsi majandusprognoose

  20. Malaria has no effect on birth weight in Rwanda

    NARCIS (Netherlands)

    Rulisa, S.; Mens, P.F.; Karema, C.; Schallig, H.D.F.H.; Kaligirwa, N.; Vyankandondera, J.; de Vries, P.J.

    2009-01-01

    Background: Malaria has a negative effect on pregnancy outcome, causing low birth weight, premature birth and stillbirths, particularly in areas with high malaria transmission. In Rwanda, malaria transmission intensity ranges from high to nil, probably associated with variable altitudes. Overall,

  1. New Era stands against Muiznieks / Aaron Eglitis

    Index Scriptorium Estoniae

    Eglitis, Aaron

    2005-01-01

    Läti juhtiv parempartei Uus Aeg ning rahvuslikud Isamaa Eest ja Vabadus ei toeta koalitsiooni kuuluva Läti Esimese Partei liikme Nils Muiznieksi kandidatuuri inimõiguste osakonna juhiks kuna viimane olevat ebakompetentne ja eelarvamustega

  2. Lattelecom "deal of century" on verge of annulment

    Index Scriptorium Estoniae

    2007-01-01

    Läti majandusministri kohusetäitja Gaidis Berzins teatas Lattelecomi juhatuse esimehele Nils Melngailisele, et tema töölepingut ei pikendata. Asjaolu pidurdab Lattelecomi erastamist investeerimisfirmale Blackstone Group ja Lattelecomi töötajatele

  3. Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill

  4. A Rare Case of Zosteriform Cutaneous Metastases from Squamous ...

    African Journals Online (AJOL)

    2013-04-23

    unknown; however, proposed theories include lymphatic ... [Downloaded free from http://www.amhsr.org on Tuesday, April 23, 2013, IP: 41.132.185.55] || Click here to download free Android application for this journal ... Source of Support: Nil.

  5. Use of Otoscope as a Diagnostic and Therapeutic Aid in Umbilical ...

    African Journals Online (AJOL)

    DISCUSSION. Umbilical pilonidal sinus is a rare entity as compared ... The theory of the acquired origin of umbilical pilonidal sinus was ... knowledge, this is the first study reporting the use of otoscope ... Financial support and sponsorship. Nil.

  6. Large Vesico‑Vaginal Fistula Caused by a Foreign Body

    African Journals Online (AJOL)

    Introduction. Vesico‑vaginal fistula is commonly caused by obstructed labor, gynecological surgery ... of a foreign body in the vagina have been reported mostly in developed countries. .... Source of Support: Nil. Conflict of Interest: None declared.

  7. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2005-01-01

    Uutest heliplaatidest Starsailor "On The Outside", Alabama "The Essential", Sean Paul "The Trinity", Nils Landgren & Joe Sample "Creole Love Call", Millionaire "Paradisiac", Kashmir "No Balance Palace", Bonnie Raitt "Souls Alike"

  8. Complete, infected, chronic, nonpuerperal uterine inversion: A case ...

    African Journals Online (AJOL)

    (district) hospital with a diagnosis of utero-vaginal prolapse for further management. She presented with .... reported with no association with tumor as was seen in this case.[2] Although ... management. Financial support and sponsorship. Nil.

  9. Prognostic Factors and Outcome of Management of Ischemic ...

    African Journals Online (AJOL)

    management, prognostic factors, and outcome of ischemic priapism in patients seen at Ahmadu Bello University Teaching Hospital, Zaria, Nigeria. ..... Financial support and sponsorship. Nil. ... European Association of Urology guidelines on.

  10. A Study of Kaduna Polytechnic, Kaduna

    African Journals Online (AJOL)

    2018-01-30

    Jan 30, 2018 ... higher institution in Nigeria, the reasons for its use and related eye ... higher institution, reasons .... management of Kaduna Polytechnic. .... Financial support and sponsorship. Nil. ... Norwalk, CT: Appleton and Lange; 1996. p.

  11. Plaadid / Lauri Sommer

    Index Scriptorium Estoniae

    Sommer, Lauri, 1973-

    2002-01-01

    Uutest plaatidest Shannon Lawson "Chase The Sun", Queens of the Stone Age "Songs For The Deaf, "Soundtrack. Pulp Fiction", John Adams "Naive and Sentimental Music", paul Weller "Illumination", Avril Lavigne "Let Go", Pasadena "Vastu taevast", nils Landgren "sentimental Journey"

  12. Histopathological Profile of Breast Cancer in an African Population

    African Journals Online (AJOL)

    Presently in the United States alone, it was estimated that one in every eight and one in ... female cancer globally with a significant geographic, racial and ethnical variations in its incidence. ..... of Support: Nil. Conflict of Interest: None declared.

  13. Sub-littoral meiobenthos of the northeastern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Rodrigues, C.L.; Harkantra, S.N.; Parulekar, A.H.

    Of the 11 taxonomic groups represented, Nematoda followed by foraminifera and harpacticoida were dominant Meiofaunal abundance was more related to the texture of the sediment than variation in depth Population density varied from nil to 534.65 x 10...

  14. A Survey of the Awareness of Prostate Cancer and its Screening ...

    African Journals Online (AJOL)

    blacks and mixed race men compared to men of European or of Asian descent.[3] ... and the United States Preventive Service Task Force[4] did not recommend ..... Source of Support: Nil, Conflicts of Interest: None declared. [Downloaded free ...

  15. Epigenetic regulation of photoperiodic flowering

    OpenAIRE

    Takeno, Kiyotoshi

    2010-01-01

    The cytidine analogue 5-azacytidine, which causes DNA demethylation, induced flowering in the non-vernalization-requiring plants Perilla frutescens var. crispa, Silene armeria and Pharbitis nil (synonym Ipomoea nil) under non-inductive photoperiodic conditions, suggesting that the expression of photoperiodic flowering-related genes is regulated epigenetically by DNA methylation. The flowering state induced by DNA demethylation was not heritable. Changes in the genome-wide methylation state we...

  16. Temporal Constraint Propagation for Airlift Planning Analysis

    Science.gov (United States)

    1989-12-01

    STATIOU KMSP) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COIO) (EARLIEST-ARRIVAL-TIME C012) (LATEST-ARRIVAL-TIME COlS) (PRIORITY 001) (BULK-CARGO 200...CODES NIL)) ($F (LOAD-DESIG!ATOR RI) (ONLOAD-STATION KLFI) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COOO) (EARLIEST-ARRIVAL-TIME COOS) (LATEST-ARRIVAL...CATEGORY-CODES NIL)) ($F (LOAD-DESIGNATOR RIS) (ONLOAD-STATION KSBD) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COO) (EARLIEST-ARRIVAL-TIME COOS) (LATEST

  17. Ferro- to antiferromagnetic crossover angle in diphenoxido- and carboxylato-bridged trinuclear Ni(II)₂-Mn(II) complexes: experimental observations and theoretical rationalization.

    Science.gov (United States)

    Seth, Piya; Figuerola, Albert; Jover, Jesús; Ruiz, Eliseo; Ghosh, Ashutosh

    2014-09-02

    Three new trinuclear heterometallic Ni(II)-Mn(II) complexes have been synthesized using a [NiL] metalloligand, where H2L = N,N'-bis(salicylidene)-1,3-propanediamine. The complexes [(NiL)2Mn(OCnn)2(CH3OH)2]·CH3OH (1), [(NiL)2Mn(OPh)2(CH3OH)2][(NiL)2Mn(OPh)2]·H2O (2), and [(NiL)2Mn(OSal)2(CH3OH)2]·2[NiL] (3) (where OCnn = cinnamate, OPh = phenylacetate, OSal = salicylate) have been structurally characterized. In all three complexes, in addition to the double phenoxido bridge, the two terminal Ni(II) atoms are linked to the central Mn(II) by means of a syn-syn bridging carboxylate, giving rise to a linear structure. Complexes 1 and 2 with Ni-O-Mn angles of 97.24 and 96.43°, respectively, exhibit ferromagnetic interactions (J(Ni-Mn) = +1.38 and +0.50 cm(-1), respectively), whereas 3 is antiferromagnetic (J(Ni-Mn) = -0.24 cm(-1)), having an Ni-O-Mn angle of 98.51°. DFT calculations indicate that there is a clear magneto-structural correlation between the Ni-O-Mn angle and J(Ni-Mn) values, which is in agreement with the experimental results.

  18. Comparison studies of rheological and thermal behaviors of ionic liquids and nanoparticle ionic liquids.

    Science.gov (United States)

    Xu, Yiting; Zheng, Qiang; Song, Yihu

    2015-08-14

    Novel nanoparticle ionic liquids (NILs) are prepared by grafting modified nanoparticles with long-chain ionic liquids (ILs). The NIL behaves like a liquid at ambient temperature. We studied the rheological behavior of the IL and NIL over the range of 10-55 °C and found an extraordinary difference between the IL and NIL: a small content of nanosilica (7%) moderately improves the crystallinity by 7% of the poly(ethylene glycol) (PEG) segment in the IL, and it improves the dynamic moduli significantly (by 5 times at room temperature). It retards the decay temperature (by 10 °C) of the dynamic moduli during heating as well. The thermal rheological hysteresis observed during heating-cooling temperature sweeps is ascribed to the melting-recrystallization of the PEG segments. Meanwhile, the IL and NIL express accelerated crystallization behavior in comparison with the oligomeric anion. For the first time, we find that ILs and NILs are able to form nanoparticle-containing spherulites at room temperature after long time aging.

  19. Comparative analysis of root transcriptome profiles of two pairs of drought-tolerant and susceptible rice near-isogenic lines under different drought stress

    Directory of Open Access Journals (Sweden)

    Moumeni Ali

    2011-12-01

    Full Text Available Abstract Background Plant roots are important organs to uptake soil water and nutrients, perceiving and transducing of soil water deficit signals to shoot. The current knowledge of drought stress transcriptomes in rice are mostly relying on comparative studies of diverse genetic background under drought. A more reliable approach is to use near-isogenic lines (NILs with a common genetic background but contrasting levels of resistance to drought stress under initial exposure to water deficit. Here, we examined two pairs of NILs in IR64 background with contrasting drought tolerance. We obtained gene expression profile in roots of rice NILs under different levels of drought stress help to identify genes and mechanisms involved in drought stress. Results Global gene expression analysis showed that about 55% of genes differentially expressed in roots of rice in response to drought stress treatments. The number of differentially expressed genes (DEGs increased in NILs as the level of water deficits, increased from mild to severe condition, suggesting that more genes were affected by increasing drought stress. Gene onthology (GO test and biological pathway analysis indicated that activated genes in the drought tolerant NILs IR77298-14-1-2-B-10 and IR77298-5-6-B-18 were mostly involved in secondary metabolism, amino acid metabolism, response to stimulus, defence response, transcription and signal transduction, and down-regulated genes were involved in photosynthesis and cell wall growth. We also observed gibberellic acid (GA and auxin crosstalk modulating lateral root formation in the tolerant NILs. Conclusions Transcriptome analysis on two pairs of NILs with a common genetic background (~97% showed distinctive differences in gene expression profiles and could be effective to unravel genes involved in drought tolerance. In comparison with the moderately tolerant NIL IR77298-5-6-B-18 and other susceptible NILs, the tolerant NIL IR77298-14-1-2-B-10 showed

  20. Integrated model-based retargeting and optical proximity correction

    Science.gov (United States)

    Agarwal, Kanak B.; Banerjee, Shayak

    2011-04-01

    Conventional resolution enhancement techniques (RET) are becoming increasingly inadequate at addressing the challenges of subwavelength lithography. In particular, features show high sensitivity to process variation in low-k1 lithography. Process variation aware RETs such as process-window OPC are becoming increasingly important to guarantee high lithographic yield, but such techniques suffer from high runtime impact. An alternative to PWOPC is to perform retargeting, which is a rule-assisted modification of target layout shapes to improve their process window. However, rule-based retargeting is not a scalable technique since rules cannot cover the entire search space of two-dimensional shape configurations, especially with technology scaling. In this paper, we propose to integrate the processes of retargeting and optical proximity correction (OPC). We utilize the normalized image log slope (NILS) metric, which is available at no extra computational cost during OPC. We use NILS to guide dynamic target modification between iterations of OPC. We utilize the NILS tagging capabilities of Calibre TCL scripting to identify fragments with low NILS. We then perform NILS binning to assign different magnitude of retargeting to different NILS bins. NILS is determined both for width, to identify regions of pinching, and space, to locate regions of potential bridging. We develop an integrated flow for 1x metal lines (M1) which exhibits lesser lithographic hotspots compared to a flow with just OPC and no retargeting. We also observe cases where hotspots that existed in the rule-based retargeting flow are fixed using our methodology. We finally also demonstrate that such a retargeting methodology does not significantly alter design properties by electrically simulating a latch layout before and after retargeting. We observe less than 1% impact on latch Clk-Q and D-Q delays post-retargeting, which makes this methodology an attractive one for use in improving shape process windows

  1. Molecular Breeding of Rice Restorer Lines and Hybrids for Brown Planthopper (BPH) Resistance Using the Bph14 and Bph15 Genes.

    Science.gov (United States)

    Wang, Hongbo; Ye, Shengtuo; Mou, Tongmin

    2016-12-01

    The development of hybrid rice is a practical approach for increasing rice production. However, the brown planthopper (BPH), Nilaparvata lugens Stål, causes severe yield loss of rice (Oryza sativa L.) and can threaten food security. Therefore, breeding hybrid rice resistant to BPH is the most effective and economical strategy to maintain high and stable production. Fortunately, numerous BPH resistance genes have been identified, and abundant linkage markers are available for molecular marker-assisted selection (MAS) in breeding programs. Hence, we pyramided two BPH resistance genes, Bph14 and Bph15, into a susceptive CMS restorer line Huahui938 and its derived hybrids using MAS to improve the BPH resistance of hybrid rice. Three near-isogenic lines (NILs) with pyramided Bph14 and Bph15 were obtained by molecular marker-assisted backcross (MAB) and phenotypic selection. The genomic components of these NILs were detected using the whole-genome SNP (Single nucleotide polymorphism) array, RICE6K, suggesting that the recurrent parent genome (RPG) recovery of the NILs was 87.88, 87.70 and 86.62 %, respectively. BPH bioassays showed that the improved NILs and their derived hybrids carrying homozygous Bph14 and Bph15 were resistant to BPH. However, the hybrids with heterozygous Bph14 and Bph15 remained susceptible to BPH. The developed NILs showed no significant differences in major agronomic traits and rice qualities compared with the recurrent parent. Moreover, the improved hybrids derived from the NILs exhibited better agronomic performance and rice quality compared with the controls under natural field conditions. This study demonstrates that it is essential to stack Bph14 and Bph15 into both the maternal and paternal parents for developing BPH-resistant hybrid rice varieties. The SNP array with abundant DNA markers is an efficient tool for analyzing the RPG recovery of progenies and can be used to monitor the donor segments in NILs, thus being extremely important

  2. High-resolution mapping of the brown planthopper resistance gene Bph6 in rice and characterizing its resistance in the 9311 and Nipponbare near isogenic backgrounds.

    Science.gov (United States)

    Qiu, Yongfu; Guo, Jianping; Jing, Shengli; Zhu, Lili; He, Guangcun

    2010-11-01

    Brown planthopper (Nilaparvata lugens Stål, BPH) is one of the most destructive insect pests of rice. Exploring resistance genes from diverse germplasms and incorporating them into cultivated varieties are critical for controlling this insect. The rice variety Swarnalata was reported to carry a resistance gene (designated Bph6), which has not yet been assigned to a chromosome location and the resistance mechanism is still unknown. In this study, we identified and mapped this gene using the F(2) and backcrossing populations and characterized its resistance in indica 9311 and japonica Nipponbare using near isogenic lines (NILs). In analysis of 9311/Swarnalata F(2) population, the Bph6 gene was located on the long arm of chromosome 4 between the SSR markers RM6997 and RM5742. The gene was further mapped precisely to a 25-kb region delimited between the STS markers Y19 and Y9; and the distance between these markers is 25-kb in Nipponbare genome. The Bph6 explained 77.5% of the phenotypic variance of BPH resistance in F(2) population and 84.9% in BC(2)F(2) population. Allele from Swarnalata significantly increased resistance to the BPH, resulted in a reduced damage score. In characterization of Bph6-mediated resistance, the BPH insects showed significant preference between NIL-9311 and 9311 in 3 h and between NIL-NIP and Nipponbare in 120 h after release. BPH growth and development were inhibited, and the insect's survival rates were lower on Bph6-NIL plants, compared with the parents 9311 and Nipponbare. The results indicate that the Bph6 exerted prolonged antixenotic and antibiotic effects in Bph6-NIL plants, and NIL-9311 plants showed a quicker and stronger effect toward BPH than NIL-NIP plants.

  3. Development and characterization of japonica rice lines carrying the brown planthopper-resistance genes BPH12 and BPH6.

    Science.gov (United States)

    Qiu, Yongfu; Guo, Jianping; Jing, Shengli; Zhu, Lili; He, Guangcun

    2012-02-01

    The brown planthopper (Nilaparvata lugens Stål; BPH) has become a severe constraint on rice production. Identification and pyramiding BPH-resistance genes is an economical and effective solution to increase the resistance level of rice varieties. All the BPH-resistance genes identified to date have been from indica rice or wild species. The BPH12 gene in the indica rice accession B14 is derived from the wild species Oryza latifolia. Using an F(2) population from a cross between the indica cultivar 93-11 and B14, we mapped the BPH12 gene to a 1.9-cM region on chromosome 4, flanked by the markers RM16459 and RM1305. In this population, BPH12 appeared to be partially dominant and explained 73.8% of the phenotypic variance in BPH resistance. A near-isogenic line (NIL) containing the BPH12 locus in the background of the susceptible japonica variety Nipponbare was developed and crossed with a NIL carrying BPH6 to generate a pyramid line (PYL) with both genes. BPH insects showed significant differences in non-preference in comparisons between the lines harboring resistance genes (NILs and PYL) and Nipponbare. BPH growth and development were inhibited and survival rates were lower on the NIL-BPH12 and NIL-BPH6 plants compared to the recurrent parent Nipponbare. PYL-BPH6 + BPH12 exhibited 46.4, 26.8 and 72.1% reductions in population growth rates (PGR) compared to NIL-BPH12, NIL-BPH6 and Nipponbare, respectively. Furthermore, insect survival rates were the lowest on the PYL-BPH6 + BPH12 plants. These results demonstrated that pyramiding different BPH-resistance genes resulted in stronger antixenotic and antibiotic effects on the BPH insects. This gene pyramiding strategy should be of great benefit for the breeding of BPH-resistant japonica rice varieties.

  4. Perceptual multistability in figure-ground segregation using motion stimuli.

    Science.gov (United States)

    Gori, Simone; Giora, Enrico; Pedersini, Riccardo

    2008-11-01

    In a series of experiments using ambiguous stimuli, we investigate the effects of displaying ordered, discrete series of images on the dynamics of figure-ground segregation. For low frame presentation speeds, the series were perceived as a sequence of discontinuous, static images, while for high speeds they were perceived as continuous. We conclude that using stimuli varying continuously along one parameter results in stronger hysteresis and reduces spontaneous switching compared to matched static stimuli with discontinuous parameter changes. The additional evidence that the size of the hysteresis effects depended on trial duration is consistent with the stochastic nature of the dynamics governing figure-ground segregation. The results showed that for continuously changing stimuli, alternative figure-ground organizations are resolved via low-level, dynamical competition. A second series of experiments confirmed these results with an ambiguous stimulus based on Petter's effect.

  5. Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21.

    Science.gov (United States)

    Ellur, Ranjith K; Khanna, Apurva; S, Gopala Krishnan; Bhowmick, Prolay K; Vinod, K K; Nagarajan, M; Mondal, Kalyan K; Singh, Nagendra K; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K

    2016-07-11

    Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India's forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region.

  6. The method of life extension for the High Flux Isotope Reactor vessel

    International Nuclear Information System (INIS)

    Chang, Shib-Jung.

    1995-01-01

    The state of the vessel steel embrittlement as a result of neutron irradiation can be measured by its increase in the nil ductility temperature (NDT). This temperature is sometimes referred to as the brittle-ductile transition temperature (DBT) for fracture. The life extension of the High Flux Isotope Reactor (HFIR) vessel is calculated by using the method of fracture mechanics. A hydrostatic pressure test (hydrotest) is performed in order to determine a safe vessel static pressure. It is then followed by using fracture mechanics to project the reactor life from the safe hydrostatic pressure. The life extension calculation provides the following information on the remaining life of the reactor as a function of the nil ductility temperature increase: the probability of vessel fracture due to hydrotest vs vessel life at several hydrotest pressures; the hydrotest time interval vs the uncertainty of the nil ductility temperature increase rate; and the hydrotest pressure vs the uncertainty of the nil ductility temperature increase rate. It is understood that the use of a complete range of uncertainties of the nil ductility temperature increase is equivalent to the entire range of radiation damage that can be experienced by the vessel steel. From the numerical values for the probabilities of the vessel fracture as a result of hydrotest, it is estimated that the reactor vessel life can be extended up to 50 EFPY (100 MW) with the minimum vessel operating temperature equal to 85 degree F

  7. Effects of antioxidants on apoptosis induced by dasatinib and nilotinib in K562 cells.

    Science.gov (United States)

    Damiano, Sara; Montagnaro, Serena; Puzio, Maria V; Severino, Lorella; Pagnini, Ugo; Barbarino, Marcella; Cesari, Daniele; Giordano, Antonio; Florio, Salvatore; Ciarcia, Roberto

    2018-06-01

    In clinical practice for the treatment of chronic myeloid leukemia, second generation of tyrosine kinase inhibitors such as Nilotinib (NIL) specific and potent inhibitor of the BCR/ABL kinase and Dasatinib (DAS) a inhibitor of BCR/ABL and Src family kinase were developed to clinically overcome imatinib resistance. In this study, we wanted to test the ability of some antioxidants such Resveratrol (RES) or a new recombinant mitochondrial manganese containing superoxide dismutase (rMnSOD) or δ-tocotrienol (δ-TOCO) to interact with DAS and NIL on viability, reactive oxygen species (ROS) production, lipid peroxidation, and apoptosis. To test the possible mechanisms of action of such antioxidants, we utilized N-acetyl-L-cysteine (NAC) a specific inhibitor ROS production or PP1 a specific Src tyrosine kinase inhibitor or BAPTA a specific chelator of intracellular calcium. Our data demonstrated: 1) RES, rMnSOD, δ-TOCO, and NAC, at dose used, significantly reduced the intracellular levels of MDA induced by DAS or NIL; 2) RES, rMnSOD, and δ-TOCO increased the intracellular ROS levels; 3) The increase ROS levels is related to higher levels of oligonucleosomesi induced by DAS and NIL and that NAC significantly reduced this activity. Interestingly, our data showed that apoptotic activity of DAS and NIL have significantly increased the production of oligonucleosomes by triggering excessive ROS generation as well as functionality of SERCA receptors. © 2018 Wiley Periodicals, Inc.

  8. Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21

    Science.gov (United States)

    Ellur, Ranjith K.; Khanna, Apurva; S, Gopala Krishnan.; Bhowmick, Prolay K.; Vinod, K. K.; Nagarajan, M.; Mondal, Kalyan K.; Singh, Nagendra K.; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K.

    2016-01-01

    Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India’s forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region. PMID:27403778

  9. Impact of polymer film thickness and cavity size on polymer flow during embossing : towards process design rules for nanoimprint lithography.

    Energy Technology Data Exchange (ETDEWEB)

    Schunk, Peter Randall; King, William P. (Georgia Institute of Technology, Atlanta, GA); Sun, Amy Cha-Tien; Rowland, Harry D. (Georgia Institute of Technology, Atlanta, GA)

    2006-08-01

    This paper presents continuum simulations of polymer flow during nanoimprint lithography (NIL). The simulations capture the underlying physics of polymer flow from the nanometer to millimeter length scale and examine geometry and thermophysical process quantities affecting cavity filling. Variations in embossing tool geometry and polymer film thickness during viscous flow distinguish different flow driving mechanisms. Three parameters can predict polymer deformation mode: cavity width to polymer thickness ratio, polymer supply ratio, and Capillary number. The ratio of cavity width to initial polymer film thickness determines vertically or laterally dominant deformation. The ratio of indenter width to residual film thickness measures polymer supply beneath the indenter which determines Stokes or squeeze flow. The local geometry ratios can predict a fill time based on laminar flow between plates, Stokes flow, or squeeze flow. Characteristic NIL capillary number based on geometry-dependent fill time distinguishes between capillary or viscous driven flows. The three parameters predict filling modes observed in published studies of NIL deformation over nanometer to millimeter length scales. The work seeks to establish process design rules for NIL and to provide tools for the rational design of NIL master templates, resist polymers, and process parameters.

  10. Performance and feeding behaviour of two biotypes of the black currant-lettuce aphid, Nasonovia ribisnigri, on resistant and susceptible Lactuca sativa near-isogenic lines.

    Science.gov (United States)

    ten Broeke, Cindy J M; Dicke, Marcel; van Loon, Joop J A

    2013-10-01

    The black currant-lettuce aphid, Nasonovia ribisnigri, is an important pest of cultivated lettuce, Lactuca sativa. Since 1982, the control of this aphid on lettuce is largely based on host plant resistance, conferred by the Nr gene, introgressed from Lactuca virosa. The resistance mechanism remains to be identified. N. ribisnigri populations virulent on the Nr-based resistance in lettuce have emerged in several locations in Europe since 2007. The objective of this study was to investigate the resistance mechanism mediated by the Nr gene in lettuce by detailed studies of aphid feeding behaviour and performance. Both avirulent (Nr:0) and virulent (Nr:1)biotypes of N. ribisnigri were studied on five resistant and two susceptible near isogenic lines (NILs). In addition, survival and colony development were quantified.Nr:0 aphids showed a strong decrease in sieve element ingestion and took longer to accept a sieve element on resistant NILs compared with susceptible NILs, and no aphids survived on the resistant NIL. Nr:1 aphids fed and performed equally well on the resistant and susceptible NILs. The resistance mechanism against Nr:0 aphids encoded by the Nr gene seems to be located in the phloem, although we also observed differences in feeding behaviour during the pathway phase to the phloem. Nr:1 aphids were highly virulent to the resistance conferred by the Nr gene. The consequences of the appearance of Nr:1 aphids for control of N. ribisnigri are discussed.

  11. Chemical phenomena in primary titanium production

    CSIR Research Space (South Africa)

    van Vuuren, DS

    2011-01-01

    Full Text Available TiO2 $ 490m p.a. $ 2500 p.a. Pigment Production ~20 kt TiO2 5100 kt TiO2 $ 37m p.a. $ 10000 m.p.a. Sponge Production Nil 125 kt p.a. Ti $ 1250 m.p.a. Ingot Production Nil 145 kt p.a. Ti $ 2600 m.p.a. Mill Products Nil ~90 kt p.a. Ti $ 4500 m... Museum Photo courtesy of the Kyushu National Museum http://web-japan.org/nipponia/nipponia38/en/travel/travel03.html V AL U E TiCl4 TiO2 Sponge Powder M2TiF6 Ingot INC R EAS ING COS T PRECURSOR REDUCTANT PRODUCT...

  12. Functional patterns obtained by nanoimprinting lithography and subsequent growth of polymer brushes

    International Nuclear Information System (INIS)

    Genua, A; AlduncIn, J A; Pomposo, J A; Grande, H; Kehagias, N; Reboud, V; Sotomayor, C; Mondragon, I; Mecerreyes, D

    2007-01-01

    In this work the growth of polymer brushes was combined with nanoimprint lithography (NIL) in order to obtain new functional nanopatterns. First, a functional thermoplastic methacrylic copolymer poly(methyl methacrylate-co-2-bromoisobutyryl-oxy-ethyl methacrylate) was synthesized. This copolymer was successfully patterned by NIL using a silicon stamp at 160 deg. C and 60 bar. Next, hydrophilic polymer brushes based on poly(3-sulfopropylmethacrylate) and hydrophobic polymer brushes based on a poly(fluorinated methacrylate) were grown on the imprinted surfaces. The surface properties of the patterned polymer were accordingly modified and, as a consequence, the water contact angle was modified from 80.3 deg. to 32.5 deg. in the case of the hydrophilic brushes and to 118.1 deg. in the case of the hydrophobic brushes. As an application we demonstrated the use of hydrophobic polymer brushes in order to modify the surface of polymeric stamps for NIL with self-demoulding properties

  13. Simultaneous analysis of residual stress and stress intensity factor in a resist after UV-nanoimprint lithography based on electron moiré fringes

    International Nuclear Information System (INIS)

    Wang, Qinghua; Kishimoto, Satoshi

    2012-01-01

    In this study, the residual stress in a resist (PAK01) film and the stress intensity factor (SIF) of an induced crack are simultaneously estimated during ultraviolet nanoimprint lithography (UV-NIL) based on electron moiré fringes. A micro grid in a triangular arrangement on the resist film fabricated by UV-NIL is directly used as the model grid. Electron moiré fringes formed by the interference between the fabricated grid and the electron scan beam are used to measure the displacement distribution around the tip of a crack induced by the residual stress in the resist. The SIF of the crack is estimated using a displacement extrapolation method. The residual strain fields and the corresponding residual stress in the resist film far from the crack are determined and analyzed. This method is effective for evaluating the grid quality fabricated by the UV-NIL technique. (paper)

  14. Nano imprint lithography of textures for light trapping in thin film silicon solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Soppe, W.J.; Dorenkamper, M.S.; Notta, J.B.; Pex, P.P.A.C. [ECN-Solliance, High Tech Campus 5, 5656 AE Eindhoven (Netherlands); Schipper, W.; Wilde, R. [Nanoptics GmbH, Innungsstrasse 5, 21244 Buchholz (Germany)

    2012-09-15

    Nano Imprint Lithography (NIL) is a versatile and commercially viable technology for fabrication of structures for light trapping in solar cells. We demonstrate the applicability of NIL in thin film silicon solar cells in substrate configuration, where NIL is used to fabricate a textured rear contact of the solar cells. We applied random structures, based on the natural texture of SnO:F grown by APCVD, and designed 2D periodic structures and show that for single junction {mu}c-Si cells these textured rear contacts lead to an increase of Jsc of more than 40 % in comparison to cells with flat rear contacts. Cells on optimized periodic textures showed higher fill factors which can be attributed to reduced microcrack formation, leading to less shunting in comparison to cells on random textures.

  15. A 3D-printed device for polymer nanoimprint lithography

    Science.gov (United States)

    Caño-García, Manuel; Geday, Morten A.; Gil-Valverde, Manuel; Megías Zarco, Antonio; Otón, José M.; Quintana, Xabier

    2018-02-01

    Nanoimprint lithography (NIL) is an imprinting technique which has experienced an increasing popularity due to its versatility in fabrication processes. Commercial NIL machines are readily available achieving high quality results; however, these machines involve a relatively high investment. Hence, small laboratories often choose to perform NIL copies in a more rudimentary and cheaper way. A new simple system is presented in this document. It is based on two devices which can be made in-house in plastic by using a 3D printer or in aluminum. Thus, the overall manufacturing complexity is vastly reduced. The presented system includes pressure control and potentially temperature control. Replicas have been made using a sawtooth grating master with a pitch around half micrometre. High quality patterns with low density of imperfections have been achieved in 2.25 cm2 surfaces. The material chosen for the negative intermediary mould is PDMS. Tests of the imprint have been performed using the commercial hybrid polymer Ormostamp®.

  16. Kinetic Modeling of a Heterogeneous Fenton Oxidative Treatment of Petroleum Refining Wastewater

    Science.gov (United States)

    Basheer Hasan, Diya'uddeen; Abdul Raman, Abdul Aziz; Wan Daud, Wan Mohd Ashri

    2014-01-01

    The mineralisation kinetics of petroleum refinery effluent (PRE) by Fenton oxidation were evaluated. Within the ambit of the experimental data generated, first-order kinetic model (FKM), generalised lumped kinetic model (GLKM), and generalized kinetic model (GKM) were tested. The obtained apparent kinetic rate constants for the initial oxidation step (k 2′), their final oxidation step (k 1′), and the direct conversion to endproducts step (k 3′) were 10.12, 3.78, and 0.24 min−1 for GKM; 0.98, 0.98, and nil min−1 for GLKM; and nil, nil, and >0.005 min−1 for FKM. The findings showed that GKM is superior in estimating the mineralization kinetics. PMID:24592152

  17. Cones fabricated by 3D nanoimprint lithography for highly sensitive surface enhanced Raman spectroscopy

    International Nuclear Information System (INIS)

    Wu Wei; Hu Min; Ou Fungsuong; Li Zhiyong; Williams, R Stanley

    2010-01-01

    We demonstrated a cost-effective and deterministic method of patterning 3D cone arrays over a large area by using nanoimprint lithography (NIL). Cones with tip radius of less than 10 nm were successfully duplicated onto the UV-curable imprint resist materials from the silicon cone templates. Such cone structures were shown to be a versatile platform for developing reliable, highly sensitive surface enhanced Raman spectroscopy (SERS) substrates. In contrast to the silicon nanocones, the SERS substrates based on the Au coated cones made by the NIL offered significant improvement of the SERS signal. A further improvement of the SERS signal was observed when the polymer cones were imprinted onto a reflective metallic mirror surface. A sub-zeptomole detection sensitivity for a model molecule, trans-1,2-bis(4-pyridyl)-ethylene (BPE), on the Au coated NIL cone surfaces was achieved.

  18. Nanoimprint lithography in the cyclic olefin copolymer, Topas, a highly ultraviolet-transparent and chemically resistant thermoplast

    DEFF Research Database (Denmark)

    Nielsen, T.; Nilsson, D.; Bundgaard, F.

    2004-01-01

    -on-a-chipapplications. In particular, Topas® is suitable for micro systems made for optical bio-detection since waveguides for UV-light can be made directly in Topas®. In this article full process sequences for spin coating Topas® onto 4 in. silicon wafers, NIL silicon stamp fabrication with micro and nanometer sized features...... by metal deposition and lift-off ontop of a Topas® film patterned by NIL is demonstrated. This exploits the chemical resistance ofTopas® to sodium hydroxide and acetone. The demonstrated UVL and lift-off on top of an imprinted Topas® film opens new possibilities for post-NIL processing....

  19. Thermodynamic Characteristics of Reactions of the Formation of Complexes between Triglycine and Ni2+ Ions in Aqueous Solution

    Science.gov (United States)

    Gorboletova, G. G.; Metlin, A. A.; Bychkova, S. A.

    2018-05-01

    Thermal effects of reactions of the formation of complexes between Ni(II) and triglycine are determined via direct calorimetry in aqueous solutions at 298.15 K and ionic strengths of 0.2, 0.5, and 1.0 (KNO3). Standard thermodynamic characteristics (Δr H°, Δr G°, Δr S°) of complexing processes in the investigated systems are calculated. The structures of triglycinate complexes NiL+, NiH-1L, NiL2, NiH-2L2- 2, NiL- 3, and NiH-3L4- 3 are introduced to compare the obtained values and data on the thermodynamics of triglycinate complexes of Ni(II).

  20. Self-recognition of high-mannose type glycans mediating adhesion of embryonal fibroblasts.

    Science.gov (United States)

    Yoon, Seon-Joo; Utkina, Natalia; Sadilek, Martin; Yagi, Hirokazu; Kato, Koichi; Hakomori, Sen-itiroh

    2013-07-01

    High-mannose type N-linked glycan with 6 mannosyl residues, termed "M6Gn2", displayed clear binding to the same M6Gn2, conjugated with ceramide mimetic (cer-m) and incorporated in liposome, or coated on polystyrene plates. However, the conjugate of M6Gn2-cer-m did not interact with complex-type N-linked glycan with various structures having multiple GlcNAc termini, conjugated with cer-m. The following observations indicate that hamster embryonic fibroblast NIL-2 K cells display homotypic autoadhesion, mediated through the self-recognition capability of high-mannose type glycans expressed on these cells: (i) NIL-2 K cells display clear binding to lectins capable of binding to high-mannose type glycans (e.g., ConA), but not to other lectins capable of binding to other carbohydrates (e.g. GS-II). (ii) NIL-2 K cells adhere strongly to plates coated with M6Gn2-cer-m, but not to plates coated with complex-type N-linked glycans having multiple GlcNAc termini, conjugated with cer-m; (iii) degree of NIL-2 K cell adhesion to plates coated with M6Gn2-cer-m showed a clear dose-dependence on the amount of M6Gn2-cer-m; and (iv) the degree of NIL-2 K adhesion to plates coated with M6Gn2-cer-m was inhibited in a dose-dependent manner by α1,4-L-mannonolactone, the specific inhibitor in high-mannose type glycans addition. These data indicate that adhesion of NIL-2 K is mediated by self-aggregation of high mannose type glycan. Further studies are to be addressed on auto-adhesion of other types of cells based on self interaction of high mannose type glycans.

  1. Comparative transcriptome proifling of two maize near-isogenic lines differing in the allelic state for bacterial brown spot disease resistance

    Institute of Scientific and Technical Information of China (English)

    WU Xiao-jun; Xu Li; ZHAO Pan-feng; LI Na; WU Lei; HE Yan; WANG Shou-cai

    2015-01-01

    The bacterial brown spot disease (BBS), caused primarily by Pseudomonas syringae pv. syringae van Hal (Pss), reduces plant vigor, yield and quality in maize. To reveal the nature of the defense mechanisms and identify genes involved in the effective host resistance, the dynamic changes of defense transcriptome triggered by the infection of Pss were investigated and compared between two maize near-isogenic lines (NILs). We found that Pss infection resulted in a sophisticated tran-scriptional reprogramming of several biological processes and the resistant NIL employed much faster defense responses than the susceptible NIL. Numerous genes encoding essential components of plant basal resistance would be able to be activated in the susceptible NIL, such as PEN1, PEN2, PEN3, and EDR1, however, in a basic manner, such resistance might not be sufifcient for suppressing Pss pathogenesis. In addition, the expressions of a large number of PTI-, ETI-, PR-, and WRKY-related genes were pronouncedly activated in the resistant NIL, suggesting that maize employ a multitude of defense pathways to defend Pss infection. Six R-gene homologs were identiifed to have signiifcantly higher expression levels in the resistant NIL at early time point, indicating that a robust surveil ance system (gene-to-gene model) might operate in maize during Pss attacks, and these homolog genes are likely to be potential candidate resistance genes involved in BBS disease resistance. Furthermore, a holistic group of novel pathogen-responsive genes were deifned, providing the repertoire of candidate genes for further functional characterization and identiifcation of their regulation patterns during pathogen infection.

  2. Design and Evaluation of an Energy-Dense, Light-Weight Combat Ration to Sustain Land Forces Involved in High-Intensity, Short-Duration Operations

    Science.gov (United States)

    2015-03-01

    group sessions centred on popular jack rations such as retorted fish and salami-type items as well as noodles , other pasta, confectionery and energy...Amount consumed Consumed Partially consumed Not consumed nil response Palatability 0% 20% 40% 60% 80% 100% Coffee, Instant Tea bag SCM sugar Pe rc... Instant Tea bag SCM sugar Pe rc en t o f r es po nd an ts Too much Enough Not enough nil response Amount consumed 0% 20% 40% 60% 80% 100% Coffee, Instant

  3. Three-Dimensional Route Planning for a Cruise Missile for Minimal Detection by Observer

    Science.gov (United States)

    1989-06-01

    detect the enemy’s weakest avenues of approach are needed. Such systems could also be used to identify our own deficiencies and allow for...vector-k (oval (line-segment-direction-vector (oval line-i))))) ( Tk2 (vector-k (eval (line-segment-direction-voctor (oval line-2))))) (Tval ’nil...zerop Tkl)) (not (zerop Tk2 ))) (setf Tval (/ Tkl Tk2 ))) (t (return-from parallel-lines ’nil))) (cond ((and (equal Til (* Tval Ti2)) (equal Tjl (* Tval

  4. Appendices on provisional nomenclature, symbols, terminology and conventions - number 55

    International Nuclear Information System (INIS)

    1976-01-01

    Ten numerically-based syllables (nil, un, bi, etc) are used to provide recommended names of elements of atomic numbers greater than 100. The symbol of the element is composed of the initial letters of the numerical roots which make up the name. Abbreviated forms of the names of elements 101 to 199 are proposed. Thus: element 105 would be named Un-nil-pentium [hyphens not part of name but shown in the recommendatoins to assist comprehension], symbol Unp, abbreviation Pentium. (U.K.)

  5. Nanoimprinted organic semiconductor laser pumped by a light-emitting diode.

    Science.gov (United States)

    Tsiminis, Georgios; Wang, Yue; Kanibolotsky, Alexander L; Inigo, Anto R; Skabara, Peter J; Samuel, Ifor D W; Turnbull, Graham A

    2013-05-28

    An organic semiconductor laser, simply fabricated by UV-nanoimprint lithography (UV-NIL), that is pumped with a pulsed InGaN LED is demonstrated. Molecular weight optimization of the polymer gain medium on a nanoimprinted polymer distributed feedback resonator enables the lowest reported UV-NIL laser threshold density of 770 W cm(-2) , establishing the potential for scalable organic laser fabrication compatible with mass-produced LEDs. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

    OpenAIRE

    J. E. Vinchira; G. A. Wills; A. P. Muñoz

    2014-01-01

    Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus ) suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta). Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatori...

  7. Den umulige film

    DEFF Research Database (Denmark)

    Moestrup, Steffen Damkjær

    2014-01-01

    Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv.......Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv....

  8. Viking Line visandab oma laevadele purjeid / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2008-01-01

    Viking Line'i juht Nils-Erik Eklund leiab, et Tallinki uued laevad on pigem probleem kui konkurentsieelis, sest uue põlvkonna reisilaevad peaks liikuma osaliselt tuule- ja päikeseenergia jõul. Vt. samas: Tallinna-Helsingi liinil on tasakaal lähedal

  9. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Sushil Kumar Addy. Articles written in Sadhana. Volume 30 Issue 1 February 2005 pp 1-10. Thermal effect on gravity waves in a compressible liquid layer over a solid half-space under initial hydrostatic stress · Sushil Kumar Addy Nil Ratan Chakraborty · More Details Abstract Fulltext PDF.

  10. Arabidopsis CDS blastp result: AK069900 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069900 J023035E20 At5g23420.1 high mobility group (HMG1/2) family protein similar to high mobility... group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box 8e-32 ...

  11. Carcinoma of the pancreas and periampullary region: palliation versus cure

    NARCIS (Netherlands)

    Klinkenbijl, J. H.; Jeekel, J.; Schmitz, P. I.; Rombout, P. A.; Nix, G. A.; Bruining, H. A.; van Blankenstein, M.

    1993-01-01

    A retrospective study of 310 patients with carcinoma of the head of the pancreas or periampullary region was performed. Preoperative bile drainage by placement of a stent reduced the number of postoperative complications, especially bleeding (P = 0.03). The operative mortality rate was nil in

  12. Awareness and knowledge of mother-to-child transmission of HIV ...

    African Journals Online (AJOL)

    2010-02-08

    Feb 8, 2010 ... Ninety-one percent of mothers were aware of mother-to-child transmission of HIV. Transplacental ... The pandemic is having a serious effect on the reproductive ..... Source of Support: Nil, Con.ict of Interest: None declared.

  13. The Empty Seashell

    DEFF Research Database (Denmark)

    Bubandt, Nils

    The Empty Seashell explores what it is like to live in a world where cannibal witches are undeniably real, yet too ephemeral and contradictory to be an object of belief. In a book based on more than three years of fieldwork between 1991 and 2011, Nils Bubandt argues that cannibal witches for people...

  14. RIMS (real-time imprint monitoring by scattering of light) study of pressure, temperature and resist effects on nanoimprint lithography

    International Nuclear Information System (INIS)

    Yu Zhaoning; Gao He; Chou, Stephen Y

    2007-01-01

    To optimize nanoimprint lithography (NIL), it is essential to be able to characterize and control the NIL process in situ and in real time. Recently we have developed a real-time imprint monitoring by the scattering-of-light (RIMS) approach, which allows us to detect the degree of resist deformation and the duration of resist penetration by a mould during the imprint process in real time. In this paper we report the performances of RIMS under a broad range of working conditions. RIMS data shows that the resist penetration is facilitated by increasing processing temperature, pressure and the resist film thickness; a prolonged pre-NIL resist baking step, on the other hand, has the effect of slowing it down. Our results provide further demonstration of the effectiveness of this method under different working conditions. RIMS measurements show not only how long an imprint takes to complete, but also how an imprint progresses with time and how it is affected by differences in processing parameters. These measurements provide information crucial for a better understanding and process optimization in NIL

  15. A 10 years autopsy‑based study of maternal mortality in Lagos State ...

    African Journals Online (AJOL)

    2016-03-05

    Mar 5, 2016 ... ... women who die during pregnancy, delivery, and puerperium remain a global public ... ignorance, leading to inaction in cases where maternal death could be prevented. ... and the relations could not be persuaded to bring the bodies down to the main ..... Financial support and sponsorship. Nil. Conflicts of ...

  16. Environmental Assessment of Installation Development at Joint Base San Antonio-Lackland, Texas

    Science.gov (United States)

    2013-02-01

    Sanitary Sewer Lines Upgrades Natural Infrastructure Management Projects • Nil. Medio Creek Erosion Control • NI2. Warrior Week Road- Leon Creek Bridge...Intrastate MSL mean sea level MSW municipal solid waste MWD Military Working Dog NAAQS National Ambient Air Quality Standards NAGPRA Native...2-39  2-25. Proposed Location for Project NI1, Medio Creek Erosion Control

  17. Intersatellite Link Design Issues

    Science.gov (United States)

    1985-01-01

    of Science degree by Richard S. Fuhrmann has been approved for the Tel ecommunications Program by Frank S. Barnes Sadel W.’MaleyK Date --- 45 N... means , the holier of a monopoly when it comes to satellites. In the early . 70"s, the low cost per circuit qenerated interest in Nil Fj domestic

  18. Postharvest firmness behaviour of near-isogenic lines of melon

    NARCIS (Netherlands)

    Tijskens, L.M.M.; Dos-Santos, N.; Jowkar, M.M.; Obando-Ulloa, J.M.; Moreno, E.; Schouten, R.E.; Monforte, A.J.; Fernández-Trujillo, J.P.

    2009-01-01

    In two consecutive seasons the firmness of 13¿15 near-isogenic lines (NILs) of melons (Cucumis melo L.) was followed during storage at 21 °C. Firmness was measured using non-destructive compression of whole melon fruit to a predefined compression distance of 2 mm. The same individuals (about 6 per

  19. Fatigue crack growth retardation in spot heated mild steel sheet

    Indian Academy of Sciences (India)

    A fatigue crack can be effectively retarded by heating a spot near the crack tip under nil remote stress condition. The subcritical spot heating at a proper position modifies the crack growth behaviour in a way, more or less, similar to specimen subjected to overload spike. It is observed that the extent of crack growth retardation ...

  20. Enhanced Recovery After Surgery: It's Time to Change Practice

    NARCIS (Netherlands)

    Steenhagen, E

    Perioperative surgical care is undergoing a paradigm shift. Traditional practices such as prolonged preoperative fasting (nil by mouth from midnight), bowel cleaning, and reintroduction of oral nutrition 3-5 days after surgery are being shunned. These and other similar changes have been formulated

  1. Riia trammid-trollid võivad varsti sõita Eesti elektriga. Lätis elekter kallines / Anne Oja ; kommenteerinud Davis Skulte

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2011-01-01

    Latvenergo tõstab firmadele müüdava elektri tariife 50% võrra. Riia linnapea Nil Ušakov teatas, et Riia munitsipaalettevõtted võivad hakata elektrienergiat ostma Eesti Energia tütarfirmalt Enefit. Mitu ettevõtet on juba Enefiti kasuks otsustanud

  2. Total Thyroidectomy for the Treatment of Recurrent Graves' Disease With Ophthalmopathy

    Directory of Open Access Journals (Sweden)

    Ahmet Nart

    2008-07-01

    Conclusion: TT resulted in a significant reduction in TRAb levels with concomitant regression of recurrent GO in all patients. The operative morbidity was very low and mortality was nil. However, the long-term consequences of permanent hypothyroidism, which is the ultimate result of TT, are of major concern.

  3. Male sexuality after cancer treatment - needs for information and support : testicular cancer compared to malignant lymphoma

    NARCIS (Netherlands)

    Jonker-Pool, G.; Hoekstra, H.J.; van Imhoff, G.W.; Sonneveld, D.J.A.; Sleijfer, D.T.; van Driel, M.F.; Koops, H.S.; van de Wiel, H.B.M.

    Testicular cancer (TC) as well as malignant lymphoma (NIL), both have nowadays an excellent prognosis. However, both types of cancer may be diagnosed at young adulthood and patients may experience sexual concerns. In this article the need for information and support concerning sexuality will be

  4. UN Peacekeeping

    DEFF Research Database (Denmark)

    of civilians, Denmark’s contribution to the UN mission in Liberia, anti-piracy operations, and the prospective role of special forces in UN operations. The two forewords of the book have been written by Major General Hu Guangzheng from AMS and Rear Admiral Nils Christian Wang from the Royal Danish Defence...

  5. On Education and Politics / Karlis Streips

    Index Scriptorium Estoniae

    Streips, Karlis

    2011-01-01

    5. septembril ilmunud ajalehes Diena kontrolliti Läti poliitikute teadmisi. Küsimustele vastasid Valdis Zatlers, Solvita Aboltina, Nils Usakovs, Raimonds Vejonis, Ainars Slesers ja Gaidis Berzins. Keskharidusega Ainars Slesersi vastustest. Autor leiab, et keskharidusega inimene ei tohiks parlamendis olla

  6. Inhibitory control in childhood stuttering

    NARCIS (Netherlands)

    Eggers, K.; de Nil, L.; Van den Bergh, B.R.H.

    2013-01-01

    Purpose The purpose of this study was to investigate whether previously reported parental questionnaire-based differences in inhibitory control (IC; Eggers, De Nil, & Van den Bergh, 2010) would be supported by direct measurement of IC using a computer task. Method Participants were 30 children who

  7. ATLAS Thesis Awards 2015

    CERN Multimedia

    Biondi, Silvia

    2016-01-01

    Winners of the ATLAS Thesis Award were presented with certificates and glass cubes during a ceremony on Thursday 25 February. The winners also presented their work in front of members of the ATLAS Collaboration. Winners: Javier Montejo Berlingen, Barcelona (Spain), Ruth Pöttgen, Mainz (Germany), Nils Ruthmann, Freiburg (Germany), and Steven Schramm, Toronto (Canada).

  8. Nondestructive Detection of Structural Damage Uniquely Associated with Fatigue

    Science.gov (United States)

    1974-07-01

    corrosion were not as numerous as cracks caused by fatigue. Stress corrosion cracking occurred mostly at fillet radius, shear pinhole, and the web of...nil i. i^mji^mitm^mm^mmmmmw^mmmtmi>i>i.vi\\ -^^ wix ^w 0) a E re i A c 0) 1- D o ^el /l Current le // T wi th ~ transducer — ’"A

  9. side-effects of oral misoprostol in the third stage of labour

    African Journals Online (AJOL)

    were placed in a plastic bag and weighed in grams. The known dry weight of the linen savers and sanitary towels was subtracted to give the approximate volume of blood in .... cially prematures. This is the eagerly awaited original video of Dr Nils Bergman's highly popular talks on the subject. The video provides the latest.

  10. All Roads Lead to Property: Pashukains, Christie and the Theory of ...

    African Journals Online (AJOL)

    Nils Christie is acknowledged generally as the theoretical founding father of restorative justice. Evgeny Pashukanis may be taken as the premier Marxist theoretician of law. This essay represents an endeavour to read Christie through the lens of Pashukanism, that is, to comprehend the theory of restorative justice developed ...

  11. Introduction: Situating Scandinavian Colonialism

    DEFF Research Database (Denmark)

    Naum, Magdalena; Nordin, Jonas M.

    2013-01-01

    described his adventures in a book published in 1667. Nils Matsson Kiöping’s account provides detailed information about a wide set of localities of the early modern global world. Like many other narratives of exploration produced by European adventurers of the era, its pages contain a blend of amazement...

  12. Potential of oil palm empty fruit bunch ash for remediation of crude ...

    African Journals Online (AJOL)

    The potential of oil palm empty fruit bunch ash for remediation of crude oil polluted soil was investigated. Three levels (100 g, 200 g and 300 g) of ash treatments in 2 kg of soil were set up alongside a control (nil ash) after pollution with100 ml of crude oil. Composite soil samples were collected and analyzed at intervals of ...

  13. Validation and dissection of quantitative trait loci for leaf traits in ...

    Indian Academy of Sciences (India)

    Validation and dissection of a QTL region for leaf traits in rice which has been reported in a number of independent studies were conducted. Three sets of near isogenic lines (NILs) were originated from a residual heterozygous line derived the indica cross Zhenshan 97B/Milyang 46. They were overlapping and totally ...

  14. Nutritional Support and Oral Intake after Gastric Resection in Five Northern European Countries

    DEFF Research Database (Denmark)

    Lassen, K; Dejong, C H C; Ljungqvist, O

    2005-01-01

    a conservative trend was noticeable in the use of nasogastric decompression tubes and 'nil-by-mouth' regimens. Nutritional support during the first 5 days is generally offered in Denmark, but not in Scotland. Drinking at will is generally allowed in Denmark and Norway by the first postoperative day. Eating...

  15. East and Central African Journal of Surgery Volume 15 Number 2 ...

    African Journals Online (AJOL)

    DELL

    Thyroid Dysfunction among Young Adults in Uganda ... enrolled 100 Undergraduate medical students by invitations through notices and ... An elevated serum TSH concentration is present in both overt and mild hypothyroidism. In .... smoking in this study. ... Nils K, Torben J, Rasmussen S, Christiansen E and Perrild H. The ...

  16. Stacking metal nano-patterns and fabrication of moth-eye structure

    Science.gov (United States)

    Taniguchi, Jun

    2018-01-01

    Nanoimprint lithography (NIL) can be used as a tool for three-dimensional nanoscale fabrication. In particular, complex metal pattern structures in polymer material are demanded as plasmonic effect devices and metamaterials. To fabricate of metallic color filter, we used silver ink and NIL techniques. Metallic color filter was composed of stacking of nanoscale silver disc patterns and polymer layers, thus, controlling of polymer layer thickness is necessary. To control of thickness of polymer layer, we used spin-coating of UV-curable polymer and NIL. As a result, ten stacking layers with 1000 nm layer thickness was obtained and red color was observed. Ultraviolet nanoimprint lithography (UV-NIL) is the most effective technique for mass fabrication of antireflection structure (ARS) films. For the use of ARS films in mobile phones and tablet PCs, which are touch-screen devices, it is important to protect the films from fingerprints and dust. In addition, as the nanoscale ARS that is touched by the hand is fragile, it is very important to obtain a high abrasion resistance. To solve these problems, a UV-curable epoxy resin has been developed that exhibits antifouling properties and high hardness. The high abrasion resistance ARS films are shown to withstand a load of 250 g/cm2 in the steel wool scratch test, and the reflectance is less than 0.4%.

  17. Untitled

    African Journals Online (AJOL)

    1987-10-29

    nickelfil) Chelates with Pyridine and 1,10—Phenanthroline. Salah S. Massoud. Chemistry Department, Faculty of Science, Alexandria, EGYPT. (Received October 29, 1987). ABSTRACT: The interaction of the square planar nickelfll) chelates of the type Ni(RIRZC=N-N=CSSCH3)2; NiL2 derived from ketones [R1, R2=CH3,.

  18. Birth weight recovery among very low birth weight infants surviving ...

    African Journals Online (AJOL)

    A multiple linear regression showed a negative association between ZSW at discharge and number of days nil per os without parenteral nutrition (PN). Antenatal steroids were associated with poor GV. There were no factors associated with regaining birth weight after 21 days on multiple logistic regression. Conclusion.

  19. Unraveling possible association between quantitative trait loci (QTL ...

    African Journals Online (AJOL)

    fire7-

    2016-10-05

    Oct 5, 2016 ... The genes for host basal resistance seem to play similar roles in basal .... purpose DNA of each QTL-NILs was isolated following the CTAB isolation method ..... never sleep: non-host resistance in plants. J. Plant Physiol.

  20. Constructivism as the Framework for International Orders

    Science.gov (United States)

    2016-09-01

    idea that each kingdom had a right to sovereign control of its territory, laying the groundwork for our modern concept of the state.5 These shared...Washington, DC: NDU Press, 2013), Chapter 1 “Deviant Globalization” by Nils Gilman, Jesse Goldhammer, and Steven Weber , 3.

  1. Effects of dietary levels of vitamin A on growth, hematology, immune response and resistance of Nile tilapia (Oreochromis niloticus) to Streptococcus iniae

    Science.gov (United States)

    This study was conducted to evaluate the effect of supplemental levels of vitamin A (0, 2,500, 5,000, 10,000, and 20,000 IU/kg diet) on the growth performance, hematology, immune response and resistance of Nile tilapia, Oreochromis niloticus to Streptococcus iniae challenge. Each diet was fed to Nil...

  2. Ethiopian Journal of Environmental Studies & Management 7(2 ...

    African Journals Online (AJOL)

    Osondu

    2013-11-01

    Nov 1, 2013 ... the positioning of the sampled sites of water levels for both dry and rainy events. One grid ... Nigeria; Of which total rainfall, percentage of forest and .... where soil moisture in May is almost nil after ..... Chemical and isotopic.

  3. Genetic dissection of black grain rice by the development of a near isogenic line.

    Science.gov (United States)

    Maeda, Hiroaki; Yamaguchi, Takuya; Omoteno, Motoyasu; Takarada, Takeshi; Fujita, Kenji; Murata, Kazumasa; Iyama, Yukihide; Kojima, Yoichiro; Morikawa, Makiko; Ozaki, Hidenobu; Mukaino, Naoyuki; Kidani, Yoshinori; Ebitani, Takeshi

    2014-06-01

    Rice (Oryza sativa L.) can produce black grains as well as white. In black rice, the pericarp of the grain accumulates anthocyanin, which has antioxidant activity and is beneficial to human health. We developed a black rice introgression line in the genetic background of Oryza sativa L. 'Koshihikari', which is a leading variety in Japan. We used Oryza sativa L. 'Hong Xie Nuo' as the donor parent and backcrossed with 'Koshihikari' four times, resulting in a near isogenic line (NIL) for black grains. A whole genome survey of the introgression line using DNA markers suggested that three regions, on chromosomes 1, 3 and 4 are associated with black pigmentation. The locus on chromosome 3 has not been identified previously. A mapping analysis with 546 F2 plants derived from a cross between the black rice NIL and 'Koshihikari' was evaluated. The results indicated that all three loci are essential for black pigmentation. We named these loci Kala1, Kala3 and Kala4. The black rice NIL was evaluated for eating quality and general agronomic traits. The eating quality was greatly superior to that of 'Okunomurasaki', an existing black rice variety. The isogenicity of the black rice NIL to 'Koshihikari' was very high.

  4. Effects of nickel chloride and oxygen depletion on behaviour and vitality of zebrafish (Danio rerio, Hamilton, 1822) (Pisces, Cypriniformes) embryos and larvae

    International Nuclear Information System (INIS)

    Kienle, Cornelia; Koehler, H.-R.; Filser, Juliane; Gerhardt, Almut

    2008-01-01

    We examined acute (2 h exposure of 5-day-old larvae) and subchronic (exposure from fertilization up to an age of 11 days) effects of NiCl 2 .6H 2 O on embryos and larvae of zebrafish (Danio rerio), both alone and in combination with oxygen depletion. The following endpoints were recorded: acute exposure: locomotory activity and survival; subchronic exposure: hatching rate, deformations, locomotory activity (at 5, 8 and 11 days) and mortality. In acute exposures nickel chloride (7.5-15 mg Ni/L) caused decreasing locomotory activity. Oxygen depletion (≤2.45 ± 0.16 mg O 2 /L) also resulted in significantly reduced locomotory activity. In the subchronic test, exposure to ≥10 mg Ni/L resulted in delayed hatching at an age of 96 h, in decreased locomotory activity at an age of 5 days, and increased mortality at an age of 11 days (LC 20 = 9.5 mg Ni/L). The observed LOEC for locomotory activity (7.5 mg Ni/L) is in the range of environmentally relevant concentrations. Since locomotory activity was already affected by acute exposure, this parameter is recommended to supplement commonly recorded endpoints of toxicity. - Increasing concentrations of nickel chloride and decreasing concentrations of oxygen lead to reduced vitality and locomotory activity in Danio rerio embryos and larvae

  5. Bringing Culture Back In

    DEFF Research Database (Denmark)

    A number of international political scientists, economists, philosophers, and humanist scholars address the role of culture, ethnicity, and religion in contemporary states and societies. Contributions by Jørn Borup, Michael Böss, Marianne Qvortrup Fibiger, Antje Gimmler, Nils Holtug, John...

  6. Tööle innustavad aiaraamatud / Jaan Mettik

    Index Scriptorium Estoniae

    Mettik, Jaan

    2007-01-01

    Tallinnas 2006. a. kirjastuselt Maalehe Raamat ilmunud "Praktilisest aiarajaja käsiraamatust", Hermann Hacksteini ja Wota Wehmeyeri raamatust "Kiviktaimlaleksikon : teejuht kiviktaimla edukaks rajamiseks", kirjastuselt Varrak 2006. a. ilmunud Graham Rice raamatust "Segaaed" ja 2007. a. ilmunud Nils Skaareri taamatust "Koduõue kivid ja sillutis"

  7. Some ecological and biochemical observations on Caloglossa lepreiurii (Harvey) from Zuri estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Jagtap, T.G.; Untawale, A.G.

    January and February to nil. The alga prefers diffused light, fairly high temperatures, high nutrients and optimum salinity ranging between 10 ppt to 20 ppt. Major metabolites showed 272.75 mg/g dry weight was recorded in September. Organic carbon ranged...

  8. Secondhand smoke exposure among nonsmoking adults in two ...

    African Journals Online (AJOL)

    2011-06-15

    Jun 15, 2011 ... Department of Medicine, University of Ilorin Teaching Hospital, Ilorin; ... 2011, IP: 41.185.171.19] || Click here to download free Android application for .... The disadvantages include difficulties in validation, ... in English and local language depending on the ...... Source of Support: Nil, Con.ict of Interest: No.

  9. AcEST: DK944889 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 27-F10, full insert seque... 264 2e-69 tr|Q40093|Q40093_IPONI PNIL34 OS=Ipomoea nil GN=PNIL 34 PE=2 SV=1 263...LVY 487 VKNL+R+P Y M P++SGSVD AEFEPQLVY Sbjct: 367 VKNLKRIPHVAALVSEIIAAYLMPPIESGSVDFAEFEPQLVY 408 >tr|Q40093|Q40093_IPONI PNIL34

  10. Virtual lesion extension : a measure to quantify the effects of bacterial blight on rice leaf CO2 exchange

    NARCIS (Netherlands)

    Elings, A.; Rossing, W.A.H.; Werf, van der W.

    1999-01-01

    Virtual lesion extension was proposed as a measure to summarize the effects of foliar diseases with single spreading lesions on CO2-exchange parameters at the whole-leaf level. Visible lesion plus virtual lesion extension constitute a virtual lesion, in which CO2 exchange was postulated to be nil.

  11. Map-based Cloning and Characterization of the BPH18 Gene from Wild Rice Conferring Resistance to Brown Planthopper (BPH) Insect Pest.

    Science.gov (United States)

    Ji, Hyeonso; Kim, Sung-Ryul; Kim, Yul-Ho; Suh, Jung-Pil; Park, Hyang-Mi; Sreenivasulu, Nese; Misra, Gopal; Kim, Suk-Man; Hechanova, Sherry Lou; Kim, Hakbum; Lee, Gang-Seob; Yoon, Ung-Han; Kim, Tae-Ho; Lim, Hyemin; Suh, Suk-Chul; Yang, Jungil; An, Gynheung; Jena, Kshirod K

    2016-09-29

    Brown planthopper (BPH) is a phloem sap-sucking insect pest of rice which causes severe yield loss. We cloned the BPH18 gene from the BPH-resistant introgression line derived from the wild rice species Oryza australiensis. Map-based cloning and complementation test revealed that the BPH18 encodes CC-NBS-NBS-LRR protein. BPH18 has two NBS domains, unlike the typical NBS-LRR proteins. The BPH18 promoter::GUS transgenic plants exhibited strong GUS expression in the vascular bundles of the leaf sheath, especially in phloem cells where the BPH attacks. The BPH18 proteins were widely localized to the endo-membranes in a cell, including the endoplasmic reticulum, Golgi apparatus, trans-Golgi network, and prevacuolar compartments, suggesting that BPH18 may recognize the BPH invasion at endo-membranes in phloem cells. Whole genome sequencing of the near-isogenic lines (NILs), NIL-BPH18 and NIL-BPH26, revealed that BPH18 located at the same locus of BPH26. However, these two genes have remarkable sequence differences and the independent NILs showed differential BPH resistance with different expression patterns of plant defense-related genes, indicating that BPH18 and BPH26 are functionally different alleles. These findings would facilitate elucidation of the molecular mechanism of BPH resistance and the identified novel alleles to fast track breeding BPH resistant rice cultivars.

  12. Sud du Sahara | Page 188 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... mer dans les zones côtières du delta du Nil (Égypte). Langue French. Read more about Involvement of the Private Security Sector in African Conflicts, Peacekeeping and Humanitarian Assistance Operations. Langue English. Read more about Building Livelihood Resilience to Alleviate Poverty in Semi-arid Areas of West ...

  13. Comparison of growth, yield and fiber quality of the obsolete SA30 yellow leaf with four sets of modern yellow and green leaf near isogenic cotton (Gossypium hirsutum L.) lines

    Science.gov (United States)

    The Virescent Yellow leaf cotton line Seed Accession 30 (SA30) was crossed with four modern parental lines (DP5690, DES119, SG747 and MD51ne) to develop four sets of near isogenic lines (NILs) segregating for green and yellow leaves. Comparisons of these lines were made in the field in a two year re...

  14. International Uranium Resources Evaluation Project (IUREP) national favourability studies: Cook Islands

    International Nuclear Information System (INIS)

    1977-11-01

    The Cook Islands total only 320 square kilometers in area are located in the central South Pacific, and are made up of either volcanic material or coral. Since neither rock type is considered a good host or source of uranium, the uranium potential of the Cook Islands is considered nil. (author)

  15. Consumer health information partnerships: the health science library and multitype library system.

    Science.gov (United States)

    Hollander, S

    1996-04-01

    The University of Illinois Library of the Health Sciences at Rockford (LHS-Rockford) long has honored a commitment to serving the health information needs of the greater Rockford community. Utilization data collected over the past five years indicate that approximately 50% of reference transactions involve persons not affiliated with the university. In early 1994, LHS-Rockford submitted a proposal to the Northern Illinois Library System (NILS), a multitype system spanning twelve counties in northwestern Illinois, asking to serve as a resource library for improving medical and health information services provided by the 138 NILS member libraries. The NILS funded this pilot project as part of an effort to implement a new strategic plan, which encouraged member libraries to form networks to provide reference back-up service. LHS-Rockford acquired InfoTrac's Health Reference Center, a consumer health information database, and set up a dedicated workstation near the information and circulation desk. Referral guidelines were established and the project was promoted among NILS member libraries. Activities were documented in order to track project success in terms of referrals and outcomes. The demonstration project was very successful, and it proves public consumers seeking health information can benefit greatly from this type of cooperative arrangement.

  16. Nõutakse Eesti-Läti-Leedu lastefilme / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2005-01-01

    Berliini festivali filmiturul tutvustas Baltic Films kõige edukamalt lastefilme nagu Rene Vilbre "Röövlirahnu Martin". Läti animafilmist räägib festivali lastefilmide konkursil plastiliinanimatsiooniga "Kuule, jänes... papa sõidab Londonisse" esinenud Nils Skapans (s 1969). Lisatud tabelid "Balti riigid ja film 2004" ja "Mida Baltikumis mullu kõige enam vaadati?"

  17. Transfer standard device to improve the traceable calibration of physiotherapy ultrasound machines

    NARCIS (Netherlands)

    Hekkenberg, R.T.; Richards, A.; Beissner, K.; Zeqiri, B.; Bezemer, R.A.; Hodnett, M.; Prout, G.; Cantrall, C.

    2006-01-01

    Ultrasound (US) physiotherapy as a clinical treatment is extremely common in the Western world. Internationally, regulation to ensure safe application of US physiotherapy by regular calibration ranges from nil to mandatory. The need for a portable power standard (PPS) has been addressed within a

  18. Dead wood in European beech (Fagus sylvatica) forest reserves

    NARCIS (Netherlands)

    Christensen, M.; Hahn, K.; Mountford, E.P.; Ódor, P.; Standovár, T.; Rozenbergar, D.; Diaci, J.; Wijdeven, S.M.J.; Meyer, P.; Winter, S.; Vrska, T.

    2005-01-01

    Data were analysed on the volume of dead wood in 86 beech forest reserves, covering most of the range of European beech forests. The mean volume was 130 m3/ha and the variation among reserves was high, ranging from almost nil to 550 m3/ha. The volume depended significantly on forest type, age since

  19. Malaria has no effect on birth weight in Rwanda

    NARCIS (Netherlands)

    Rulisa, Stephen; Mens, Pètra F.; Karema, Corine; Schallig, Henk D. F. H.; Kaligirwa, Nadine; Vyankandondera, Joseph; de Vries, Peter J.

    2009-01-01

    Malaria has a negative effect on pregnancy outcome, causing low birth weight, premature birth and stillbirths, particularly in areas with high malaria transmission. In Rwanda, malaria transmission intensity ranges from high to nil, probably associated with variable altitudes. Overall, the incidence

  20. Viis sepapoissi näitavad raua tulist ilu / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2010-01-01

    Eesti Kunstiakadeemia sepakunsti eriala tudengite Nils Hindi, Hans-Otto Ojaste, Urmas Lüüsi, Fred Truusi ja Jan Västeri näitus "Ferri canes" Dominiiklaste kloostri Mauritiuse Instituudis (Tallinn, Müürivahe 33) 30. juunini 2010

  1. Elus sepakunst / Heili Sõrmus

    Index Scriptorium Estoniae

    Sõrmus, Heili

    2010-01-01

    Eesti Kunstiakadeemia sepakunsti eriala üliõpilaste Nils Hindi (animatsioon "Kratt" koostöös Rainer Kaasik-Aaslaviga), Hans-Otto Ojaste, Urmas Lüüsi, Fred Truusi ja Jan Västeri sepakunsti näitus "Ferri canes" Dominiiklaste kloostri Mauritiuse Instituudis (Tallinn, Müürivahe 33) 30. juulini 2010

  2. (Ventouse) in Modern Obstetric Practice in Nigeria

    African Journals Online (AJOL)

    2014-01-10

    unknown, about 10‑15% in the UK[14] 4.5% in the USA. ... [Downloaded free from http://www.amhsr.org on Friday, January 10, 2014, IP: 197.87.13.14] || Click here to download free Android application for this journal .... Source of Support: Nil.

  3. A Clinicomycological Study of Cutaneous Mycoses in Sawai Man ...

    African Journals Online (AJOL)

    2014-01-10

    [Downloaded free from http://www.amhsr.org on Friday, January 10, 2014, IP: 197.87.13.14] || Click here to download free Android application for this ..... mechanism of action are unknown, by some of the respondents .... Source of Support: Nil.

  4. Comparison of 25 and 50 microgram of misoprostol for induction of ...

    African Journals Online (AJOL)

    2014-09-03

    Sep 3, 2014 ... ... on Friday, February 20, 2015, IP: 41.135.175.148] || Click here to download free Android application for this journal ... action is unknown.[5] At present, there is no ..... Source of Support: Nil, Conflict of Interest: None declared.

  5. Kallinevad bussipiletid kiskusid Valgamaa altkäemaksuskandaali / Risto Berendson

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 29. okt. lk. 4-5. Transpordiettevõtte GoBus juhte kahtlustatakse Valgamaa maavanemale altkäemaksu andmises. Vt. samas: Nils Niitra. Kriminaalasi avas suuromanikele võimaluse juhte vallandada; Priit Rajalo. Naabrimehed Valgas peavad maavanemat tipp-topp meheks

  6. Fabrication and characterization of free-standing, high-line-density transmission gratings for the vacuum UV to soft X-ray range

    NARCIS (Netherlands)

    Goh, S.J.; Bastiaens, Hubertus M.J.; Vratzov, B.; Huang, Qiushi; Bijkerk, Frederik; Boller, Klaus J.

    2015-01-01

    We present state-of-the-art high resolution transmission gratings, applicable for spectroscopy in the vacuum ultraviolet (VUV) and the soft X-ray (SRX) wavelength range, fabricated with a novel process using ultraviolet based nano imprint lithography (UV-NIL). Free-standing, high-line-density

  7. Crumbs, Thieves, and Relics: Translation and Alien Humanism

    Science.gov (United States)

    McAlhany, Joseph

    2014-01-01

    Terence's famous humanistic motto, "homo sum: humani nil a me alienum puto," was transmitted from antiquity to modernity as an isolated fragment of a surviving play, and was subjected to various forms of translation and interpretation. In this essay, Joseph McAlhany argues that fragments and translation, by their nature, resist…

  8. Theory of Gearing

    Science.gov (United States)

    1989-12-01

    a surface has a tangen plane at Us. if the sot of limiting toyot nil.b in a plasne. Figirst 1131 shows dhre t ypes ofw (esif limiting rays. In the...Kinematic precision is affected by errors which are the result of either intentional adjustments or accidental defects in the manufacturing and assembly

  9. Supramolecular Layer-by-Layer Assembly of 3D Multicomponent Nanostructures via Multivalent Molecular Recognition

    NARCIS (Netherlands)

    Ling, X.Y.; Phang, In Yee; Reinhoudt, David; Vancso, Gyula J.; Huskens, Jurriaan

    2008-01-01

    The supramolecular layer-by-layer assembly of 3D multicomponent nanostructures of nanoparticles is demonstrated. Nanoimprint lithography (NIL) was used as the patterning tool for making patterned β-cyclodextrin (CD) self-assembled monolayers (SAMs) and for the confinement of nanoparticles on the

  10. Macrobenthos of the shelf off north eastern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Harkantra, S.N.; Rodrigues, C.L.; Parulekar, A.H.

    .6 (x = 10.61 + or - 3.2 gm/2) and from nil to 12.572 (x = 839 + or - 120 m/2) respectively. Loose sand sheltered rich fauna whereas muddy substrata has very poor fauna. Twenty nine major taxa were identified. Polychaeta formed the dominant group...

  11. Fabrication of nanoparticle and protein nanostructures using nanoimprint lithography

    NARCIS (Netherlands)

    Maury, P.A.

    2007-01-01

    Nanoimprint lithography (NIL) was used as a tool to pattern self-assembled monolayers (SAMs) on silicon substrates because of its ability to pattern in the micrometer and nanometer ranges. The resulting polymer template behaved as a physical barrier preventing the formation of a SAM in the covered

  12. Reply to Pfister and Hellweg: Water footprint accounting, impact assessment, and life-cycle assessment

    NARCIS (Netherlands)

    Hoekstra, Arjen Y.; Gerbens-Leenes, Winnie; van der Meer, Theo H.

    2009-01-01

    In response to our article on the blue and green water footprint (WF) of bioenergy (1), others propose to multiply each blue WF component by a water-stress index and neglect green WFs, because impacts would be nil (2). They propose to redefine the WF from a volumetric measure to an index resulting

  13. Strength and stiffness capacity utilisation of timber members in roof ...

    African Journals Online (AJOL)

    C Brand Wessels, Nils-Olaf Petersen. Abstract. The main objective of this study was to determine which property, of the six strength and stiffness properties used in structural timber design, was the most influential in the design of nail-plated roof trusses. Thirty recently completed nail-plated roof truss designs were randomly ...

  14. High Levels of Phytophenolics and Antioxidant Activities in Oryza ...

    African Journals Online (AJOL)

    Purpose: To investigate phenolic levels, phytophenolic profiles and total antioxidant activities of Oryza sativa, unpolished Thai rice. Methods: Unpolished Thai rice strains of Leum Phua, Klam, Hawm Nil and Black Rose were measured for antioxidant activity using 1,1-diphenyl-2-picrylhydrazyl (DPPH), ...

  15. Elements and rationale for a common approach to assess and report soil disturbance.

    Science.gov (United States)

    Mike Curran; Doug Maynard; Ron Heninger; Tom Terry; Steve Howes; Doug Stone; Tom Niemann; Richard E. Miller

    2008-01-01

    Soil disturbance from forest practices ranges from barely perceptible to very obvious, and from positive to nil to negative effects on forest productivity and 1 or hydrologic function. Currently, most public and private landholders and various other interested parties have different approaches to describing this soil disturbance. More uniformity is needed to describe,...

  16. Time-Efficient High-Resolution Large-Area Nano-Patterning of Silicon Dioxide

    Directory of Open Access Journals (Sweden)

    Li Lin

    2017-01-01

    Full Text Available A nano-patterning approach on silicon dioxide (SiO2 material, which could be used for the selective growth of III-V nanowires in photovoltaic applications, is demonstrated. In this process, a silicon (Si stamp with nanopillar structures was first fabricated using electron-beam lithography (EBL followed by a dry etching process. Afterwards, the Si stamp was employed in nanoimprint lithography (NIL assisted with a dry etching process to produce nanoholes on the SiO2 layer. The demonstrated approach has advantages such as a high resolution in nanoscale by EBL and good reproducibility by NIL. In addition, high time efficiency can be realized by one-spot electron-beam exposure in the EBL process combined with NIL for mass production. Furthermore, the one-spot exposure enables the scalability of the nanostructures for different application requirements by tuning only the exposure dose. The size variation of the nanostructures resulting from exposure parameters in EBL, the pattern transfer during nanoimprint in NIL, and subsequent etching processes of SiO2 were also studied quantitatively. By this method, a hexagonal arranged hole array in SiO2 with a hole diameter ranging from 45 to 75 nm and a pitch of 600 nm was demonstrated on a four-inch wafer.

  17. Epithelial Inclusion Cyst in a Cervical Lymph Node: Report of a Rare ...

    African Journals Online (AJOL)

    epithelial inclusion cyst within a submandibular lymph node. ... Financial support and sponsorship. Nil. Conflicts of interest. There are no conflicts of interest. Bahadur S, Pujani M, Jetley S. Department of Pathology, Hamdard Institute of Medical. Sciences and Research, Jamia Hamdard, New Delhi, India. E‑mail: ...

  18. Plasma-assisted quartz-to-quartz direct bonding for the fabrication of a multilayered quartz template for nanoimprint lithography

    International Nuclear Information System (INIS)

    Lee, Jihye; Ali, Altun; Kim, Ki-don; Choi, Dae-guen; Choi, Jun-Hyuk; Jeong, Jun-ho; Kim, Jae-Hyun

    2010-01-01

    In this paper, a low-temperature plasma-assisted process is developed to realize a uniform, ultraviolet (UV) transparent and chemically inert quartz-to-quartz direct bonding. Two sets of pretests are performed in order to understand how the bond surface energy changes with the plasma exposure time and the wet etching of quartz, respectively. The developed technique is used to fabricate a multilayered quartz template for UV nanoimprint lithography (UV-NIL). The multilayered quartz template is fabricated by bonding a square piece of a standard quartz wafer, which is about 625 µm in thickness, to a wet-etched 6.35 mm thick quartz photomask plate. A fabricated multilayered template is loaded to the commercial UV-NIL tool Imprio(TM) 100, and NIL was performed successfully. The developed direct bonding technique makes it possible for standard quartz wafers, which are compatible with high-resolution semiconductor fabrication processes, to be utilized as the templates in commercial UV-NIL machines with enhanced mechanical stability.

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 401 - 450 of 516 ... ... gain from tree breeding strategies : risks and benefits : creating new germplasm, Abstract ... C Brand Wessels, Nils-Olaf Petersen ... of sap flow in two Eucalyptus species established in the vicinity of gold-mine tailings ...

  20. Herpes Zoster‑Induced Acute Urinary Retention: Two Cases and ...

    African Journals Online (AJOL)

    2018-04-04

    Apr 4, 2018 ... We report two uncommon cases of acute urinary retention in Chinese patients caused by reactivation of sacral herpes zoster and ... creations are licensed under the identical terms. For reprints contact: reprints@medknow.com .... anonymity cannot be guaranteed. Financial support and sponsorship. Nil.

  1. Bibliography of Soviet Laser Developments, Number 66, July-August 1983.

    Science.gov (United States)

    1984-09-01

    Scientific Research Institute of Motion Pictures and Photography (NI kinofotoinstitut). 243. Radio Engineering Institute, AN SSSR (Radiotekhnicheskiy...Research Institute of Otolaryngology im Kolomiychenko (Kiyevskiy NIl otolaringologii im Kolomiychenko). 608. Mozyr State Pedagogical Institute (Mozyrskiy...756. Institute of Geology, Komi Branch, AN SSSR (Institut geologii Komi filiala AN SSSR). 757. Ukrainian Scientific Research Institute of Tools and

  2. Photonic crystal structures on nonflat surfaces fabricated by dry lift-off soft UV nanoimprint lithography

    International Nuclear Information System (INIS)

    Sun, Tangyou; Xu, Zhimou; Xu, Haifeng; Zhao, Wenning; Wu, Xinghui; Liu, Sisi; Ma, Zhichao; He, Jian; Liu, Shiyuan; Peng, Jing

    2013-01-01

    The surface nonflatness induced from the material itself or the production atmosphere can lead to serious non-uniformity consequences in nanoimprint lithography (NIL) which is used for providing a low cost and high throughput nano-fabrication process. In this paper, soft UV NIL (SUNIL) processes are used for photonic crystal (PC) pattern transfer of a GaN-based light-emitting diode (LED) with patterned sapphire substrate (PSS). The results reveal a significant incompatibility between the conventional SUNIL and the nonflat p-GaN surface. Ellipse-shaped rather than circle-shaped PC structure is obtained on the p-GaN surface due the deformation of the soft mold in nonflat NIL. A dry lift-off (DLO) SUNIL is proposed to overcome the non-uniformity issue in nonflat NIL as well as the collapse problem of the free-standing pillar-shaped resist in wet lift-off. The photoluminescence enhancements of the LED fabricated by the DLO SUNIL method compared to those with conventional SUNIL and unpatterned LED are 1.41 fold and 3.48 fold, respectively. Further study shows that the DLO SUNIL is applicable in the fabrication of the PC structure with tunable duty cycle via one single initial PC mold. (paper)

  3. «Вольное переложение» Жития Феодора Студита"Free transposition" of The Life of Theodore Studite

    Directory of Open Access Journals (Sweden)

    Tamara P. Lönngren

    2012-01-01

    Full Text Available This article deals with the manuscript tradition named "free transposition" applied to The Life of Theodore Studite in Old Russian literature. Evidence is presented that the author of this "free transposition" was indeed Nil Sorskij. The investigation of eight recently discovered copies has made it possible to establish their mutual interdependence and to construct the corresponding stemma.

  4. Fine mapping of a quantitative resistance gene for gray leaf spot of maize (Zea mays L.) derived from teosinte (Z. mays ssp. parviglumis)

    Science.gov (United States)

    In previous work, using near isogenic line (NIL) populations in which segments of the tesosinte (Zea mays ssp. parviglumis) genome had been introgressed into the background of the maize line B73, we had identified a QTL on chromosome 8, here called Qgls8, for gray leaf spot resistance. We identified...

  5. Novel Technique for Safe Primary Trocar Insertion in Laparoscopy: Chou's Method

    Directory of Open Access Journals (Sweden)

    Pan-Hsin Chou

    2005-06-01

    Conclusion: The results with this novel method incorporating the unique concept of directly holding the fascia suggest it to be relatively safe, simple, and economic. The risk of major vascular injury was decreased to nil by this technique and the chance of visceral injury was also minimal.

  6. Un nouveau centre de recherche soutient les efforts d'adaptation ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 juil. 2014 ... Image satellite du delta du Nil. José Alberto Gonçalves Pereira. Entretien avec. Mohamed Abdrabo est le directeur général de l'Alexandria Research Centre for Adaptation to Climate Change (ARCA), un nouveau centre de recherche qui soutient les politiques d'adaptation adoptées par le gouvernement ...

  7. Mehed ilumaailmast / Krista Dudarenko

    Index Scriptorium Estoniae

    Dudarenko, Krista, 1970-

    2007-01-01

    Vestlusringis osalevad Lumene Eesti OÜ tegevdirektor Indrek Lepik, ASi Pariisi Vesi omanik ja juht Nils Niimann, L'Oreali massikosmeetika müügijuht Ivo Rundans, Riviera Internationali juht Antoine Stecken, Sirowa Grupi direktor Juergen Warzecha ning omanimelise kosmeetikafirma omanik Heino Puuste

  8. Un nouveau centre de recherche soutient les efforts d'adaptation ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 juil. 2014 ... Mohamed Abdrabo est le directeur général de l'Alexandria Research Centre for Adaptation to Climate Change (ARCA), un nouveau centre de recherche qui soutient les politiques d'adaptation adoptées par le gouvernement égyptien au regard du delta du Nil.

  9. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    coordinated distorted octahedral environments, and the isophthalato ligand bridges two Ni(II) centres in a bis bidentate fashion to form dimers in all three complexes. The monomers of {[Ni(-L)]2(-IPA)}2+ are connected through intermolecular ...

  10. Fast thermal nanoimprint lithography by a stamp with integrated heater

    DEFF Research Database (Denmark)

    Tormen, Massimo; Malureanu, Radu; Pedersen, Rasmus Haugstrup

    2008-01-01

    We propose fast nanoimprinting lithography (NIL) process based on the use of stamps with integrated heater. The latter consists of heavily ion implantation n-type doped silicon layer buried below the microstructured surface of the stamp. The stamp is heated by Joule effect, by 50 μs 25 Hz...

  11. The use of nested PCR in the polymerase chain reaction for the detection of Phytophthora fragariae and P. cactorum in strawberry,

    NARCIS (Netherlands)

    Lacourt, I.; Bonants, P.J.M.; Gent-Pelzer, van M.P.; Cooke, D.E.L.; Hagenaar-de Weerdt, M.; Surplus, L.; Duncan, J.M.

    1997-01-01

    Phytophthora fragariae var. fragariae Hickman, which causes red core disease of strawberry, is a quarantine organism on which a nil tolerance is placed. Detection of the fungus is by a root tip bait test which is highly specific and sensitive but time-consuming (5–6 weeks), has to be done at 12°C

  12. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 30; Issue 1. Volume 30, Issue 1. February 2005, pages 1-85. pp 1-10. Thermal effect on gravity waves in a compressible liquid layer over a solid half-space under initial hydrostatic stress · Sushil Kumar Addy Nil Ratan Chakraborty · More Details Abstract Fulltext PDF. This paper deals with ...

  13. Ultrasound guided percutaneous fine needle aspiration biopsy ...

    African Journals Online (AJOL)

    2011-06-15

    Jun 15, 2011 ... guided PFNAB/US-guided PNCB was the diagnostic test in 23.33% cases. It confirmed a highly ..... provides guidance in multiple axial, longitudinal and .... Source of Support: Nil, Con.ict of Interest: None declared. Gani, et al.

  14. Histopathological Study of Placentae in Low Birth Weight Babies in ...

    African Journals Online (AJOL)

    Chi‑square test with or without yate's correction was used as and when required. P < 0.05 was taken as .... For fixation, the placenta was cut into the multiple longitudinal slices of on-2 cm and kept ..... Source of Support: Nil. Conflict of Interest: ...

  15. Broader leaves result in better performance of indica rice under drought stress.

    Science.gov (United States)

    Farooq, M; Kobayashi, N; Ito, O; Wahid, A; Serraj, R

    2010-09-01

    Leaf growth is one of the first physiological processes affected by changes in plant water status under drought. A decrease in leaf expansion rate usually precedes any reduction in stomatal conductance or photosynthesis. Changes in leaf size and stomatal opening are potential adaptive mechanisms, which may help avoid drought by reducing transpiration rate, and can be used to improve rice genotypes in water-saving cultivation. The indica rice cultivar IR64 and four of its near-isogenic lines (NILs; BC(3)-derived lines) unique for leaf size traits, YTK 124 (long leaves), YTK 127 (broad leaves), YTK 205 (short leaves) and YTK 214 (narrow leaves), were compared in this study for changes in leaf growth and its water status. The plants were subjected to two soil water regimes, well-watered and progressive soil drying measured by the fraction of transpirable soil water (FTSW). Applied drought reduced leaf number, total leaf area, specific leaf area, plant biomass, tiller number, plant height, stomatal conductance, amount of water transpired, leaf relative water content, and leaf water potential more in IR64 and the NILs than in the respective controls; nonetheless, transpiration efficiency (TE) was slightly higher under drought than in the well-watered controls. NILs with broader leaves had higher biomass (and its individual components), less stomatal conductance, and higher TE under drought than NILs with narrow and shorter leaves. Under drought, leaf number was positively correlated with tiller number and plant height; nonetheless, root weight and total biomass, water transpired and TE, and plant height and TE were positively correlated with each other. However, a negative correlation was observed between stomatal conductance and the FTSW threshold at which normalized transpiration started to decline during soil drying. Overall, the IR64-derived lines with broader leaves performed better than NILs with narrow and short leaves under drought. Copyright 2010 Elsevier Gmb

  16. Identification of Candidate Genes Responsible for Stem Pith Production Using Expression Analysis in Solid-Stemmed Wheat.

    Science.gov (United States)

    Oiestad, A J; Martin, J M; Cook, J; Varella, A C; Giroux, M J

    2017-07-01

    The wheat stem sawfly (WSS) is an economically important pest of wheat in the Northern Great Plains. The primary means of WSS control is resistance associated with the single quantitative trait locus (QTL) , which controls most stem solidness variation. The goal of this study was to identify stem solidness candidate genes via RNA-seq. This study made use of 28 single nucleotide polymorphism (SNP) makers derived from expressed sequence tags (ESTs) linked to contained within a 5.13 cM region. Allele specific expression of EST markers was examined in stem tissue for solid and hollow-stemmed pairs of two spring wheat near isogenic lines (NILs) differing for the QTL. Of the 28 ESTs, 13 were located within annotated genes and 10 had detectable stem expression. Annotated genes corresponding to four of the ESTs were differentially expressed between solid and hollow-stemmed NILs and represent possible stem solidness gene candidates. Further examination of the 5.13 cM region containing the 28 EST markers identified 260 annotated genes. Twenty of the 260 linked genes were up-regulated in hollow NIL stems, while only seven genes were up-regulated in solid NIL stems. An -methyltransferase within the region of interest was identified as a candidate based on differential expression between solid and hollow-stemmed NILs and putative function. Further study of these candidate genes may lead to the identification of the gene(s) controlling stem solidness and an increased ability to select for wheat stem solidness and manage WSS. Copyright © 2017 Crop Science Society of America.

  17. Characterization and fine mapping of qkc7.03: a major locus for kernel cracking in maize.

    Science.gov (United States)

    Yang, Mingtao; Chen, Lin; Wu, Xun; Gao, Xing; Li, Chunhui; Song, Yanchun; Zhang, Dengfeng; Shi, Yunsu; Li, Yu; Li, Yong-Xiang; Wang, Tianyu

    2018-02-01

    A major locus conferring kernel cracking in maize was characterized and fine mapped to an interval of 416.27 kb. Meanwhile, combining the results of transcriptomic analysis, the candidate gene was inferred. Seed development requires a proper structural and physiological balance between the maternal tissues and the internal structures of the seeds. In maize, kernel cracking is a disorder in this balance that seriously limits quality and yield and is characterized by a cracked pericarp at the kernel top and endosperm everting. This study elucidated the genetic basis and characterization of kernel cracking. Primarily, a near isogenic line (NIL) with a B73 background exhibited steady kernel cracking across environments. Therefore, deprived mapping populations were developed from this NIL and its recurrent parent B73. A major locus on chromosome 7, qkc7.03, was identified to be associated with the cracking performance. According to a progeny test of recombination events, qkc7.03 was fine mapped to a physical interval of 416.27 kb. In addition, obvious differences were observed in embryo development and starch granule arrangement within the endosperm between the NIL and its recurrent parent upon the occurrence of kernel cracking. Moreover, compared to its recurrent parent, the transcriptome of the NIL showed a significantly down-regulated expression of genes related to zeins, carbohydrate synthesis and MADS-domain transcription factors. The transcriptomic analysis revealed ten annotated genes within the target region of qkc7.03, and only GRMZM5G899476 was differently expressed between the NIL and its recurrent parent, indicating that this gene might be a candidate gene for kernel cracking. The results of this study facilitate the understanding of the potential mechanism underlying kernel cracking in maize.

  18. DINAMIKA BISNIS TRAVEL UMROH SE KOTA PASURUAN DI ERA GLOBALISASI

    Directory of Open Access Journals (Sweden)

    Dewi Masitah

    2015-12-01

    Full Text Available This research aims to know how the Ethics and responsibility of  PT TRAVEL Umrah conducts its travel business?. This background research of Various motivations variety PT TRAVEL Umrah in implementing its travel business. Is that motivation is not only a business commodity, so causing a few problems related to that Travel, among others, the cheapness of travel so that the number of Umrah pilgrims displaced and not so depart with many reasons such as the visa is not out or travel unclear. This research is a qualitative research of Phenomenology. The research data obtained through technique of observation, in-depth interviews (in-depth interview, Focus Group Discussion (FGD and documentation with data analysis using a model of Miles and Huberman, which includes three lines of analysis, namely data reduction (data reduction, a data display (presentation data, and conclusion drawing / verification (conclusion. This Research uses the perspective of Petter Beyyer related to a religious commodity for the sake of a capitalist. Business in the name of religion is a commodity.

  19. A mathematical programming approach for sequential clustering of dynamic networks

    Science.gov (United States)

    Silva, Jonathan C.; Bennett, Laura; Papageorgiou, Lazaros G.; Tsoka, Sophia

    2016-02-01

    A common analysis performed on dynamic networks is community structure detection, a challenging problem that aims to track the temporal evolution of network modules. An emerging area in this field is evolutionary clustering, where the community structure of a network snapshot is identified by taking into account both its current state as well as previous time points. Based on this concept, we have developed a mixed integer non-linear programming (MINLP) model, SeqMod, that sequentially clusters each snapshot of a dynamic network. The modularity metric is used to determine the quality of community structure of the current snapshot and the historical cost is accounted for by optimising the number of node pairs co-clustered at the previous time point that remain so in the current snapshot partition. Our method is tested on social networks of interactions among high school students, college students and members of the Brazilian Congress. We show that, for an adequate parameter setting, our algorithm detects the classes that these students belong more accurately than partitioning each time step individually or by partitioning the aggregated snapshots. Our method also detects drastic discontinuities in interaction patterns across network snapshots. Finally, we present comparative results with similar community detection methods for time-dependent networks from the literature. Overall, we illustrate the applicability of mathematical programming as a flexible, adaptable and systematic approach for these community detection problems. Contribution to the Topical Issue "Temporal Network Theory and Applications", edited by Petter Holme.

  20. Preliminary investigation to use Bayesian networks in predicting NOx, CO, CO2 and HC emissions

    International Nuclear Information System (INIS)

    Karri, V.; Hafez, H.A.; Kristiansen, M.

    2005-01-01

    A Bayesian network was used to characterize Lister-Petter diesel combustion engine emissions. Three sets of tests were conducted: (1) full open throttle; (2) 68 per cent closed throttle; and (3) 58 per cent closed throttle. The first test simulated normal lean burning conditions, while the last 2 tests simulated a clogged air filter. Experiments were conducted in an engine generator assembly with a fixed speed governor of 1500 rpm. Electrochemical sensors were used to detect nitrogen oxide (NO x ); carbon dioxide (CO 2 ); carbon monoxide (CO); hydrocarbons; and particulate matter. Engine oil, engine outlet, and engine inlet and exhaust temperatures were digitally measured. Data from 20 experimental sets of tests were used to train, test and project accurate emission levels. The Bayesian network model was built using input variables and measured output parameters related to the exhaust components. Human knowledge was used to build relationships between defined nodes and a path condition algorithm. An estimation-maximization algorithm was used. Results of the validation study showed that the Bayesian network accurately predicted emissions levels. It was concluded that it is possible to predict engine emission outputs with probable acceptable levels using Bayesian network modelling techniques and limited experimental data. 33 refs., 3 tabs., 8 figs

  1. Redescriptions and comments on the validity of Acuaria subula and A. skrjabini (Nematoda, Spirurida, Acuariidae), parasites of passerine birds.

    Science.gov (United States)

    Mutafchiev, Yasen; Kontrimavichus, Vytautas L; Georgiev, Boyko B

    2013-09-01

    Acuaria subula (Dujardin, 1845) is redescribed by light microcopy (LM) and scanning electron microscopy (SEM) on the basis of specimens from its type host, Erithacus rubecula (Passeriformes, Muscicapidae), from Curonian Spit (Kaliningradskaya Oblast', Russia) and Bulgaria. Acuaria skrjabini (Ozerskaya, 1926) is redescribed by LM and SEM on the basis of specimens from Passer domesticus (type host) and P. hispaniolensis (Passeriformes, Passeridae) from Bulgaria. Contrary to previous opinions recognizing A. skrjabini as a junior synonym of A. subula, the present study confirms that they are distinct species. They can be distinguished on the basis of the ratio between the length of cordons and the body length, the ratio between the length of muscular oesophagus and glandular oesophagus, and the ratio between the total length of oesophagus and the body length. In addition, the plates forming the cordons in these two species exhibit different morphological characters. Another difference between these two species is associated with the particular irregular mosaic ornamentation of the cuticle on the ventral and lateral sides of body around the region of vulva of A. subula and its absence in A. skrjabini. Data on their host and geographical ranges are surveyed. The type series of Acuaria buttnerae Chabaud et Petter, 1961, described as a parasite of Calandrella brachydactyla (Passeriformes, Alaudidae) in France, is re-examined; the latter species is recognized as a junior synonym of A. skrjabini (new synonymy).

  2. Further developments in performance prediction techniques of adiabatic diesel engines

    Energy Technology Data Exchange (ETDEWEB)

    Rasihhan, Y

    1990-01-01

    The engine cycle simulation program 'SPICE', developed at Bath University, has been used extensively for insulated diesel engine research. The present study introduces more comprehensive engine heat transfer models thus enabling us to study the insulated engine heat transfer and performance characteristics in more detail. The new version of 'SPICE' separates the gas to wall heat transfer into two parts, convective and radiative. For this purpose, a detailed radiative heat transfer model which considers both the flame (gas and soot) and wall to wall radiative heat transfer is written. The previous engine resistance model is refined and replaced by a more detailed resistance model which considers piston-liner conduction heat transfer and 2-D heat flow in the liner. The wall surface temperature swing is also included in the engine heat transfer calculations which is quite significant in low conductivity ceramic insulated engines. A 1-D finite difference model is written for the transient heat transfer region of the wall and linked to the engine resistance model. This new version of 'SPICE' is used to predict the insulated engine heat transfer and performance for the experimental Petter PH1W engine for various insulation levels and schemes. An answer to the controversy of increase in engine heat loss with insulation is looked for. The effect of wall deposits on engine heat transfer and its significance for the insulated engine is highlighted. (Author).

  3. Potential climatic impact of organic haze on early Earth.

    Science.gov (United States)

    Hasenkopf, Christa A; Freedman, Miriam A; Beaver, Melinda R; Toon, Owen B; Tolbert, Margaret A

    2011-03-01

    We have explored the direct and indirect radiative effects on climate of organic particles likely to have been present on early Earth by measuring their hygroscopicity and cloud nucleating ability. The early Earth analog aerosol particles were generated via ultraviolet photolysis of an early Earth analog gas mixture, which was designed to mimic possible atmospheric conditions before the rise of oxygen. An analog aerosol for the present-day atmosphere of Saturn's moon Titan was tested for comparison. We exposed the early Earth aerosol to a range of relative humidities (RHs). Water uptake onto the aerosol was observed to occur over the entire RH range tested (RH=80-87%). To translate our measurements of hygroscopicity over a specific range of RHs into their water uptake ability at any RH 100%, we relied on the hygroscopicity parameter κ, developed by Petters and Kreidenweis. We retrieved κ=0.22 ±0.12 for the early Earth aerosol, which indicates that the humidified aerosol (RH 100%). In regions where the haze was dominant, it is expected that low particle concentrations, once activated into cloud droplets, would have created short-lived, optically thin clouds. Such clouds, if predominant on early Earth, would have had a lower albedo than clouds today, thereby warming the planet relative to current-day clouds. © Mary Ann Liebert, Inc.

  4. Cucullanid nematodes (Nematoda: Cucullanidae) from deep-sea marine fishes off New Caledonia, including Dichelyne etelidis n. sp.

    Science.gov (United States)

    Moravec, František; Justine, Jean-Lou

    2011-02-01

    Three nematode species of the family Cucullanidae, intestinal parasites of marine perciform fishes, are reported from off New Caledonia: Cucullanus bourdini Petter & Le Bel, 1992 from the crimson jobfish Pristipomoides filamentosus (Valenciennes) and the goldflag jobfish Pristipomoides auricilla (Jordan, Evermann & Tanaka) (new host record) (both Lutjanidae); Dichelyne etelidis n. sp. from the deep-water red snapper Etelis carbunculus Cuvier (type-host) and the deep-water longtail red snapper Etelis coruscans Valenciennes (both Lutjanidae); and Dichelyne sp. (only one female) from the trumpet emperor Lethrinus miniatus (Forster) (Lethrinidae). Detailed light and electron microscopical studies revealed in C. bourdini some taxonomically important, previously unreported features, such as the location of the excretory pore, nature of the vulva and the size of fully-developed eggs. The new species, D. etelidis, is characterised mainly by the length of the spicules (462-748 μm), a single intestinal caecum, the location of the deirids and excretory pore, the arrangement of the genital papillae and the host group.

  5. Reinterpretaion of the friendship paradox

    Science.gov (United States)

    Fu, Jingcheng; Wu, Jianliang

    The friendship paradox (FP) is a sociological phenomenon stating that most people have fewer friends than their friends do. It is to say that in a social network, the number of friends that most individuals have is smaller than the average number of friends of friends. This has been verified by Feld. We call this interpreting method mean value version. But is it the best choice to portray the paradox? In this paper, we propose a probability method to reinterpret this paradox, and we illustrate that the explanation using our method is more persuasive. An individual satisfies the FP if his (her) randomly chosen friend has more friends than him (her) with probability not less than 1/2. Comparing the ratios of nodes satisfying the FP in networks, rp, we can see that the probability version is stronger than the mean value version in real networks both online and offline. We also show some results about the effects of several parameters on rp in random network models. Most importantly, rp is a quadratic polynomial of the power law exponent γ in Price model, and rp is higher when the average clustering coefficient is between 0.4 and 0.5 in Petter-Beom (PB) model. The introduction of the probability method to FP can shed light on understanding the network structure in complex networks especially in social networks.

  6. São Jerônimo em Tradução.

    Directory of Open Access Journals (Sweden)

    Maria Esther Maciel

    2001-12-01

    Full Text Available São Jerônimo teve que reinventar o latim para traduzir a Bíblia diretamente da língua hebraica, causando efeitos de estranhamento em seus contemporâneos e inaugurando uma nova concepção da arte de traduzir. No cinema contemporâneo, pelo menos dois cineastas trouxeram á tela a figura do santo tradutor: Julio Bressane, em São Jerônimo, e Petter Greenaway, em O livro de cabeceira No casa deste, a evocação de Jerônimo entrelaça-se obliquamente, através do protagonista Jerome, á de um tradutor importante para a poesia de língua inglesa do século XX: Arthur Waley, o primeiro a traduzir para o inglês o clássico japon~es O livro de cabeceira, de Sei Shonagon. No Brasil, Horoldo de Campos marca a confluência dessas duas vertentes: a tradução criativa da poesia oriental e a da reescrita – na trilha aberta por São Jerônimo – de fragmentos da Bíblia a partir do original hebraico.

  7. Fine mapping of a quantitative resistance gene for gray leaf spot of maize (Zea mays L.) derived from teosinte (Z. mays ssp. parviglumis).

    Science.gov (United States)

    Zhang, Xinye; Yang, Qin; Rucker, Elizabeth; Thomason, Wade; Balint-Kurti, Peter

    2017-06-01

    In this study we mapped the QTL Qgls8 for gray leaf spot (GLS) resistance in maize to a ~130 kb region on chromosome 8 including five predicted genes. In previous work, using near isogenic line (NIL) populations in which segments of the teosinte (Zea mays ssp. parviglumis) genome had been introgressed into the background of the maize line B73, we had identified a QTL on chromosome 8, here called Qgls8, for gray leaf spot (GLS) resistance. We identified alternate teosinte alleles at this QTL, one conferring increased GLS resistance and one increased susceptibility relative to the B73 allele. Using segregating populations derived from NIL parents carrying these contrasting alleles, we were able to delimit the QTL region to a ~130 kb (based on the B73 genome) which encompassed five predicted genes.

  8. Printable photonic crystals with high refractive index for applications in visible light

    International Nuclear Information System (INIS)

    Calafiore, Giuseppe; Mejia, Camilo A; Munechika, Keiko; Peroz, Christophe; Piña-Hernandez, Carlos; Fillot, Quentin; Dhuey, Scott; Sassolini, Simone; Salvadori, Filippo; Cabrini, Stefano

    2016-01-01

    Nanoimprint lithography (NIL) of functional high-refractive index materials has proved to be a powerful candidate for the inexpensive manufacturing of high-resolution photonic devices. In this paper, we demonstrate the fabrication of printable photonic crystals (PhCs) with high refractive index working in the visible wavelengths. The PhCs are replicated on a titanium dioxide-based high-refractive index hybrid material by reverse NIL with almost zero shrinkage and high-fidelity reproducibility between mold and printed devices. The optical responses of the imprinted PhCs compare very well with those fabricated by conventional nanofabrication methods. This study opens the road for a low-cost manufacturing of PhCs and other nanophotonic devices for applications in visible light. (paper)

  9. Pathologic findings and liver elements in hibernating bats with white-nose syndrome.

    Science.gov (United States)

    Courtin, F; Stone, W B; Risatti, G; Gilbert, K; Van Kruiningen, H J

    2010-03-01

    Two groups of vespertilionid bats were collected from affected hibernacula. In group 1 (n, 14; pathology and microbiology), the average body weights of all species were at the lower limit of published ranges. Twelve bats (86%) had mycotic growth in the epidermis, hair follicles, and sebaceous glands. Geomyces destructans, with its characteristic curved conidia, was observed microscopically, cultured, and confirmed by polymerase chain reaction. Dermatitis and mural folliculitis was nil to mild. When focally coinfected with Gram-negative bacteria, there was necrosis and pustules. Fat stores were little to abundant in 12 bats (86%) and nil in 2. Thirteen bats (93%) had pulmonary congestion and 7 (50%) had bone marrow granulocytosis. In group 2 (n, 24; liver elements), 3 bats (13%) had potentially toxic lead levels and 1 (4%), potentially toxic arsenic level. There was no evidence of major organ failure or consistent element toxicity.

  10. Generation of metallic arc spectrum of pumping discharge of XeCl laser; XeCl ekishima laser reiki hoden ni okeru arc iko to kinzoku supekutoru no hassei

    Energy Technology Data Exchange (ETDEWEB)

    Koike, H.; Yukimura, K. [Doshisha University, Kyoto (Japan)

    1997-12-20

    An arc generation of a long-pulse spiker-sustainer excimer laser with about 250ns of pulse width , is discussed by using time-varying spectroscopic method. First arcing occurs during a main discharge for laser excitation and shows XeII spectrum, while a glow-like discharge represents only XeI spectrum, the metallic spectrum such as Nil caused by vaporization of electrode material begins to appear just after the termination of the main discharge. Second arcing occurs after about 2{mu}s, which brings strong intensity of Nil spectrum. It means that the reignition arc might be produced in a metallic vapor that appears during the main discharge. Accordingly, it is concluded that the reignition arc is inherently metallic, which is different from the main arc with rare gas plasma. 9 refs., 9 figs.

  11. Fabrication of nano-sized metal patterns on flexible polyethylene-terephthalate substrate using bi-layer nanoimprint lithography

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Seon Yong; Jung, Ho Yong [Department of Materials Science and Engineering, Korea University, Seoul, 136-701 (Korea, Republic of); Jeong, Jun-Ho [Nano-Mechanical Systems Research Center, Korea Institute of Machinery and Materials, Yuseong-gu Daejeon, 305-343 (Korea, Republic of); Lee, Heon, E-mail: heonlee@korea.ac.k [Department of Materials Science and Engineering, Korea University, Seoul, 136-701 (Korea, Republic of)

    2009-05-29

    Polymer films are widely used as a substrate for displays and for solar cells since they are cheap, transparent and flexible, and their material properties are easy to design. Polyethylene-terephthalate (PET) is especially useful for various applications requiring transparency, flexibility and good thermal and chemical resistance. In this study, nano-sized metal patterns were fabricated on flexible PET film by using nanoimprint lithography (NIL). Water-soluble poly-vinyl alcohol (PVA) resin was used as a planarization and sacrificial layer for the lift-off process, as it does not damage the PET films and can easily be etched off by using oxygen plasma. NIL was used to fabricate the nano-sized patterns on the non-planar or flexible substrate. Finally, a nano-sized metal pattern was successfully formed by depositing the metal layer over the imprinted resist patterns and applying the lift-off process, which is economic and environmentally friendly, to the PET films.

  12. Integrating anti-reflection and superhydrophobicity of moth-eye-like surface morphology on a large-area flexible substrate

    International Nuclear Information System (INIS)

    Liu, Chia-Hsing; Niu, Pei-Lun; Sung, Cheng-Kuo

    2014-01-01

    This paper proposes an ultraviolet nanoimprint lithography (UV-NIL) roll-to-roll (R2R) process with argon and oxygen (Ar–O 2 ) plasma ashing and coating of a dilute perfluorodecyltrichlorosilane (FDTS) layer to fabricate the large-area moth-eye-like surface morphology on a polyethylene terephthalate substrate. By using Maxwell-Garnett's effective medium theory, the optimal dimensions of the moth-eye-like surface morphology was designed and fabricated with UV-NIL R2R process to obtain maximum transmittance ratio. In addition, the base angle (θ = 30.1°) of the moth-eye-like surface morphology was modified with Ar–O 2 plasma ashing and coated with a dilute FDTS layer to possess both superhydrophobic and air-retention properties. This increases both the transmittance ratio of 4% and contact angle to 153°. (paper)

  13. OCA-P, a deterministic and probabilistic fracture-mechanics code for application to pressure vessels

    International Nuclear Information System (INIS)

    Cheverton, R.D.; Ball, D.G.

    1984-05-01

    The OCA-P code is a probabilistic fracture-mechanics code that was prepared specifically for evaluating the integrity of pressurized-water reactor vessels when subjected to overcooling-accident loading conditions. The code has two-dimensional- and some three-dimensional-flaw capability; it is based on linear-elastic fracture mechanics; and it can treat cladding as a discrete region. Both deterministic and probabilistic analyses can be performed. For the former analysis, it is possible to conduct a search for critical values of the fluence and the nil-ductility reference temperature corresponding to incipient initiation of the initial flaw. The probabilistic portion of OCA-P is based on Monte Carlo techniques, and simulated parameters include fluence, flaw depth, fracture toughness, nil-ductility reference temperature, and concentrations of copper, nickel, and phosphorous. Plotting capabilities include the construction of critical-crack-depth diagrams (deterministic analysis) and various histograms (probabilistic analysis)

  14. Nanoimprinted backside reflectors for a-Si:H thin-film solar cells: critical role of absorber front textures.

    Science.gov (United States)

    Tsao, Yao-Chung; Fisker, Christian; Pedersen, Thomas Garm

    2014-05-05

    The development of optimal backside reflectors (BSRs) is crucial for future low cost and high efficiency silicon (Si) thin-film solar cells. In this work, nanostructured polymer substrates with aluminum coatings intended as BSRs were produced by positive and negative nanoimprint lithography (NIL) techniques, and hydrogenated amorphous silicon (a-Si:H) was deposited hereon as absorbing layers. The relationship between optical properties and geometry of front textures was studied by combining experimental reflectance spectra and theoretical simulations. It was found that a significant height variation on front textures plays a critical role for light-trapping enhancement in solar cell applications. As a part of sample preparation, a transfer NIL process was developed to overcome the problem of low heat deflection temperature of polymer substrates during solar cell fabrication.

  15. Efficient methods of nanoimprint stamp cleaning based on imprint self-cleaning effect

    Energy Technology Data Exchange (ETDEWEB)

    Meng Fantao; Chu Jinkui [Key Laboratory for Micro/Nano Technology and System of Liaoning Province, Dalian University of Technology, 116024 Dalian (China); Luo Gang; Zhou Ye; Carlberg, Patrick; Heidari, Babak [Obducat AB, SE-20125 Malmoe (Sweden); Maximov, Ivan; Montelius, Lars; Xu, H Q [Division of Solid State Physics, Lund University, Box 118, S-22100 Lund (Sweden); Nilsson, Lars, E-mail: ivan.maximov@ftf.lth.se [Department of Food Technology, Engineering and Nutrition, Lund University, Box 117, S-22100 Lund (Sweden)

    2011-05-06

    Nanoimprint lithography (NIL) is a nonconventional lithographic technique that promises low-cost, high-throughput patterning of structures with sub-10 nm resolution. Contamination of nanoimprint stamps is one of the key obstacles to industrialize the NIL technology. Here, we report two efficient approaches for removal of typical contamination of particles and residual resist from stamps: thermal and ultraviolet (UV) imprinting cleaning-both based on the self-cleaning effect of imprinting process. The contaminated stamps were imprinted onto polymer substrates and after demolding, they were treated with an organic solvent. The images of the stamp before and after the cleaning processes show that the two cleaning approaches can effectively remove contamination from stamps without destroying the stamp structures. The contact angles of the stamp before and after the cleaning processes indicate that the cleaning methods do not significantly degrade the anti-sticking layer. The cleaning processes reported in this work could also be used for substrate cleaning.

  16. Planar self-aligned imprint lithography for coplanar plasmonic nanostructures fabrication

    KAUST Repository

    Wan, Weiwei

    2014-03-01

    Nanoimprint lithography (NIL) is a cost-efficient nanopatterning technology because of its promising advantages of high throughput and high resolution. However, accurate multilevel overlay capability of NIL required for integrated circuit manufacturing remains a challenge due to the high cost of achieving mechanical alignment precision. Although self-aligned imprint lithography was developed to avoid the need of alignment for the vertical layered structures, it has limited usage in the manufacture of the coplanar structures, such as integrated plasmonic devices. In this paper, we develop a new process of planar self-alignment imprint lithography (P-SAIL) to fabricate the metallic and dielectric structures on the same plane. P-SAIL transfers the multilevel imprint processes to a single-imprint process which offers higher efficiency and less cost than existing manufacturing methods. Such concept is demonstrated in an example of fabricating planar plasmonic structures consisting of different materials. © 2014 Springer-Verlag Berlin Heidelberg.

  17. DWDM DFB LD fabricated by nanoimprint process

    Science.gov (United States)

    Liu, Wen; Wang, Lei; Zhou, Ning; Zhang, Yiwen; Qiu, Fei; Xu, Zhimou

    2011-02-01

    DFB LDs are key components in DWDM optical network. Now they are very expensive because the feedback grating period has to be controlled with very high accuracy and EBL is currently the most popular solution. We propose a high throughput, low cost NIL process based on a large stamp fabricated by SFIL and soft stamp pattern transfer method. DFB chips on 30mm*30mm area were manufactured with both good uniformity and performance. 13 ITU channels from 1540nm to 1560nm of 200GHz space are made. Our results show NIL has high potential to become another popular technology for DFB LD production, this cost effective and high efficiency manufacture solution may yield a significant impact to the future optical communication industry development.

  18. Dried duckweed and commercial feed promote adequate growth performance of tilapia fi ngerlings

    OpenAIRE

    Tavares, Flávia de A.; Rodrigues, João Bosco R.; Fracalossi, Débora Machado; Esquivel, Juan; Roubach, Rodrigo

    2008-01-01

    http://dx.doi.org/10.5007/2175-7925.2008v21n3p91Desempenho de alevinos de tilapia nilótica alimentados com uma  combinação de lemnas secas e ração comercial. O presente estudo  avaliou a utilização de ração comercial e lemna seca no cultivo de  alevinos de tilápias nilóticas com o objetivo de reduzir os custos de produção. Três dietas representadas por lemna seca, ração comercial  (40% proteína bruta) e uma combinação de lemna seca e ração  comercial foram fornecidas a um grupo de 20 alevinos...

  19. Status of Standardization Projects

    Science.gov (United States)

    1994-09-01

    942 953 953 A VDI N 4820 0657 NIL V 25513F USAF VALVE CHECK FOR 300 71 D2 943 963 944 G AS 99 U 4820 0658 NIL-V-9439 VALVES OXYGEN CYLINDER HIGH 71 02...944 951 951 A AR AS 99 IS N D 5305 2048 N535494 SCREW WOOD FLAT HEAD SLOTTED IS F5 A 944 951 951 A AR AS 99 IS N D 5305 2049 NS35495 SCREW WOOD ROUND...951 A AS U D 5340 2047 MIL-C-85052Z6 CLAMP INSERT 275F AS F4 913 924 951 A AV AS 99 U D 5340 2048 MIL-C-85052/7 CLAMP INSERT LOOP 500F AS F4 913 924

  20. Carsten Niebuhr and James Bruce

    DEFF Research Database (Denmark)

    Friis, Ib

    2013-01-01

    In 1791 Carsten Niebuhr published a review of the first two volumes of Bruce’s Reisen zur Entdeckung der Quellen des Nils (1790). Niebuhr’s strongest criticism of Bruce was that he seemed to have plagiarized some of Niebuhr’s astronomical observations (“adopted them without examination”) and that......In 1791 Carsten Niebuhr published a review of the first two volumes of Bruce’s Reisen zur Entdeckung der Quellen des Nils (1790). Niebuhr’s strongest criticism of Bruce was that he seemed to have plagiarized some of Niebuhr’s astronomical observations (“adopted them without examination...... as written by Bruce in 1770 at Gondar, Abyssinia, contains information about latitudes identical with some of Niebuhr’s observations which were unpublished in 1770; possible explanations for this are proposed. In summary, it seems that Niebuhr is right; it is almost certain that Bruce plagiarized some...

  1. Mueller matrix ellipsometric detection of profile asymmetry in nanoimprinted grating structures

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiuguo; Ma, Zhichao; Xu, Zhimou [Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); Zhang, Chuanwei; Jiang, Hao [State Key Laboratory of Digital Manufacturing Equipment and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); Liu, Shiyuan, E-mail: shyliu@mail.hust.edu.cn [Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); State Key Laboratory of Digital Manufacturing Equipment and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2014-11-21

    Mueller matrix ellipsometry (MME) is applied to detect foot-like asymmetry encountered in nanoimprint lithography (NIL) processes. We present both theoretical and experimental results which show that MME has good sensitivity to both the magnitude and direction of asymmetric profiles. The physics behind the use of MME for asymmetry detection is the breaking of electromagnetic reciprocity theorem for the zeroth-order diffraction of asymmetric gratings. We demonstrate that accurate characterization of asymmetric nanoimprinted gratings can be achieved by performing MME measurements in a conical mounting with the plane of incidence parallel to grating lines and meanwhile incorporating depolarization effects into the optical model. The comparison of MME-extracted asymmetric profile with the measurement by cross-sectional scanning electron microscopy also reveals the strong potential of this technique for in-line monitoring NIL processes, where symmetric structures are desired.

  2. etat des connaissances sur la pisciculture en cote d'ivoire

    African Journals Online (AJOL)

    régions du pays et le choix du Tilapia du Nil. (Oreochromis niloticus) comme principale espèce d'élevage. Il s'en est ... conséquemment freiné les investissements prévus pour la modernisation du sous-secteur d'élevage. ... financement, les systèmes de production pratiqués, la taille des exploitations, la qualité de l'eau, les ...

  3. AcEST: DK949288 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e dehydrogenase (Fragment) OS=Arab... 50 7e-05 tr|Q84JM5|Q84JM5_IPONI Angustifolia OS=Ipomoea nil GN=IAN PE=... 0.015 tr|B6U1W6|B6U1W6_MAIZE Angustifolia OS=Zea mays PE=2 SV=1 42 0.015 tr|A3C6

  4. AcEST: BP916224 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 70 5e-11 tr|A3C6S4|A3C6S4_ORYSJ Putative uncharacterized protein OS=Oryza... 70 5e-11 tr|B6U1W6|B6U1W6_MAIZE Angus...ent) OS=Arab... 65 2e-09 tr|Q84JM5|Q84JM5_IPONI Angustifolia OS=Ipomoea nil GN=IA

  5. The Battle for Leyte Gulf, October 1944. Strategical and Tactical Analysis. Volume I. Preliminary Operations until 0719 October 17th, 1944 Including Battle off Formosa

    Science.gov (United States)

    1953-01-01

    Cdl.CAR.DTV FOUR stated in interrogation that the piloto ifor the ISE and HYU `,A were more or less completely trained, but those for the JIJNYYO and RYUIIO...only nb(,ut one-third the •ize of the group which had attncked the previous nil,h’., and was composed of thono "T" Forcu planet remaining in hyu ±,hu, it

  6. Delineating a Retesting Zone Using Receiver Operating Characteristic Analysis on Serial QuantiFERON Tuberculosis Test Results in US Healthcare Workers

    Directory of Open Access Journals (Sweden)

    Wendy Thanassi

    2012-01-01

    Full Text Available Objective. To find a statistically significant separation point for the QuantiFERON Gold In-Tube (QFT interferon gamma release assay that could define an optimal “retesting zone” for use in serially tested low-risk populations who have test “reversions” from initially positive to subsequently negative results. Method. Using receiver operating characteristic analysis (ROC to analyze retrospective data collected from 3 major hospitals, we searched for predictors of reversion until statistically significant separation points were revealed. A confirmatory regression analysis was performed on an additional sample. Results. In 575 initially positive US healthcare workers (HCWs, 300 (52.2% had reversions, while 275 (47.8% had two sequential positive tests. The most statistically significant (Kappa = 0.48, chi-square = 131.0, P<0.001 separation point identified by the ROC for predicting reversion was the tuberculosis antigen minus-nil (TBag-nil value at 1.11 International Units per milliliter (IU/mL. The second separation point was found at TBag-nil at 0.72 IU/mL (Kappa = 0.16, chi-square = 8.2, P<0.01. The model was validated by the regression analysis of 287 HCWs. Conclusion. Reversion likelihood increases as the TBag-nil approaches the manufacturer's cut-point of 0.35 IU/mL. The most statistically significant separation point between those who test repeatedly positive and those who revert is 1.11 IU/mL. Clinicians should retest low-risk individuals with initial QFT results < 1.11 IU/mL.

  7. Validation of a 1DL earliness per se (eps) flowering QTL in bread wheat (Triticum aestivum).

    Science.gov (United States)

    Zikhali, Meluleki; Leverington-Waite, Michelle; Fish, Lesley; Simmonds, James; Orford, Simon; Wingen, Luzie U; Goram, Richard; Gosman, Nick; Bentley, Alison; Griffiths, Simon

    2014-01-01

    Vernalization, photoperiod and the relatively poorly defined earliness per se ( eps ) genes regulate flowering in plants. We report here the validation of a major eps quantitative trait locus (QTL) located on wheat 1DL using near isogenic lines (NILs). We used four independent pairs of NILs derived from a cross between Spark and Rialto winter wheat varieties, grown in both the field and controlled environments. NILs carrying the Spark allele, defined by QTL flanking markers Xgdm111 and Xbarc62 , consistently flowered 3-5 days earlier when fully vernalized relative to those with the Rialto. The effect was independent of photoperiod under field conditions, short days (10-h light), long days (16-h light) and very long days (20-h light). These results validate our original QTL identified using doubled haploid (DH) populations. This QTL represents variation maintained in elite north-western European winter wheat germplasm. The two DH lines used to develop the NILs, SR9 and SR23 enabled us to define the location of the 1DL QTL downstream of marker Xgdm111 . SR9 has the Spark 1DL arm while SR23 has a recombinant 1DL arm with the Spark allele from Xgdm111 to the distal end. Our work suggests that marker assisted selection of eps effects is feasible and useful even before the genes are cloned. This means eps genes can be defined and positionally cloned in the same way as the photoperiod and vernalization genes have been. This validation study is a first step towards fine mapping and eventually cloning the gene directly in hexaploid wheat.

  8. Estonia ballett üle seitsme aasta taas Pärnus / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2010-01-01

    Rahvusooperi Estonia balleti kunstiline juht Toomas Edur Estonia balletitrupist ja 20. veebruaril toimuvast kolmest lühiballetist koosnevast balletiõhtust Pärnu kontserdimajas. Esitatakse Bohuslav Martinu "Enne öö saabumist" (koreograaf Nils Christe), Arnold Schönbergi "Pelléas ja Mélisande" (koreograaf Tiit Härm), Robert Schumanni "Teine sümfoonia" (koreograaf Uwe Scholz)

  9. Victory celebrations mark 1945 peace

    Index Scriptorium Estoniae

    2011-01-01

    Riia vennaskalmistul 8. mail peetud Teises maailmasõjas langenute mälestamistseremooniast võtsid osa ka Läti president Valdis Zatlers, spiiker Solvita Aboltina, kaitseminister Artis Pabriks, riiklike relvajõudude juhataja Raimond Graube ja Riia linnapea Nils Usakovs. 30 000 inimest tähistas Riias 9. mai võidupüha, kohal olid ka Euroopa Parlamendi saadikud Tatjana Zdanoka, Alfreds Rubiks ja Vladimirs Buzajevs

  10. Regulation of intestinal immune response by selective removal of the anterior, posterior, or entire pituitary gland in Trichinella spiralis infected golden hamsters.

    Science.gov (United States)

    Hernández-Cervantes, Rosalía; Quintanar-Stephano, Andrés; Moreno-Méndoza, Norma; López-Griego, Lorena; López-Salazar, Valeria; Hernández-Bello, Romel; Carrero, Julio César; Morales-Montor, Jorge

    2013-01-01

    The influence of anterior pituitary hormones on the gastrointestinal tract of humans and animals has been previously reported. Hypophysectomy (HYPOX) in the rat causes atrophy of the intestinal mucosa, and reduction of gastric secretion and intestinal absorption, as well as increased susceptibility to bacterial and viral infections. However, to our knowledge, no findings have been published concerning the immune response following HYPOX during worm infection, particularly that which is caused by the nematode Trichinella spiralis. The aim of this work was to analyze the effects of total or partial HYPOX on colonization of T. spiralis in the intestinal lumen, together with duodenal and splenic cytokine expression. Our results indicate that 5 days post infection, only neurointermediate pituitary lobectomy (NIL) reduces the number of intestinally recovered T. spiralis larvae. Using semiquantitative inmunofluorescent laser confocal microscopy, we observed that the mean intensity of all tested Th1 cytokines was markedly diminished, even in the duodenum of infected controls. In contrast, a high level of expression of these cytokines was noted in the NIL infected hamsters. Likewise, a significant decrease in the fluorescence intensity of Th2 cytokines (with the exception of IL-4) was apparent in the duodenum of control and sham infected hamsters, compared to animals with NIL surgeries, which showed an increase in the expression of IL-5 and IL-13. Histology of duodenal mucosa from NIL hamsters showed an exacerbated inflammatory infiltrate located along the lamina propria, which was related to the presence of the parasite. We conclude that hormones from each pituitary lobe affect the gastrointestinal immune responses to T. spiralis through various mechanisms.

  11. Efferent projections of the ectostriatum in the pigeon (Columba livia)

    Science.gov (United States)

    Husband, S. A.; Shimizu, T.

    1999-01-01

    The ectostriatum is a major visual component of the avian telencephalon. The core region of the ectostriatum (Ec) receives visual input from the optic tectum through thalamic nuclei. In the present study, the efferent projections of the ectostriatum were investigated by using the anterograde tracers Phaseolus vulgaris leucoagglutinin and biotinylated dextran amine. Projection patterns resulting from these tracers were confirmed by the retrograde tracer cholera toxin subunit B. When anterograde tracers were injected in Ec, primary projections were seen traveling dorsolaterally to the belt region of the ectostriatum (Ep) and the neostriatal area immediately surrounding Ep (Ep2). Neurons in Ep sent projections primarily to the overlying Ep2. The efferents of Ep2 traveled dorsolaterally to terminate in three telencephalic regions, from anterior to posterior: (1) neostriatum frontale, pars lateralis (NFL), (2) area temporo-parieto-occipitalis (TPO), and (3) neostriatum intermedium, pars lateralis (NIL). A part of the archistriatum intermedium and the lateral part of the neostriatum caudale also received somewhat minor projections. In addition, some neurons in Ec were also the source of direct, but minor, projections to the NFL, TPO, NIL, and archistriatum intermedium. The topographical relationship among the primary (Ec), secondary (Ep and Ep2), and tertiary (NFL, TPO, NIL) areas indicate that the neural populations for visual processing are organized along the rostral-caudal axis. Thus, the anterior Ec sent efferents to the anterior Ep, which in turn sent projections to anterior Ep2. Neurons in the anterior Ep2 sent projections to NFL and the anterior TPO. Similarly, the intermediate and posterior Ec sent projections to corresponding parts of Ep, whose efferents projected to intermediate and posterior Ep2, respectively. The intermediate Ep2 gave rise to major projections to TPO, whereas posterior Ep2 neurons sent efferents primarily to NIL. The organization of this

  12. Renforcement de la résilience face aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    étudier le rôle de l'aquaculture dans un climat variable et changeant et d'élaborer des stratégies d'adaptation au niveau de l'exploitation et du bassin de la rivière. Dans le nord de la Thaïlande, le tilapia rouge et le tilapia du Nil ...

  13. Constitutive water-conserving mechanisms are correlated with the terminal drought tolerance of pearl millet [Pennisetum glaucum (L.) R. Br.].

    Science.gov (United States)

    Kholová, Jana; Hash, C Tom; Kakkera, Aparna; Kocová, Marie; Vadez, Vincent

    2010-01-01

    Pearl millet, a key staple crop of the semi-arid tropics, is mostly grown in water-limited conditions, and improving its performance depends on how genotypes manage limited water resources. This study investigates whether the control of water loss under non-limiting water conditions is involved in the terminal drought tolerance of pearl millet. Two pairs of tolerant x sensitive pearl millet genotypes, PRLT 2/89-33-H77/833-2 and 863B-P2-ICMB 841-P3, and near-isogenic lines (NILs), introgressed with a terminal drought tolerance quantitative trait locus (QTL) from the donor parent PRLT 2/89-33 into H77/833-2 (NILs-QTL), were tested. Upon exposure to water deficit, transpiration began to decline at lower fractions of transpirable soil water (FTSW) in tolerant than in sensitive genotypes, and NILs-QTL followed the pattern of the tolerant parents. The transpiration rate (Tr, in g water loss cm(-2) d(-1)) under well-watered conditions was lower in tolerant than in sensitive parental genotypes, and the Tr of NILs-QTL followed the pattern of the tolerant parents. In addition, Tr measured in detached leaves (g water loss cm(-2) h(-1)) from field-grown plants of the parental lines showed lower Tr values in tolerant parents. Defoliation led to an increase in Tr that was higher in sensitive than in tolerant genotypes. The differences in Tr between genotypes was not related to the stomatal density. These results demonstrate that constitutive traits controlling leaf water loss under well-watered conditions correlate with the terminal drought tolerance of pearl millet. Such traits may lead to more water being available for grain filling under terminal drought.

  14. What are the memory sources of dreaming?

    Science.gov (United States)

    Nielsen, Tore A; Stenstrom, Philippe

    2005-10-27

    Investigators since Freud have appreciated that memories of the people, places, activities and emotions of daily life are reflected in dreams but are typically so fragmented that their predictability is nil. The mechanisms that translate such memories into dream images remain largely unknown. New research targeting relationships between dreaming, memory and the hippocampus is producing a new theory to explain how, why and when we dream of waking life events.

  15. MIZEX. A Program for Mesoscale Air-Ice-Ocean Interaction Experiments in Arctic Marginal Ice Zones. I. Research Strategy.

    Science.gov (United States)

    1981-06-01

    I0’ writing -up of results, and synthesis of the Bering km in surface area; the Bering Sea area is on the MIZ results with incoming results from the...application to rapid Ielting . Rev. Iho trne.ali Sea sdui ri Al ).f X, N. pi I 1975 Api I 19761 li la yer lj t ’ii.,i r wNil liet.,ii fol r1 od,% ’ir e r. S

  16. Transformerless dc-Isolated Converter

    Science.gov (United States)

    Rippel, Wally E.

    1987-01-01

    Efficient voltage converter employs capacitive instead of transformer coupling to provide dc isolation. Offers buck/boost operation, minimal filtering, and low parts count, with possible application in photovoltaic power inverters, power supplies and battery charges. In photovoltaic inverter circuit with transformerless converter, Q2, Q3, Q4, and Q5 form line-commutated inverter. Switching losses and stresses nil because switching performed when current is zero.

  17. Exploitation of Labour and Exploitation of Commodities: a “New Interpretation”

    OpenAIRE

    Veneziani, Roberto; Yoshihara, Naoki

    2011-01-01

    In the standard Okishio-Morishima approach, the existence of profits is proved to be equivalent to the exploitation of labour. Yet, it can also be proved that the existence of profits is equivalent to the ‘exploitation’ of any good. Labour and commodity exploitation are just different numerical representations of the productiveness of the economy. This paper presents an alternative approach to exploitation theory which is related to the New Interpretation (Duménil 1980; Foley 1982). In this a...

  18. Characterization of QTL for unique agronomic traits of new-plant-type rice varieties using introgression lines of IR64

    Directory of Open Access Journals (Sweden)

    Analiza G. Tagle

    2016-02-01

    Full Text Available To enhance the yield potential of an elite indica rice cultivar, an introgression (BC3-derived line of IR64, YTH288, was developed using a new-plant-type cultivar, IR66215-44-2-3, as a donor parent. YTH288 has agronomically valuable characteristics such as large panicles, few unproductive tillers, and large leaves inherited from NPT. To identify the genetic basis of these traits, we used 167 F2 plants derived from a cross between IR64 and YTH288 to conduct QTL analysis for five agronomic traits: days to heading (DTH, culm length (CL, flag leaf length (FLL, flag leaf width (FLW, and filled spikelet number per panicle (FSN. Six putative QTL were detected: four on chromosome 4 (for CL, FLL, FLW, and FSN and two on chromosome 2 (for DTH and FLL. All QTL with the IR66215-44-2-3 allele, except that for FLL on chromosome 2, had positive effects on each trait. To confirm the effects of these putative QTL, we developed NILs with the IR64 genetic background by marker-assisted selection. We observed significant differences in several agronomic traits between IR64 and NILs that carried these QTL on chromosomes 2 and 4. Additionally, four IR64-NILs carrying chromosomal segments derived from different NPT varieties on the long arm of chromosome 4 exhibited similar pleiotropic effects for unique agronomic traits. These NILs can be used as research materials for studying each trait and as breeding materials for yield improvement of indica rice cultivars.

  19. Mälestuskilde Emilie Bertelsonist / Joosep Koppel

    Index Scriptorium Estoniae

    Koppel, Joosep

    2013-01-01

    Juhtumist 1930. aastatel, kui Kükita misjonijaamale saadeti Rootsist annetusena riideid ja jalatseid, kuid mille Tallinna Tolliamet maksustas 300-kroonise maksuga. Misjonär Emilie Bertelsoni rollist loo lahendamisel. Lisatud foto traktaat-ajakirjast Prizõv (Призыв), mida andis välja Emilie Bertelson koostöös rootsi misjonär Nils Angeliniga aastatel 1928-1935

  20. Epidemiology and Treatment of Posttraumatic Stress Disorder in West-Nile Populations of Sudan and Uganda

    OpenAIRE

    Neuner, Frank

    2003-01-01

    Bürgerkriege haben für die betroffenen Länder verheerende Auswirkungen auf soz-ialer, wirtschaftlicher, medizinischer und politischer Ebene. In einer epidemiologischen Studie, die im West-Nil Gebiet von Sudan und Uganda durchgeführt wurde, sollten die psychischen Folgen des sudanesischen Bürgerkrieges untersucht werden. Dabei wurden drei Populationen miteinander verglichen: Sudanesen, die im Sudan verblieben waren (n =664), Flüchtlinge, die aus dem Sudan nach Uganda geflohen waren (n = 1240) ...

  1. Nepenthes rafflesiana pitcher liquid has antifungal activity against Candida spp.

    Directory of Open Access Journals (Sweden)

    Hanna Yolanda

    2014-08-01

    Full Text Available Background To develop new effective antifungals, it is essential to search for antifungal compounds from plants such as Nepenthes spp., which have their greatest diversity in Indonesia. Since chitin-induced liquid (CIL from Nepenthes khasiana pitchers has antifungal activity, due to their naphthoquinone content, this study aimed to evaluate antifungal activity of Nepenthes rafflesiana pitcher liquids on Candida spp. Methods Collected pitcher liquids were of 3 types: non-induced liquid (NIL, prey-induced liquid (PIL, and chitin-induced liquid (CIL. Non-induced liquid (NIL was collected from fresh naturally opened pitchers, PIL from opened pitchers after 3 hours of induction with Zophobas morio larvae, and CIL from closed pitchers after 5 days of chitin solution injection. The antifungal activity of the liquids against C. albicans, C. glabrata, C. krusei, and C. tropicalis were detected by disc diffusion and macrodilution methods. Results Inhibition zone diameters of NIL, PIL, and CIL against C. albicans were 35.00 (35.00 – 39.33 mm, 26.33 (23.00 – 40.00 mm, and 30.00 ( 28.00 – 32.00 mm, respectively, while for C. glabrata the zone diameters were 22.22 ± 3.66 mm, 29.89 ± 2.79 mm, and 28.89 ± 1.17 mm, respectively. No inhibition zones were found for NIL, PIL, and CIL against C. krusei and C. tropicalis. At concentrations of 80%, almost all samples showed visually apparent inhibition of fungal growth. Conclusion The pitcher liquid of N. rafflesiana has antifungal properties, presumably due to the presence of many potentially active substances, such as naphthoquinones, as has been proven in other studies.

  2. Operations Monitoring Assistant System Design

    Science.gov (United States)

    1986-07-01

    Logic. Artificial Inteligence 25(1)::75-94. January.18. 41 -Nils J. Nilsson. Problem-Solving Methods In Artificli Intelligence. .klcG raw-Hill B3ook...operations monitoring assistant (OMA) system is designed that combines operations research, artificial intelligence, and human reasoning techniques and...KnowledgeCraft (from Carnegie Group), and 5.1 (from Teknowledze). These tools incorporate the best methods of applied artificial intelligence, and

  3. Modularly Integrated MEMS Technology

    Science.gov (United States)

    2006-05-23

    Letters, Vol.80, No.20, pp.3706-08, 2002. [3.9] N. R. Zangerberg, J. Fage- Pederson , J. L . Hansen, and A. N. Larsen, “Boron and Phosphorus diffusion in...on servers or to redistribute to lists, requires prior specific permission. Acknowledgement Tsu-Jae King, Roger T. Howe, Sanjay Govingjee, Nils...the GRADUATE DIVISION of the UNIVERSITY OF CALIFORNIA, BERKELEY Committee in Charge Tsu-Jae King, Chair Roger T. Howe Sanjay Govindjee

  4. Black esophagus: exploring the dark

    Directory of Open Access Journals (Sweden)

    Robert Forster

    2013-10-01

    Full Text Available Black esophagus is a rare but underdiagnosed disease. It occurs most frequently in severely ill patients and carries a high mortality rate. Cause of death is usually attributed to the comorbid conditions. Treatment is directed at the underlying cause, acid suppression and keeping the patient nil-per-os. Surgery is needed in complicated cases and stenosis is the most feared longterm sequel. In the present article, two cases are described and literature is reviewed.

  5. Treating urban sewage using constructed wetlands; Depuracion de aguas residuales urbanas mediante humedales contruidos

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, J. [ETS Camins, Canals i Ports. UPC. Barcelona (Spain); Ruiz, A. [Biologa. Barcelona. (Spain); Junqueras, X. [Biologo. Barcelona (Spain)

    1997-09-01

    Constructed wetlands are a low-cost alternative for treating sewage from small urbanized areas. The ``Can Massaguer`` children`s holiday home has a 230 m``2 subsurface flow wetland for secondary treatment of the sewage generated by 130 people. The system comprises two porous substrate beds with macrophytes (ditch reed, Phragmites australis) and entry and exit units. Its high purification performance and nil running costs make it ideal for treating wastewaters from small built-up areas. (Author)

  6. Maximal Bell's inequality violation for non-maximal entanglement

    International Nuclear Information System (INIS)

    Kobayashi, M.; Khanna, F.; Mann, A.; Revzen, M.; Santana, A.

    2004-01-01

    Bell's inequality violation (BIQV) for correlations of polarization is studied for a product state of two two-mode squeezed vacuum (TMSV) states. The violation allowed is shown to attain its maximal limit for all values of the squeezing parameter, ζ. We show via an explicit example that a state whose entanglement is not maximal allow maximal BIQV. The Wigner function of the state is non-negative and the average value of either polarization is nil

  7. West Europe Report No. 2157

    Science.gov (United States)

    1983-06-13

    Fund Proposal (Editorial, Nils-Eric Sandberg; DAGENS NYHETER, 13 Apr 83) ... 26 POLITICAL ICELAND Columnist Examines Election Setback for...reorientation of government 1. An article by Andre Bergeron in F.O.-HEBDO, 16 March 1983. 2. An article by Mercier in SYNDICALISM CFDT, 17 March 1983 (see LE...fuss is about. 9906 CSO: 3650/168 27 POLITICAL ICELAND COLUMNIST EXAMINES ELECTION SETBACK FOR PEOPLE’S ALLIANCE Reykjavik MORGUNBLADID in

  8. Biodegradable micromechanical sensors

    DEFF Research Database (Denmark)

    Keller, Stephan Sylvest; Greve, Anders; Schmid, Silvan

    of mechanical and thermal properties of polymers. For example, measurements of the resonance frequency of cantilevers were used to characterize thin polymer coatings in various environmental conditions [2]. Also, the influence of humidity on the Young’s modulus of SU-8 was evaluated [3]. However, introduction...... (NIL). Second, we used spray-coating to deposit thin biodegradable films on microcantilevers. Both approaches allowed the determination of the Young’s modulus of the biopolymer. Furthermore, biodegradation by enzymes was investigated....

  9. The Organization of Knowledge in a Multi-Lingual, Integrated Parser.

    Science.gov (United States)

    1984-11-01

    of Israeli rule. Spanish: Dos alcaldes que simpatizan con Is Organizacion para Is Liberacion de Palestina fueron mutilados duranto las explosiones...NAME ISRAEL OUR DURO Total time: 97618 asecs. NIL Translation: Explosions in 4 cities of the West Bank somed 2 Arab mayors today during s the worst... Israel . German: In Angre if*s uf don besetiten Vest soak vrden mindestons noun Pa lestineaeer einschli eastlich swel erableebe, 9vorgerselater

  10. Digital Genesis: Computers, Evolution and Artificial Life

    OpenAIRE

    Taylor, Tim; Dorin, Alan; Korb, Kevin

    2015-01-01

    The application of evolution in the digital realm, with the goal of creating artificial intelligence and artificial life, has a history as long as that of the digital computer itself. We illustrate the intertwined history of these ideas, starting with the early theoretical work of John von Neumann and the pioneering experimental work of Nils Aall Barricelli. We argue that evolutionary thinking and artificial life will continue to play an integral role in the future development of the digital ...

  11. Parallel Artificial Intelligence Search Techniques for Real Time Applications.

    Science.gov (United States)

    1987-12-01

    list) (cond ((atom e) e) ((setq a-list (match ’((> v)) e nil)) (inf-to-pre (match-value ’v a-list))) ((setq a-list (match ’((+ 1) (restrict ? oneplus ...defun oneplus (x) 2 (equal x ’) :,- ""find the value of a key into an association list. 7,. :" (defun match-value (key a-list) : : (cadr (assoc key a

  12. Genetic and biochemical analysis reveals linked QTLs determining natural variation for fruit post-harvest water loss in pepper (Capsicum).

    Science.gov (United States)

    Popovsky-Sarid, Sigal; Borovsky, Yelena; Faigenboim, Adi; Parsons, Eugene P; Lohrey, Gregory T; Alkalai-Tuvia, Sharon; Fallik, Elazar; Jenks, Matthew A; Paran, Ilan

    2017-02-01

    Molecular markers linked to QTLs controlling post-harvest fruit water loss in pepper may be utilized to accelerate breeding for improved shelf life and inhibit over-ripening before harvest. Bell pepper (Capsicum annuum L.) is an important vegetable crop world-wide. However, marketing is limited by the relatively short shelf life of the fruit due to water loss and decay that occur during prolonged storage. Towards breeding pepper with reduced fruit post-harvest water loss (PWL), we studied the genetic, physiological and biochemical basis for natural variation of PWL. We performed quantitative trait locus (QTL) mapping of fruit PWL in multiple generations of an interspecific cross of pepper, which resulted in the identification of two linked QTLs on chromosome 10 that control the trait. We further developed near-isogenic lines (NILs) for characterization of the QTL effects. Transcriptome analysis of the NILs allowed the identification of candidate genes associated with fruit PWL-associated traits such as cuticle biosynthesis, cell wall metabolism and fruit ripening. Significant differences in PWL between the NILs in the immature fruit stage, differentially expressed cuticle-associated genes and differences in the content of specific chemical constituents of the fruit cuticle, indicated a likely influence of cuticle composition on the trait. Reduced PWL in the NILs was associated with delayed over-ripening before harvest, low total soluble solids before storage, and reduced fruit softening after storage. Our study enabled a better understanding of the genetic and biological processes controlling natural variation in fruit PWL in pepper. Furthermore, the genetic materials and molecular markers developed in this study may be utilized to breed peppers with improved shelf life and inhibited over-ripening before harvest.

  13. A gene encoding an abscisic acid biosynthetic enzyme (LsNCED4) collocates with the high temperature germination locus Htg6.1 in lettuce (Lactuca sp.).

    Science.gov (United States)

    Argyris, Jason; Truco, María José; Ochoa, Oswaldo; McHale, Leah; Dahal, Peetambar; Van Deynze, Allen; Michelmore, Richard W; Bradford, Kent J

    2011-01-01

    Thermoinhibition, or failure of seeds to germinate when imbibed at warm temperatures, can be a significant problem in lettuce (Lactuca sativa L.) production. The reliability of stand establishment would be improved by increasing the ability of lettuce seeds to germinate at high temperatures. Genes encoding germination- or dormancy-related proteins were mapped in a recombinant inbred line population derived from a cross between L. sativa cv. Salinas and L. serriola accession UC96US23. This revealed several candidate genes that are located in the genomic regions containing quantitative trait loci (QTLs) associated with temperature and light requirements for germination. In particular, LsNCED4, a temperature-regulated gene in the biosynthetic pathway for abscisic acid (ABA), a germination inhibitor, mapped to the center of a previously detected QTL for high temperature germination (Htg6.1) from UC96US23. Three sets of sister BC(3)S(2) near-isogenic lines (NILs) that were homozygous for the UC96US23 allele of LsNCED4 at Htg6.1 were developed by backcrossing to cv. Salinas and marker-assisted selection followed by selfing. The maximum temperature for germination of NIL seed lots with the UC96US23 allele at LsNCED4 was increased by 2-3°C when compared with sister NIL seed lots lacking the introgression. In addition, the expression of LsNCED4 was two- to threefold lower in the former NIL lines as compared to expression in the latter. Together, these data strongly implicate LsNCED4 as the candidate gene responsible for the Htg6.1 phenotype and indicate that decreased ABA biosynthesis at high imbibition temperatures is a major factor responsible for the increased germination thermotolerance of UC96US23 seeds.

  14. First Detections of the [NII] 122 Micrometer Line at High Redshift: Demonstrating the Utility of the Line for Studying Galaxies in the Early Universe

    Science.gov (United States)

    Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Phillips, Thomas G.; Falgarone, Edith; Benford, Dominic J.; Staguhn, Johannes G.; Tucker, Carol E.

    2011-01-01

    We report the first detections of the [NIl] 122 {\\mu} m line from a high redshift galaxy. The line was strongly (> 6{\\sigma}) detected from SMMJ02399-0136, and HI413+ 117 (the Cloverleaf QSO) using the Redshift(z) and Early Universe Spectrometer (ZEUS) on the CSO. The lines from both sources are quite bright with line-to-FIR continuum luminosity ratios that are approx.7.0x10(exp -4) (Cloverleaf) and 2.1x10(exp -3) (SMMJ02399). With ratios 2-10 times larger than the average value for nearby galaxies, neither source exhibits the line-to-continuum deficits seen in nearby sources. The line strengths also indicate large ionized gas fractions, approx.8 to 17% of the molecular gas mass. The [OIII]/[NII] line ratio is very sensitive to the effective temperature of ionizing stars and the ionization parameter for emission arising in the narrow-line region (NLR) of an AGN. Using our previous detection of the [01II] 88 {\\mu}m line, the [OIII]/ [NIl] line ratio for SMMJ02399-0136 indicates the dominant source of the line emission is either stellar HII regions ionized by 09.5 stars, or the NLR of the AGN with ionization parameter 10g(U) = -3.3 to -4.0. A composite system, where 30 to 50% of the FIR lines arise in the NLR also matches the data. The Cloverleaf is best modeled by a superposition of approx.200 M82like starbursts accounting for all of the FIR emission and 43% of the [NIl] line. The remainder may come from the NLR. This work demonstrates the utility of the [NIl] and [OIII] lines in constraining properties of the ionized medium.

  15. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Blast disease caused by the pathogen Pyricularia oryzae is a serious threat to rice production. Six generations viz., P1, P2, F1, F2, B1 and B2 of a cross between blast susceptible high-yielding rice cultivar ADT 43 and resistant near isogenic line (NIL) CT13432-3R, carrying four blast resistance genes Pi1, Pi2, Pi33 and Pi54 ...

  16. Genetic analysis of a hybrid sterility gene that causes both pollen and embryo sac sterility in hybrids between Oryza sativa L. and Oryza longistaminata.

    Science.gov (United States)

    Chen, H; Zhao, Z; Liu, L; Kong, W; Lin, Y; You, S; Bai, W; Xiao, Y; Zheng, H; Jiang, L; Li, J; Zhou, J; Tao, D; Wan, J

    2017-09-01

    Oryza longistaminata originates from African wild rice and contains valuable traits conferring tolerance to biotic and abiotic stress. However, interspecific crosses between O. longistaminata and Oryza sativa cultivars are hindered by reproductive barriers. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL) using indica variety RD23 as the recipient parent and O. longistaminata as the donor parent. Both pollen and embryo sac semi-sterility were observed in F 1 hybrids between RD23 and NIL. Cytological analysis demonstrated that pollen abortion in F 1 hybrids occurred at the early bi-nucleate stage due to a failure of the first mitosis in microspores. Partial embryo sacs in the F 1 hybrids were defective during the functional megaspore formation stage. Most notably, nearly half of the male or female gametes were aborted in heterozygotes S40 i S40 l , regardless of their genotypes. Thus, S40 was indicated as a one-locus sporophytic sterility gene controlling both male and female fertility in hybrids between RD23 and O. longistaminata. A population of 16 802 plants derived from the hybrid RD23/NIL-S40 was developed to fine-map S40. Finally, the S40 locus was delimited to an 80-kb region on the short arm of chromosome 1 in terms with reference sequences of cv. 93-11. Eight open reading frames (ORFs) were localized in this region. On the basis of gene expression and genomic sequence analysis, ORF5 and ORF8 were identified as candidate genes for the S40 locus. These results are helpful in cloning the S40 gene and marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

  17. Northeast Artificial Intelligence Consortium (NAIC) Review of Technical Tasks. Volume 2, Part 2.

    Science.gov (United States)

    1987-07-01

    1979. 20. Nau, Dana S., "Expert Computer Systems", I7E7 Computer pp. 63-85, January 1983. 477...Edinburgh, -v .. 1979. 20. Nau, Dana S., "Expert Computer Systems,- IEEE Computer, pp. 63-85, January 1983. 21. Nilsson, Nils J., ___ -. Artificial...Percept... Saltzman , E.L. and Kelso, J.A.S., (1983), "Skilled Actions: A Task Dynamic Approach", Haskins Labs, SR-76, pp. 3-50. Seneff, Stephanie, (1985

  18. Regulation of intestinal immune response by selective removal of the anterior, posterior, or entire pituitary gland in Trichinella spiralis infected golden hamsters.

    Directory of Open Access Journals (Sweden)

    Rosalía Hernández-Cervantes

    Full Text Available The influence of anterior pituitary hormones on the gastrointestinal tract of humans and animals has been previously reported. Hypophysectomy (HYPOX in the rat causes atrophy of the intestinal mucosa, and reduction of gastric secretion and intestinal absorption, as well as increased susceptibility to bacterial and viral infections. However, to our knowledge, no findings have been published concerning the immune response following HYPOX during worm infection, particularly that which is caused by the nematode Trichinella spiralis. The aim of this work was to analyze the effects of total or partial HYPOX on colonization of T. spiralis in the intestinal lumen, together with duodenal and splenic cytokine expression. Our results indicate that 5 days post infection, only neurointermediate pituitary lobectomy (NIL reduces the number of intestinally recovered T. spiralis larvae. Using semiquantitative inmunofluorescent laser confocal microscopy, we observed that the mean intensity of all tested Th1 cytokines was markedly diminished, even in the duodenum of infected controls. In contrast, a high level of expression of these cytokines was noted in the NIL infected hamsters. Likewise, a significant decrease in the fluorescence intensity of Th2 cytokines (with the exception of IL-4 was apparent in the duodenum of control and sham infected hamsters, compared to animals with NIL surgeries, which showed an increase in the expression of IL-5 and IL-13. Histology of duodenal mucosa from NIL hamsters showed an exacerbated inflammatory infiltrate located along the lamina propria, which was related to the presence of the parasite. We conclude that hormones from each pituitary lobe affect the gastrointestinal immune responses to T. spiralis through various mechanisms.

  19. Transcriptome Profile of Near-Isogenic Soybean Lines for β-Conglycinin α-Subunit Deficiency during Seed Maturation.

    Science.gov (United States)

    Song, Bo; An, Lixin; Han, Yanjing; Gao, Hongxiu; Ren, Hongbo; Zhao, Xue; Wei, Xiaoshuang; Krishnan, Hari B; Liu, Shanshan

    2016-01-01

    Crossing, backcrossing, and molecular marker-assisted background selection produced a soybean (Glycine max) near-isogenic line (cgy-2-NIL) containing the cgy-2 allele, which is responsible for the absence of the allergenic α-subunit of β-conglycinin. To identify α-null-related transcriptional changes, the gene expressions of cgy-2-NIL and its recurrent parent DN47 were compared using Illumina high-throughput RNA-sequencing of samples at 25, 35, 50, and 55 days after flowering (DAF). Seeds at 18 DAF served as the control. Comparison of the transcript profiles identified 3,543 differentially expressed genes (DEGs) between the two genotypes, with 2,193 genes downregulated and 1,350 genes upregulated. The largest numbers of DEGs were identified at 55 DAF. The DEGs identified at 25 DAF represented a unique pattern of GO category distributions. KEGG pathway analyses identified 541 altered metabolic pathways in cgy-2-NIL. At 18DAF, 12 DEGs were involved in arginine and proline metabolism. The cgy-2 allele in the homozygous form modified the expression of several Cupin allergen genes. The cgy-2 allele is an alteration of a functional allele that is closely related to soybean protein amino acid quality, and is useful for hypoallergenic soybean breeding programs that aim to improve seed protein quality.

  20. Interfacial pattern changes of imprinted multilayered material in milli- and microscales

    Science.gov (United States)

    Yonekura, Kazuhiro; Tokumaru, Kazuki; Tsumori, Fujio

    2018-06-01

    Nanoimprint lithography (NIL) is a technique that transfers a mold pattern of nanometer order to the surface of a resist material by heating and pressing. NIL is an excellent technology in terms of high productivity, accuracy, and resolution. Recently, NIL has been applied to the processing of different multilayered materials, in which it is possible to process multiple materials simultaneously. In this processing of multilayered materials, it is possible to form an interfacial pattern between the upper layer and the lower layer simultaneously with patterning on the mold surface. This interface pattern can be controlled by the deformation characteristics, initial thickness, and so forth. In this research, we compared the interfacial pattern changes of imprinted multilayered materials in milli- and microscales. For multilayered imprint using multiple materials, it is important to know the flow of the resist and its dependence on the scale. If there is similarity in the relationship produced by the scale on the imprinted samples, a process design with a number of feedbacks could be realized. It also becomes easier to treat structures in the millimeter scale for the experiment. In this study, we employed micropowder imprint (µPI) for multilayered material imprint. A compound sheet of alumina powder and polymer binder was used for imprint. Two similar experiments in different scales, micro- and millimeter scales, were carried out. Results indicate that the interfacial patterns of micro- and millimeter-scale-imprinted samples are similar.

  1. Iterated Local Search Algorithm with Strategic Oscillation for School Bus Routing Problem with Bus Stop Selection

    Directory of Open Access Journals (Sweden)

    Mohammad Saied Fallah Niasar

    2017-02-01

    Full Text Available he school bus routing problem (SBRP represents a variant of the well-known vehicle routing problem. The main goal of this study is to pick up students allocated to some bus stops and generate routes, including the selected stops, in order to carry students to school. In this paper, we have proposed a simple but effective metaheuristic approach that employs two features: first, it utilizes large neighborhood structures for a deeper exploration of the search space; second, the proposed heuristic executes an efficient transition between the feasible and infeasible portions of the search space. Exploration of the infeasible area is controlled by a dynamic penalty function to convert the unfeasible solution into a feasible one. Two metaheuristics, called N-ILS (a variant of the Nearest Neighbourhood with Iterated Local Search algorithm and I-ILS (a variant of Insertion with Iterated Local Search algorithm are proposed to solve SBRP. Our experimental procedure is based on the two data sets. The results show that N-ILS is able to obtain better solutions in shorter computing times. Additionally, N-ILS appears to be very competitive in comparison with the best existing metaheuristics suggested for SBRP

  2. CACTA-superfamily transposable element is inserted in MYB transcription factor gene of soybean line producing variegated seeds.

    Science.gov (United States)

    Yan, Fan; Di, Shaokang; Takahashi, Ryoji

    2015-08-01

    The R gene of soybean, presumably encoding a MYB transcription factor, controls seed coat color. The gene consists of multiple alleles, R (black), r-m (black spots and (or) concentric streaks on brown seed), and r (brown seed). This study was conducted to determine the structure of the MYB transcription factor gene in a near-isogenic line (NIL) having r-m allele. PCR amplification of a fragment of the candidate gene Glyma.09G235100 generated a fragment of about 1 kb in the soybean cultivar Clark, whereas a fragment of about 14 kb in addition to fragments of 1 and 1.4 kb were produced in L72-2040, a Clark 63 NIL with the r-m allele. Clark 63 is a NIL of Clark with the rxp and Rps1 alleles. A DNA fragment of 13 060 bp was inserted in the intron of Glyma.09G235100 in L72-2040. The fragment had the CACTA motif at both ends, imperfect terminal inverted repeats (TIR), inverse repetition of short sequence motifs close to the 5' and 3' ends, and a duplication of three nucleotides at the site of integration, indicating that it belongs to a CACTA-superfamily transposable element. We designated the element as Tgm11. Overall nucleotide sequence, motifs of TIR, and subterminal repeats were similar to those of Tgm1 and Tgs1, suggesting that these elements comprise a family.

  3. An experimental and theoretical study on the interaction of DNA and BSA with novel Ni2 +, Cu2 + and VO2 + complexes derived from vanillin bidentate Schiff base ligand

    Science.gov (United States)

    Dostani, Morteza; Kianfar, Ali Hossein; Mahmood, Wan Ahmad Kamil; Dinari, Mohammad; Farrokhpour, Hossein; Sabzalian, Mohammad R.; Abyar, Fatemeh; Azarian, Mohammad Hossein

    2017-06-01

    In this investigation, the structure of bidentate N,N-Schiff base ligand of vanillin, (E)-4-(((2-amino-5-nitrophenyl)imino)methyl)-2-methoxyphenol (HL) was determined by single crystal X-ray diffraction. The interaction of new [CuL2], [NiL2] and [VOL2] complexes with DNA and BSA was explored through UV-Vis and fluorescence spectroscopy. The electronic spectra changes displayed an isosbestic point for the complexes upon titration with DNA. The Kb values for the complexes [CuL2], [NiL2] and [VOL2] were 2.4 × 105, 1.9 × 105 and 4.2 × 104, respectively. [CuL2] complex was bound more toughly than [NiL2] and [VOL2] complexes. These complexes had a significant interaction with Bovine Serum Albumin (BSA) and the results demonstrated that the quenching mechanism was a static procedure. Also, the complexes interacted with BSA by more than one binding site (n > 1). Finally, the theoretical studies were performed using the docking method to calculate the binding constants and recognize the binding site of the DNA and BSA with the complexes. The ligand and complexes including Ni2 +, Cu2 + and VO2 + ions were colonized by fungal growth.

  4. Lack of fitness costs and inheritance of resistance to Bacillus thuringiensis Cry1Ac toxin in a near-isogenic strain of Plutella xylostella (Lepidoptera: Plutellidae).

    Science.gov (United States)

    Zhu, Xun; Yang, Yanjv; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Guo, Zhaojiang; Kang, Shi; Xia, Jixing; Zhang, Youjun

    2016-02-01

    Resistance to Bacillus thuringiensis (Bt) formulations in insects may be associated with fitness costs. A lack of costs enables resistance alleles to persist, which may contribute to the rapid development and spread of resistance in populations. To assess the fitness costs associated with Bt Cry1Ac resistance in Plutella xylostella, life tables were constructed for a near-isogenic resistant strain (NIL-R) and a susceptible strain in this study. No fitness costs associated with Cry1Ac resistance in NIL-R were detected, based on the duration of egg and larval stages, the survival of eggs and larvae, adult longevity, fecundity, net reproductive rate, gross reproduction rate, finite rate of increase and mean generation time. Based on log dose-probit lines, resistance in NIL-R is incompletely recessive and results from a single, autosomal, recessive locus; the degree of dominance was estimated to be -0.74 and -0.71 for F1 (resistant ♀ × susceptible ♂) and F1 ' (susceptible ♀ × resistant ♂) progeny respectively. Assessment of near-isogenic Cry1Ac-resistant and Cry1Ac-susceptible strains of P. xylostella indicated that resistance is not accompanied with fitness costs, and that resistance is incompletely recessive. These findings should be useful in managing the development of Bt Cry1Ac resistance. © 2015 Society of Chemical Industry.

  5. Increased pericarp cell length underlies a major quantitative trait locus for grain weight in hexaploid wheat.

    Science.gov (United States)

    Brinton, Jemima; Simmonds, James; Minter, Francesca; Leverington-Waite, Michelle; Snape, John; Uauy, Cristobal

    2017-08-01

    Crop yields must increase to address food insecurity. Grain weight, determined by grain length and width, is an important yield component, but our understanding of the underlying genes and mechanisms is limited. We used genetic mapping and near isogenic lines (NILs) to identify, validate and fine-map a major quantitative trait locus (QTL) on wheat chromosome 5A associated with grain weight. Detailed phenotypic characterisation of developing and mature grains from the NILs was performed. We identified a stable and robust QTL associated with a 6.9% increase in grain weight. The positive interval leads to 4.0% longer grains, with differences first visible 12 d after fertilization. This grain length effect was fine-mapped to a 4.3 cM interval. The locus also has a pleiotropic effect on grain width (1.5%) during late grain development that determines the relative magnitude of the grain weight increase. Positive NILs have increased maternal pericarp cell length, an effect which is independent of absolute grain length. These results provide direct genetic evidence that pericarp cell length affects final grain size and weight in polyploid wheat. We propose that combining genes that control distinct biological mechanisms, such as cell expansion and proliferation, will enhance crop yields. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  6. The storage of liquid high level waste at BNFL, Sellafield. Addendum to February 2000 report

    International Nuclear Information System (INIS)

    2001-08-01

    On 18 February 2000 the Health and Safety Executive (HSE) published a report on the work of its Nuclear Installations Inspectorate (NIl) in regulating the storage of liquid high level waste at the BNFL Sellafield site. Within the report NIl gave two undertakings. One was to publish an addendum around 1 year later covering its assessment of the new safety case for the storage plant and the second was to publish a further addendum when progress had been made with options studies for reducing the stocks of liquid high level waste (HLW), also referred to as highly active liquor (HAL), to a buffer level. A progress report was published in February 2001 which included a summary of the assessment of the new safety case and NIl's regulatory action to enforce liquid HLW stock reductions. This addendum provides a more detailed update on the position reached based on consideration of BNFL's responses to the recommendations from the February 2000 HLW report since its publication. It embodies the two addenda referred to above integrated into a single document for publication

  7. Identification of a novel IL-1 cytokine family member in teleost fish.

    Science.gov (United States)

    Wang, Tiehui; Bird, Steve; Koussounadis, Antonis; Holland, Jason W; Carrington, Allison; Zou, Jun; Secombes, Christopher J

    2009-07-15

    A novel IL-1 family member (nIL-1F) has been discovered in fish, adding a further member to this cytokine family. The unique gene organization of nIL-1F, together with its location in the genome and low homology to known family members, suggests that this molecule is not homologous to known IL-1F. Nevertheless, it contains a predicted C-terminal beta-trefoil structure, an IL-1F signature region within the final exon, a potential IL-1 converting enzyme cut site, and its expression level is clearly increased following infection, or stimulation of macrophages with LPS or IL-1beta. A thrombin cut site is also present and may have functional relevance. The C-terminal recombinant protein antagonized the effects of rainbow trout rIL-1beta on inflammatory gene expression in a trout macrophage cell line, suggesting it is an IL-1beta antagonist. Modeling studies confirmed that nIL-1F has the potential to bind to the trout IL-1RI receptor protein, and may be a novel IL-1 receptor antagonist.

  8. Surface diffusion studies by optical diffraction techniques

    International Nuclear Information System (INIS)

    Xiao, X.D.

    1992-11-01

    The newly developed optical techniques have been combined with either second harmonic (SH) diffraction or linear diffraction off a monolayer adsorbate grating for surface diffusion measurement. Anisotropy of surface diffusion of CO on Ni(l10) was used as a demonstration for the second harmonic dim reaction method. The linear diffraction method, which possesses a much higher sensitivity than the SH diffraction method, was employed to study the effect of adsorbate-adsorbate interaction on CO diffusion on Ni(l10) surface. Results showed that only the short range direct CO-CO orbital overlapping interaction influences CO diffusion but not the long range dipole-dipole and CO-NI-CO interactions. Effects of impurities and defects on surface diffusion were further explored by using linear diffraction method on CO/Ni(110) system. It was found that a few percent S impurity can alter the CO diffusion barrier height to a much higher value through changing the Ni(110) surface. The point defects of Ni(l10) surface seem to speed up CO diffusion significantly. A mechanism with long jumps over multiple lattice distance initiated by CO filled vacancy is proposed to explain the observed defect effect

  9. High-resolution analysis of a QTL for resistance to Stagonospora nodorum glume blotch in wheat reveals presence of two distinct resistance loci in the target interval.

    Science.gov (United States)

    Shatalina, Margarita; Messmer, Monika; Feuillet, Catherine; Mascher, Fabio; Paux, Etienne; Choulet, Frédéric; Wicker, Thomas; Keller, Beat

    2014-03-01

    Stagonospora nodorum glume blotch (SNG), caused by the necrotrophic fungus Stagonospora nodorum, is one of the economically important diseases of bread wheat (Triticum aestivum L.). Resistance to SNG is known to be quantitative and previous studies of a recombinant inbred line (RIL) population identified a major quantitative trait locus (QTL) for resistance to SNG on the short arm of chromosome 3B. To localize this QTL (QSng.sfr-3BS) with high resolution, we constructed a genetic map for the QTL target region using information from sequenced flow-sorted chromosomes 3B of the two parental cultivars 'Arina' and 'Forno', the physical map of chromosome 3B of cultivar 'Chinese Spring' and BAC-clone sequences. The mapping population of near-isogenic lines (NIL) was evaluated for SNG resistance in field infection tests. NILs segregated for disease resistance as well as for plant height; additionally, we observed a high environmental influence on the trait. Our analysis detected a strong negative correlation of SNG resistance and plant height. Further analysis of the target region identified two linked loci associated with SNG resistance. One of them was also associated with plant height, revealing an effect of QSng.sfr-3BS on plant height that was hidden in the RIL population. This result demonstrates an unexpectedly high genetic complexity of resistance controlled by QSng.sfr-3BS and shows the importance of the study of QTL in mendelized form in NILs.

  10. Indolenine meso-substituted dibenzotetraaza[14]annulene and its coordination chemistry toward the transition metal ions Mn(III), Fe(III), Co(II), Ni(II), Cu(II), and Pd(II).

    Science.gov (United States)

    Khaledi, Hamid; Olmstead, Marilyn M; Ali, Hapipah Mohd; Thomas, Noel F

    2013-02-18

    A new dibenzotetraaza[14]annulene bearing two 3,3-dimethylindolenine fragments at the meso positions (LH(2)), has been synthesized through a nontemplate method. X-ray crystallography shows that the whole molecule is planar. The basicity of the indolenine ring permits the macrocycle to be protonated external to the core and form LH(4)(2+)·2Cl(-). Yet another structural modification having strong C-H···π interactions was found in the chloroform solvate of LH(2). The latter two modifications are accompanied by a degree of nonplanar distortion. The antiaromatic core of the macrocycle can accommodate a number of metal ions, Mn(III), Fe(III), Co(II), Ni(II) and Cu(II), to form complexes of [Mn(L)Br], [Mn(L)Cl], [Fe(LH(2))Cl(2)](+)·Cl(-), [Co(L)], [Ni(L)], and [Cu(L)]. In addition, the reaction of LH(2) with the larger Pd(II) ion leads to the formation of [Pd(2)(LH(2))(2)(OAc)(4)] wherein the macrocycle acts as a semiflexible ditopic ligand to coordinate pairs of metal ions via its indolenine N atoms into dinuclear metallocycles. The compounds LH(2), [Co(L)], and [Ni(L)] are isostructural and feature close π-stacking as well as linear chain arrangements in the case of the metal complexes. Variable temperature magnetic susceptibility measurements showed thermally induced paramagnetism in [Ni(L)].

  11. Diatom-inspired templates for 3D replication: natural diatoms versus laser written artificial diatoms

    International Nuclear Information System (INIS)

    Belegratis, M R; Schmidt, V; Nees, D; Stadlober, B; Hartmann, P

    2014-01-01

    The diatoms are ubiquitous, exist in large numbers and show a great diversity of features on their porous silica structures. Therefore, they inspire the fabrication of nanostructured templates for nanoimprint processes (NIL), where large structured areas with nanometer precision are required. In this study, two approaches regarding the respective challenges and potential exploitations are followed and discussed: the first one takes advantage of a template that is directly made of natural occurring diatoms. Here, two replication steps via soft lithography are needed to obtain a template which is subsequently used for NIL. The second approach exploits the technical capabilities of the precise 3D laser lithography (3DLL) based on two-photon polymerization of organic materials. This method enables the fabrication of arbitrary artificial diatom-inspired micro- and nanostructures and the design of an inverse structure. Therefore, only one replication step is needed to obtain a template for NIL. In both approaches, a replication technique for true 3D structures is shown. (paper)

  12. High-throughput fabrication of anti-counterfeiting colloid-based photoluminescent microtags using electrical nanoimprint lithography

    International Nuclear Information System (INIS)

    Diaz, R; Palleau, E; Poirot, D; Sangeetha, N M; Ressier, L

    2014-01-01

    This work demonstrates the excellent capability of the recently developed electrical nanoimprint lithography (e-NIL) technique for quick, high-throughput production of well-defined colloid assemblies on surfaces. This is shown by fabricating micron-sized photoluminescent quick response (QR) codes based on the electrostatic directed trapping (so called nanoxerography process) of 28 nm colloidal lanthanide-doped upconverting NaYF 4 nanocrystals. Influencing experimental parameters have been optimized and the contribution of triboelectrification in e-NIL was evidenced. Under the chosen conditions, more than 300 000 nanocrystal-based QR codes were fabricated on a 4 inch silicon wafer, in less than 15 min. These microtags were then transferred to transparent flexible films, to be easily integrated onto desired products. Invisible to the naked eye, they can be decoded and authenticated using an optical microscopy image of their specific photoluminescence mapping. Beyond this very promising application for product tracking and the anti-counterfeiting strategies, e-NIL nanoxerography, potentially applicable to any types of charged and/or polarizable colloids and pattern geometries opens up tremendous opportunities for industrial scale production of various other kinds of colloid-based devices and sensors. (paper)

  13. Characterization of actions of dopamine in the pituitary of the goldfish, Carassius auratus

    Energy Technology Data Exchange (ETDEWEB)

    Omeljaniuk, R.J.

    1988-01-01

    The dopamine receptor in the goldfish (Carassius auratus) pituitary and its involvement with inhibition of gonadotropin (GtH) and {alpha}-melanocyte stimulating hormone ({alpha}-MSH) release was studied. In vitro dopamine, in a dose-related manner, inhibited spontaneous GtH and {alpha}-MSH release from superfused fragments of pars distalis (PD) and neurointermediate lob (NIL), respectively; dopamine also inhibited sGnRH-A stimulation of GtH release. Thyrotropin releasing-hormone (TRH), in a dose-related manner, stimulated {alpha}-MSH release from NIL fragments; dopamine inhibited TRH action. The stereoisomers of apomorphine were equivalent in inhibiting GtH and {alpha}-MSH release from fragments treated with releasing factors. Domperidone, in a dose-related manner, antagonized dopamine action. ({sup 3}H)-Spiperone was used to radiolabel the goldfish pituitary dopamine receptor in vitro. The binding of ({sup 3}H)-spiperone had the characteristics of a receptor: tissue specificity, dependence on tissue quantity, reversibility, saturability, displaceability, specificity of binding with various drugs and a correlation of binding with biological effects were demonstrated. This is a low-affinity, high-capacity receptor which does not show binding stereoselectivity for apomorphine; domperidone binds avidly to this receptor. The NIL contains significantly greater numbers of this receptor compared to the PD.

  14. Robust spinal cord resting-state fMRI using independent component analysis-based nuisance regression noise reduction.

    Science.gov (United States)

    Hu, Yong; Jin, Richu; Li, Guangsheng; Luk, Keith Dk; Wu, Ed X

    2018-04-16

    Physiological noise reduction plays a critical role in spinal cord (SC) resting-state fMRI (rsfMRI). To reduce physiological noise and increase the robustness of SC rsfMRI by using an independent component analysis (ICA)-based nuisance regression (ICANR) method. Retrospective. Ten healthy subjects (female/male = 4/6, age = 27 ± 3 years, range 24-34 years). 3T/gradient-echo echo planar imaging (EPI). We used three alternative methods (no regression [Nil], conventional region of interest [ROI]-based noise reduction method without ICA [ROI-based], and correction of structured noise using spatial independent component analysis [CORSICA]) to compare with the performance of ICANR. Reduction of the influence of physiological noise on the SC and the reproducibility of rsfMRI analysis after noise reduction were examined. The correlation coefficient (CC) was calculated to assess the influence of physiological noise. Reproducibility was calculated by intraclass correlation (ICC). Results from different methods were compared by one-way analysis of variance (ANOVA) with post-hoc analysis. No significant difference in cerebrospinal fluid (CSF) pulsation influence or tissue motion influence were found (P = 0.223 in CSF, P = 0.2461 in tissue motion) in the ROI-based (CSF: 0.122 ± 0.020; tissue motion: 0.112 ± 0.015), and Nil (CSF: 0.134 ± 0.026; tissue motion: 0.124 ± 0.019). CORSICA showed a significantly stronger influence of CSF pulsation and tissue motion (CSF: 0.166 ± 0.045, P = 0.048; tissue motion: 0.160 ± 0.032, P = 0.048) than Nil. ICANR showed a significantly weaker influence of CSF pulsation and tissue motion (CSF: 0.076 ± 0.007, P = 0.0003; tissue motion: 0.081 ± 0.014, P = 0.0182) than Nil. The ICC values in the Nil, ROI-based, CORSICA, and ICANR were 0.669, 0.645, 0.561, and 0.766, respectively. ICANR more effectively reduced physiological noise from both tissue motion and CSF pulsation than three alternative methods. ICANR increases the robustness of SC rsf

  15. Canopy architectural and physiological characterisation of near-isogenic wheat lines differing in the tiller inhibition gene tin

    Directory of Open Access Journals (Sweden)

    Carina eMoeller

    2014-12-01

    Full Text Available Tillering is a core constituent of plant architecture, and influences light interception to affect plant performance. Near-isogenic lines (NILs varying for a tiller inhibition (tin gene were investigated for tillering dynamics, organ size distribution, leaf area, light interception, red : far-red ratio, and chlorophyll content. Tillering ceased earlier in the tin lines to reduce the frequencies of later primary and secondary tillers, and demonstrated the genetically lower tillering plasticity of tin compared to free-tillering NILs. The distribution of organ sizes along shoots varied between NILs. In tin lines, internode elongation commenced at a lower phytomer, the peduncles were shorter, the flag leaves were larger, and the longest leaf blades were observed at higher phytomers. Total leaf area was reduced in tin lines. The tiller economy (ratio of seed-bearing shoots to numbers of shoots produced was 10% greater in the tin lines (0.73-0.76 compared to the free-tillering sisters (0.62-0.63. At maximum tiller number, the red: far-red ratio (light quality stimulus that is thought to induce the cessation of tillering at the plant-base was 0.18-0.22 in tin lines and 0.09-0.11 in free-tillering lines at levels of photosynthetic active radiation of 49-53% and 30-33%, respectively. The tin lines intercepted less radiation compared to their free-tillering sisters once genotypic differences in tiller numbers had established, and maintained green leaf area in the lower canopy later into the season. Greater light extinction coefficients (k in tin lines prior to, but reduced k after, spike emergence indicated that differences in light interception between NILs cannot be explained by leaf area alone but that geometric and optical canopy properties contributed. The characterisation of specifically-developed NILs is refining the development of a physiology-based model for tillering to enhance understanding of the value of architectural traits for use in cereal

  16. DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

    Directory of Open Access Journals (Sweden)

    J. E. Vinchira

    2014-01-01

    Full Text Available Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta. Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatoria en 48 acuarios de vidrio (80 l, 4 réplicas, 7 peces por acuario. No se detectó selenio en el agua de abastecimiento. Los peces fueron alimentados hasta saciedad aparente 3 veces al día por un período de 9 semanas. El desempeño productivo de la tilapia nilótica no se vio afectado ( P >0.05 por la suplementación con selenio dietario. El selenio corporal se incrementó de forma lineal ( P <0.05 con la suplementación de selenio orgánico e inorgánico. La composición corporal de selenio fue menor ( P <0.05 en los peces suplementados con selenito de sodio (1.67±0.14 mg/kg en comparación con la seleno-levadura (1.95±0.21 mg/kg. A partir de la relación entre pendientes se estimó que la biodisponibilidad relativa de la seleno- levadura para la composición de selenio corporal fue de 155.72±0,10%, con relación al selenito de sodio (fijada en 100%. De acuerdo con los resultados, la concentración basal de selenio dietario (0.21 mg/kg no limitó el desempeño productivo de tilapia nilótica. La suplementación con selenio orgánico (seleno-levadura e inorgánico (selenito de sodio entre 0.10 y 1.60 mg/kg no afectó el desempeño productivo de la tilapia nilótica.

  17. Redox-active porous coordination polymers prepared by trinuclear heterometallic pivalate linking with the redox-active nickel(II) complex: synthesis, structure, magnetic and redox properties, and electrocatalytic activity in organic compound dehalogenation in heterogeneous medium.

    Science.gov (United States)

    Lytvynenko, A S; Kolotilov, S V; Kiskin, M A; Cador, O; Golhen, S; Aleksandrov, G G; Mishura, A M; Titov, V E; Ouahab, L; Eremenko, I L; Novotortsev, V M

    2014-05-19

    Linking of the trinuclear pivalate fragment Fe2CoO(Piv)6 by the redox-active bridge Ni(L)2 (compound 1; LH is Schiff base from hydrazide of 4-pyridinecarboxylic acid and 2-pyridinecarbaldehyde, Piv(-) = pivalate) led to formation of a new porous coordination polymer (PCP) {Fe2CoO(Piv)6}{Ni(L)2}1.5 (2). X-ray structures of 1 and 2 were determined. A crystal lattice of compound 2 is built from stacked 2D layers; the Ni(L)2 units can be considered as bridges, which bind two Fe2CoO(Piv)6 units. In desolvated form, 2 possesses a porous crystal lattice (SBET = 50 m(2) g(-1), VDR = 0.017 cm(3) g(-1) estimated from N2 sorption at 78 K). At 298 K, 2 absorbed a significant quantity of methanol (up to 0.3 cm(3) g(-1)) and chloroform. Temperature dependence of molar magnetic susceptibility of 2 could be fitted as superposition of χMT of Fe2CoO(Piv)6 and Ni(L)2 units, possible interactions between them were taken into account using molecular field model. In turn, magnetic properties of the Fe2CoO(Piv)6 unit were fitted using two models, one of which directly took into account a spin-orbit coupling of Co(II), and in the second model the spin-orbit coupling of Co(II) was approximated as zero-field splitting. Electrochemical and electrocatalytic properties of 2 were studied by cyclic voltammetry in suspension and compared with electrochemical and electrocatalytic properties of a soluble analogue 1. A catalytic effect was determined by analysis of the catalytic current dependency on concentrations of the substrate. Compound 1 possessed electrocatalytic activity in organic halide dehalogenation, and such activity was preserved for the Ni(L)2 units, incorporated into the framework of 2. In addition, a new property occurred in the case of 2: the catalytic activity of PCP depended on its sorption capacity with respect to the substrate. In contrast to homogeneous catalysts, usage of solid PCPs may allow selectivity due to porous structure and simplify separation of product.

  18. Building Transnational Bodies: Norway and the International Development of Laboratory Animal Science, ca. 1956–1980

    Science.gov (United States)

    Druglitrø, Tone; Kirk, Robert G. W.

    2015-01-01

    Argument This article adopts a historical perspective to examine the development of Laboratory Animal Science and Medicine, an auxiliary field which formed to facilitate the work of the biomedical sciences by systematically improving laboratory animal production, provision, and maintenance in the post Second World War period. We investigate how Laboratory Animal Science and Medicine co-developed at the local level (responding to national needs and concerns) yet was simultaneously transnational in orientation (responding to the scientific need that knowledge, practices, objects and animals circulate freely). Adapting the work of Tsing (2004), we argue that national differences provided the creative “friction” that helped drive the formation of Laboratory Animal Science and Medicine as a transnational endeavor. Our analysis engages with the themes of this special issue by focusing on the development of Laboratory Animal Science and Medicine in Norway, which both informed wider transnational developments and was formed by them. We show that Laboratory Animal Science and Medicine can only be properly understood from a spatial perspective; whilst it developed and was structured through national “centers,” its orientation was transnational necessitating international networks through which knowledge, practice, technologies, and animals circulated. More and better laboratory animals are today required than ever before, and this demand will continue to rise if it is to keep pace with the quickening tempo of biological and veterinary research. The provision of this living experimental material is no longer a local problem; local, that is, to the research institute. It has become a national concern, and, in some of its aspects . . . even international. (William Lane-Petter 1957, 240) PMID:24941794

  19. What is optimal timing for trauma team alerts? A retrospective observational study of alert timing effects on the initial management of trauma patients

    Directory of Open Access Journals (Sweden)

    Lillebo B

    2012-08-01

    Full Text Available Borge Lillebo,1 Andreas Seim,2 Ole-Petter Vinjevoll,3 Oddvar Uleberg31Norwegian EHR Research Centre, Department of Neuroscience, Faculty of Medicine, Norwegian University of Science and Technology, Trondheim, Norway; 2Department of Computer and Information Science, Faculty of Information Technology, Mathematics and Electrical Engineering, NTNU, Trondheim, Norway; 3Department of Anaesthesia and Emergency Medicine, St Olav's University Hospital, Trondheim, NorwayBackground: Trauma teams improve the initial management of trauma patients. Optimal timing of trauma alerts could improve team preparedness and performance while also limiting adverse ripple effects throughout the hospital. The purpose of this study was to evaluate how timing of trauma team activation and notification affects initial in-hospital management of trauma patients.Methods: Data from a single hospital trauma care quality registry were matched with data from a trauma team alert log. The time from patient arrival to chest X-ray, and the emergency department length of stay were compared with the timing of trauma team activations and whether or not trauma team members received a preactivation notification.Results: In 2009, the trauma team was activated 352 times; 269 times met the inclusion criteria. There were statistically significant differences in time to chest X-ray for differently timed trauma team activations (P = 0.003. Median time to chest X-ray for teams activated 15–20 minutes prearrival was 5 minutes, and 8 minutes for teams activated <5 minutes before patient arrival. Timing had no effect on length of stay in the emergency department (P = 0.694. We found no effect of preactivation notification on time to chest X-ray (P = 0.474 or length of stay (P = 0.684.Conclusion: Proactive trauma team activation improved the initial management of trauma patients. Trauma teams should be activated prior to patient arrival.Keywords: emergency medical service communication systems

  20. Sensory impairment in hip-fracture patients 65 years or older and effects of hearing/vision interventions on fall frequency

    Directory of Open Access Journals (Sweden)

    Else V Grue

    2008-11-01

    Full Text Available Else V Grue1, Marit Kirkevold2, Petter Mowinchel3, Anette H Ranhoff41Diakonhjemmet University College, Department of Research and Development, Oslo, Norway; 2University of Oslo, Department of Medisin, Institute of Nursing Sciences and Health Profession, Oslo, Norway; 3Department of Paediatrics, Woman-child division, Ullevål University Hospital Oslo, Norway; 4Diakonhjemmet Hospital, Geriatric Unit, Oslo, NorwayAim: Examine the effect of nursing interventions to improve vision and hearing, systematic assessment, and referral to sensory specialists on falling.Methods: Controlled intervention trial targeting hip fracture patients, 65 years and older, living at home and having problems seeing/reading regular print (VI or hearing normal speech (HI. Intervention group = 200, control group = 131. The InterRAI-AcuteCare (RAI-AC and the Combined-Serious-Sensory-Impairment interview guide (KAS-Screen were used. Follow-up telephone calls were done every third month for one year.Results: Mean age was 84.2 years, 79.8% were female, and 76.7% lived alone. HI was detected in 80.7% and VI in 59.8%. Falling was more frequent among the intervention group (P = 0.003 and they also more often moved to a nursing home (P < 0.001 and were dependent walking up stairs (P = 0.003.Conclusions: This study could not document the effect of intervention on falling, possibly because of different base line characteristics (more females, P = 0.018, and more living alone P = 0.011 in the intervention group, differences in nursing care between subjects, and different risk factors. Interventions to improve sensory function remain important in rehabilitation, but have to be studied further.Keywords: vision, hearing, hip fracture, falls, intervention, hospital

  1. Uncommon disorders and decay in near-isogenic lines of melon and reference cultivars Acidentes fisiológicos e podridões atípicas em linhas quase-isogénicas de melão e em cultivares de referência

    Directory of Open Access Journals (Sweden)

    Juan Antonio Martínez

    2009-12-01

    Full Text Available Postharvest disorders and rots can produce important economic losses in fruits stored for long time for exportation. The genetic and physiological basis of some disorders in melon (Cucumis melo L. are unknown and particularly the possible relation with climacteric behavior. A collection of melon near-isogenic lines (NILs (SC3-5 and seven more showing climacteric and two non-climacteric ripening pattern were analyzed to study genetic and physiological aspects of fruit disorders and rots. Two non-climacteric (Nicolás; Inodorus Group; and Shongwan Charmi PI161375, Conomon Group and two climacteric cultivars (Fado, Reticulatus Group; Védrantais, Cantaloupensis Group were used as reference. The field was divided in eight blocks containing one three-plant replication for each NIL, two for the parental cultivar Piel de Sapo and one or two for the reference cultivars. Replications evaluated were more than six in the cultivars studied. Plant problems included aphids, powdery mildew, and leaf wind injury. Preharvest fruit disorders included whole fruit cracking in cultivar Védrantais and NIL 5M2, and stylar-end cracking in cultivar Fado. Climacteric NILs with yellow skin were particularly affected by over-ripening, stylar-end cracking, and sunburn during cultivation. At harvest, two NILs showed slight placental tissue necrosis which was inherited from SC and were also detected after storage. Other uncommon disorders seen at harvest or 30 days after storage at 8ºC included warted skin (scarring, flesh discoloration (light brown or translucent areas, hollow flesh disorder, and deep furrow netting inherited from SC. Less common rots included grey mould, bacterial soft rot, Penicillium rot, cottony leak and internal Cladosporium rot. Stylar-end hardness below 20 N·mm-1 was associated with cracking and softening. The incidence of the disorders and rots was too low to confirm that the genetic component played a role in their development

  2. Carfentrazone-ethyl aplicado em pós-emergência para o controle de Ipomea spp. e Commelina benghalensis na cultura da cana-de-açúcar Carfentrazone-ethyl applied in post-emergence to control Ipomoea spp. and Commelina benghalensis in sugarcane crop

    Directory of Open Access Journals (Sweden)

    P.J. Christoffoleti

    2006-01-01

    Full Text Available Este trabalho teve como objetivos determinar a eficácia e seletividade do carfentrazone-ethyl no controle de plantas daninhas na cultura da cana-de-açúcar e avaliar curvas de dose-resposta desse herbicida em Ipomoea spp. e Commelina benghalensis. Desenvolveu-se um ensaio de campo, em pós-emergência das plantas daninhas e da cultura (cv. RB72-454. O delineamento experimental utilizado foi do tipo blocos ao acaso, com os seguintes tratamentos: carfentrazone a 5, 10, 20, 30 e 50 g ha-1 e metribuzin a 2.400 g ha-1. As plantas daninhas que infestavam a área eram Ipomoea nil, I. grandifolia, I. quamoclit, Momordica charantia e C. benghalensis. As avaliações de controle visual e fitotoxicidade foram realizadas aos 15, 30 e 45 dias após a aplicação dos herbicidas. Para elaboração das curvas de dose-resposta, um experimento foi instalado em casa de vegetação, com as plantas daninhas I. nil, I. hederifolia, I. grandifolia, I. quamoclit e C. benghalensis. As doses do herbicida carfentrazone foram: 10D, 4D, 2D, D, 0,5D, 0,25D, 0,125D, 0,1D e 0,01D, em que D = 20 g ha¹. Os dados foram analisados a partir de curvas de dose-resposta de controle visual e massa fresca. No experimento de campo, observou-se excelente controle das plantas daninhas, sendo a dose de 50 g ha-1 de carfentrazone a mais eficiente. Nenhum tratamento causou danos à cana-de-açúcar. O experimento de casa de vegetação permitiu concluir que a ordem decrescente de sensibilidade das espécies de corda-de-viola ao carfentrazone-ethyl é: I. hederifolia > I. quamoclit > I. nil > I. grandifolia; e que C. benghalensis é controlada pelo carfentrazone a partir da dose de 5 g ha-1.This work aimed to evaluate the efficacy and selectivity of the herbicide carfentrazone-ethyl applied in post-emergence to control weeds in sugarcane crop and to evaluate dose-response curves of this herbicide in four species of Ipomoea spp. and Commelina benghalensis. Field experiment was carried out in

  3. Modeling of catalytically active metal complex species and intermediates in reactions of organic halides electroreduction.

    Science.gov (United States)

    Lytvynenko, Anton S; Kolotilov, Sergey V; Kiskin, Mikhail A; Eremenko, Igor L; Novotortsev, Vladimir M

    2015-02-28

    The results of quantum chemical modeling of organic and metal-containing intermediates that occur in electrocatalytic dehalogenation reactions of organic chlorides are presented. Modeling of processes that take place in successive steps of the electrochemical reduction of representative C1 and C2 chlorides - CHCl3 and Freon R113 (1,1,2-trifluoro-1,2,2-trichloroethane) - was carried out by density functional theory (DFT) and second-order Møller-Plesset perturbation theory (MP2). It was found that taking solvation into account using an implicit solvent model (conductor-like screening model, COSMO) or considering explicit solvent molecules gave similar results. In addition to modeling of simple non-catalytic dehalogenation, processes with a number of complexes and their reduced forms, some of which were catalytically active, were investigated by DFT. Complexes M(L1)2 (M = Fe, Co, Ni, Cu, Zn, L1H = Schiff base from 2-pyridinecarbaldehyde and the hydrazide of 4-pyridinecarboxylic acid), Ni(L2) (H2L2 is the Schiff base from salicylaldehyde and 1,2-ethylenediamine, known as salen) and Co(L3)2Cl2, representing a fragment of a redox-active coordination polymer [Co(L3)Cl2]n (L3 is the dithioamide of 1,3-benzenedicarboxylic acid), were considered. Gradual changes in electronic structure in a series of compounds M(L1)2 were observed, and correlations between [M(L1)2](0) spin-up and spin-down LUMO energies and the relative energies of the corresponding high-spin and low-spin reduced forms, as well as the shape of the orbitals, were proposed. These results can be helpful for determination of the nature of redox-processes in similar systems by DFT. No specific covalent interactions between [M(L1)2](-) and the R113 molecule (M = Fe, Co, Ni, Zn) were found, which indicates that M(L1)2 electrocatalysts act rather like electron transfer mediators via outer-shell electron transfer. A relaxed surface scan of the adducts {M(L1)2·R113}(-) (M = Ni or Co) versus the distance between the

  4. Relationship between severe obesity and depth to the cricothyroid membrane in third-trimester non-labouring parturients: a prospective observational study.

    Science.gov (United States)

    Gadd, K; Wills, K; Harle, R; Terblanche, N

    2018-05-01

    Severely obese parturients have increased 'cannot intubate, cannot oxygenate' risk during Caesarean section under general anaesthesia. Front-of-neck access (FONA) at the cricothyroid membrane (CTM) is definitive management; however, attempted FONA can fail. Point-of-care ultrasonography may provide useful information about CTM depth to aid FONA in obesity. This study determined the difference in CTM depth between severely obese and non-obese parturients, utilising ultrasonography. In this prospective observational study, two anaesthetists performed airway ultrasonography on 15 severely obese (BMI >45 kg m -2 ) and 15 normal-weight (BMI ≤25 kg m -2 ) parturients in the third trimester, using the transverse and longitudinal planes, sniffing and extended head positions, and nil and firm transducer pressures. The primary outcome was CTM depth (millimetres) measured in the transverse plane with the head extended and nil transducer pressure. Secondary outcomes included CTM depth measurements using other factor configurations. Intra-class correlation coefficients assessed the inter-observer reliability. CTM depth measured in the transverse plane with head extended and nil transducer pressure was significantly greater in severely obese parturients, mean 18.0 mm (95% confidence interval 16.3-19.8), vs 10.6 mm (8.81-12.4) in non-obese (P<0.001); mean difference 7.4 mm (4.9-9.9; P<0.001). CTM depths were increased in the severely obese group regardless of scanning plane, head and neck position, or transducer pressure (all P<0.001). There was excellent inter-observer reliability. Cricothyroid membrane depth is significantly increased in severely obese vs normal-weight parturients independently of scanning plane, head and neck position, or transducer pressure. Copyright © 2018 British Journal of Anaesthesia. All rights reserved.

  5. Delimitation of the Earliness per se D1 (Eps-D1) flowering gene to a subtelomeric chromosomal deletion in bread wheat (Triticum aestivum)

    Science.gov (United States)

    Zikhali, Meluleki; Wingen, Luzie U.; Griffiths, Simon

    2016-01-01

    Earliness per se (Eps) genes account for the variation in flowering time when vernalization and photoperiod requirements are satisfied. Genomics and bioinformatics approaches were used to describe allelic variation for 40 Triticum aestivum genes predicted, by synteny with Brachypodium distachyon, to be in the 1DL Eps region. Re-sequencing 1DL genes revealed that varieties carrying early heading alleles at this locus, Spark and Cadenza, carry a subtelomeric deletion including several genes. The equivalent region in Rialto and Avalon is intact. A bimodal distribution in the segregating Spark X Rialto single seed descent (SSD) populations enabled the 1DL QTL to be defined as a discrete Mendelian factor, which we named Eps-D1. Near isogenic lines (NILs) and NIL derived key recombinants between markers flanking Eps-D1 suggest that the 1DL deletion contains the gene(s) underlying Eps-D1. The deletion spans the equivalent of the Triticum monoccocum Eps-A m 1 locus, and hence includes MODIFIER OF TRANSCRIPTION 1 (MOT1) and FTSH PROTEASE 4 (FTSH4), the candidates for Eps-A m 1. The deletion also contains T. aestivum EARLY FLOWERING 3-D1 (TaELF3-D1) a homologue of the Arabidopsis thaliana circadian clock gene EARLY FLOWERING 3. Eps-D1 is possibly a homologue of Eps-B1 on chromosome 1BL. NILs carrying the Eps-D1 deletion have significantly reduced total TaELF3 expression and altered TaGIGANTEA (TaGI) expression compared with wild type. Altered TaGI expression is consistent with an ELF3 mutant, hence we propose TaELF3-D1 as the more likely candidate for Eps-D1. This is the first direct fine mapping of Eps effect in bread wheat. PMID:26476691

  6. Mapping and validation of quantitative trait loci for resistance to Cercospora zeae-maydis infection in tropical maize (Zea mays L.).

    Science.gov (United States)

    Pozar, Gilberto; Butruille, David; Silva, Heyder Diniz; McCuddin, Zoe Patterson; Penna, Julio Cesar Viglioni

    2009-02-01

    Breeding for resistance to gray leaf spot, caused by Cercospora zeae-maydis (Cz) is paramount for many maize environments, in particular under warm and humid growing conditions. In this study, we mapped and characterized quantitative trait loci (QTL) involved in the resistance of maize against Cz. We confirmed the impact of the QTL on disease severity using near-isogenic lines (NILs), and estimated their effects on three major agronomic traits using their respective near isogenic hybrids (NIHs), which we obtained by crossing the NILs with an inbred from a complementary heterotic pool. We further validated three of the four QTL that were mapped using the Multiple Interval Mapping approach and showed LOD values>2.5. NILs genotype included all combinations between favorable alleles of the two QTL located in chromosome 1 (Q1 in bin 1.05 and Q2 in bin 1.07), and the allele in chromosome 3 (Q3 in bin 3.07). Each of the three QTL separately significantly reduced the severity of Cz. However, we found an unfavorable epistatic interaction between Q1 and Q2: presence of the favorable allele at one of the QTL allele effectively nullified the effect of the favorable allele at the other. In contrast, the interaction between Q2 and Q3 was additive, promoting the reduction of the severity to a greater extent than the sum of their individual effects. When evaluating the NIH we found significant individual effects for Q1 and Q3 on gray leaf spot severity, for Q2 on stalk lodging and grain yield, and for Q3 on grain moisture and stalk lodging. We detected significant epitasis between Q1 and Q2 for grain moisture and between Q1 and Q3 for stalk lodging. These results suggest that the combination of QTL impacts the effectiveness of marker-assisted selection procedures in commercial product development programs.

  7. Fine mapping and characterization of BPH27, a brown planthopper resistance gene from wild rice (Oryza rufipogon Griff.).

    Science.gov (United States)

    Huang, D; Qiu, Y; Zhang, Y; Huang, F; Meng, J; Wei, S; Li, R; Chen, B

    2013-01-01

    The brown planthopper (Nilaparvata lugens Stål; BPH) is one of the most serious rice pests worldwide. Growing resistant varieties is the most effective way to manage this insect, and wild rice species are a valuable source of resistance genes for developing resistant cultivars. BPH27 derived from an accession of Guangxi wild rice, Oryza rufipogon Griff. (Accession no. 2183, hereafter named GX2183), was primarily mapped to a 17-cM region on the long arm of the chromosome four. In this study, fine mapping of BPH27 was conducted using two BC(1)F(2) populations derived from introgression lines of GX2183. Insect resistance was evaluated in the BC(1)F(2) populations with 6,010 individual offsprings, and 346 resistance extremes were obtained and employed for fine mapping of BPH27. High-resolution linkage analysis defined the BPH27 locus to an 86.3-kb region in Nipponbare. Regarding the sequence information of rice cultivars, Nipponbare and 93-11, all predicted open reading frames (ORFs) in the fine-mapping region have been annotated as 11 types of proteins, and three ORFs encode disease-related proteins. Moreover, the average BPH numbers showed significant differences in 96-120 h after release in comparisons between the preliminary near-isogenic lines (pre-NILs, lines harboring resistance genes) and BaiR54. BPH growth and development were inhibited and survival rates were lower in the pre-NIL plants compared with the recurrent parent BaiR54. The pre-NIL exhibited 50.7% reductions in population growth rates (PGR) compared to BaiR54. The new development in fine mapping of BPH27 will facilitate the efforts to clone this important resistant gene and to use it in BPH-resistance rice breeding.

  8. A Single-Nucleotide Polymorphism in an Endo-1,4-β-Glucanase Gene Controls Seed Coat Permeability in Soybean.

    Directory of Open Access Journals (Sweden)

    Seong-Jin Jang

    Full Text Available Physical dormancy, a structural feature of the seed coat known as hard seededness, is an important characteristic for adaptation of plants against unstable and unpredictable environments. To dissect the molecular basis of qHS1, a quantitative trait locus for hard seededness in soybean (Glycine max (L Merr., we developed a near-isogenic line (NIL of a permeable (soft-seeded cultivar, Tachinagaha, containing a hard-seed allele from wild soybean (G. soja introduced by successive backcrossings. The hard-seed allele made the seed coat of Tachinagaha more rigid by increasing the amount of β-1,4-glucans in the outer layer of palisade cells of the seed coat on the dorsal side of seeds, known to be a point of entrance of water. Fine-mapping and subsequent expression and sequencing analyses revealed that qHS1 encodes an endo-1,4-β-glucanase. A single-nucleotide polymorphism (SNP introduced an amino acid substitution in a substrate-binding cleft of the enzyme, possibly reducing or eliminating its affinity for substrates in permeable cultivars. Introduction of the genomic region of qHS1 from the impermeable (hard-seeded NIL into the permeable cultivar Kariyutaka resulted in accumulation of β-1,4-glucan in the outer layer of palisade cells and production of hard seeds. The SNP allele found in the NIL was further associated with the occurrence of hard seeds in soybean cultivars of various origins. The findings of this and previous studies may indicate that qHS1 is involved in the accumulation of β-1,4-glucan derivatives such as xyloglucan and/or β-(1,3(1,4-glucan that reinforce the impermeability of seed coats in soybean.

  9. Boron nitride stamp for ultra-violet nanoimprinting lithography fabricated by focused ion beam lithography

    International Nuclear Information System (INIS)

    Altun, Ali Ozhan; Jeong, Jun-Ho; Rha, Jong-Joo; Kim, Ki-Don; Lee, Eung-Sug

    2007-01-01

    Cubic boron nitride (c-BN) is one of the hardest known materials (second after diamond). It has a high level of chemical resistance and high UV transmittance. In this study, a stamp for ultra-violet nanoimprint lithography (UV-NIL) was fabricated using a bi-layered BN film deposited on a quartz substrate. Deposition of the BN was done using RF magnetron sputtering. A hexagonal boron nitride (h-BN) layer was deposited for 30 min before c-BN was deposited for 30 min. The thickness of the film was measured as 160 nm. The phase of the c-BN layer was investigated using Fourier transform infrared (FTIR) spectrometry, and it was found that the c-BN layer has a 40% cubic phase. The deposited film was patterned using focused ion beam (FIB) lithography for use as a UV-NIL stamp. Line patterns were fabricated with the line width and line distance set at 150 and 150 nm, respectively. The patterning process was performed by applying different currents to observe the effect of the current value on the pattern profile. The fabricated patterns were investigated using AFM, and it was found that the pattern fabricated by applying a current value of 50 picoamperes (pA) has a better profile with a 65 nm line depth. The UV transmittance of the 160 nm thick film was measured to be 70-86%. The hardness and modulus of the BN was measured to be 12 and 150 GPa, respectively. The water contact angle of the stamp surface was measured at 75 0 . The stamp was applied to UV-NIL without coating with an anti-adhesion layer. Successful imprinting was proved via scanning electron microscope (SEM) images of the imprinted resin

  10. Patterning techniques for next generation IC's

    Science.gov (United States)

    Balasinski, A.

    2007-12-01

    Reduction of linear critical dimensions (CDs) beyond 45 nm would require significant increase of the complexity of pattern definition process. In this work, we discuss the key successor methodology to the current optical lithography, the Double Patterning Technique (DPT). We compare the complexity of CAD solutions, fab equipment, and wafer processing with its competitors, such as the nanoimprint (NIL) and the extreme UV (EUV) techniques. We also look ahead to the market availability for the product families enabled using the novel patterning solutions. DPT is often recognized as the most viable next generation lithography as it utilizes the existing equipment and processes and is considered a stop-gap solution before the advanced NIL or EUV equipment is developed. Using design for manufacturability (DfM) rules, DPT can drive the k1 factor down to 0.13. However, it faces a variety of challenges, from new mask overlay strategies, to layout pattern split, novel OPC, increased CD tolerances, new etch techniques, as well as long processing time, all of which compromise its return on investment (RoI). In contrast, it can be claimed e.g., that the RoI is the highest for the NIL but this technology bears significant risk. For all novel patterning techniques, the key questions remain: when and how should they be introduced, what is their long-term potential, when should they be replaced, and by what successor technology. We summarize the unpublished results of several panel discussions on DPT at the recent SPIE/BACUS conferences.

  11. Integrated metabolo-proteomic approach to decipher the mechanisms by which wheat QTL (Fhb1 contributes to resistance against Fusarium graminearum.

    Directory of Open Access Journals (Sweden)

    Raghavendra Gunnaiah

    Full Text Available BACKGROUND: Resistance in plants to pathogen attack can be qualitative or quantitative. For the latter, hundreds of quantitative trait loci (QTLs have been identified, but the mechanisms of resistance are largely unknown. Integrated non-target metabolomics and proteomics, using high resolution hybrid mass spectrometry, were applied to identify the mechanisms of resistance governed by the fusarium head blight resistance locus, Fhb1, in the near isogenic lines derived from wheat genotype Nyubai. FINDINGS: The metabolomic and proteomic profiles were compared between the near isogenic lines (NIL with resistant and susceptible alleles of Fhb1 upon F. graminearum or mock-inoculation. The resistance-related metabolites and proteins identified were mapped to metabolic pathways. Metabolites of the shunt phenylpropanoid pathway such as hydroxycinnamic acid amides, phenolic glucosides and flavonoids were induced only in the resistant NIL, or induced at higher abundances in resistant than in susceptible NIL, following pathogen inoculation. The identities of these metabolites were confirmed, with fragmentation patterns, using the high resolution LC-LTQ-Orbitrap. Concurrently, the enzymes of phenylpropanoid biosynthesis such as cinnamyl alcohol dehydrogenase, caffeoyl-CoA O-methyltransferase, caffeic acid O-methyltransferase, flavonoid O-methyltransferase, agmatine coumaroyltransferase and peroxidase were also up-regulated. Increased cell wall thickening due to deposition of hydroxycinnamic acid amides and flavonoids was confirmed by histo-chemical localization of the metabolites using confocal microscopy. CONCLUSION: The present study demonstrates that the resistance in Fhb1 derived from the wheat genotype Nyubai is mainly associated with cell wall thickening due to deposition of hydroxycinnamic acid amides, phenolic glucosides and flavonoids, but not with the conversion of deoxynivalenol to less toxic deoxynivalenol 3-O-glucoside.

  12. Comparative transcriptomic analysis of two Brassica napus near-isogenic lines reveals a network of genes that influences seed oil accumulation

    Directory of Open Access Journals (Sweden)

    Jingxue Wang

    2016-09-01

    Full Text Available Rapeseed (Brassica napus is an important oil seed crop, providing more than 13% of the world’s supply of edible oils. An in-depth knowledge of the gene network involved in biosynthesis and accumulation of seed oil is critical for the improvement of B. napus. Using available genomic and transcriptomic resources, we identified 1,750 acyl lipid metabolism (ALM genes that are distributed over 19 chromosomes in the B. napus genome. B. rapa and B. oleracea, two diploid progenitors of B. napus, contributed almost equally to the ALM genes. Genome collinearity analysis demonstrated that the majority of the ALM genes have arisen due to genome duplication or segmental duplication events. In addition, we profiled the expression patterns of the ALM genes in four different developmental stages. Furthermore, we developed two B. napus near isogenic lines (NILs. The high oil NIL, YC13-559, accumulates more than 10% of seed oil compared to the other, YC13-554. Comparative gene expression analysis revealed upregulation of lipid biosynthesis-related regulatory genes in YC13-559, including SHOOTMERISTEMLESS, LEAFY COTYLEDON 1 (LEC1, LEC2, FUSCA3, ABSCISIC ACID INSENSITIVE 3 (ABI3, ABI4, ABI5, and WRINKLED1, as well as structural genes, such as ACETYL-CoA CARBOXYLASE, ACYL-CoA DIACYLGLYCEROL ACYLTRANSFERASE, and LONG-CHAIN ACYL-CoA SYNTHETASES. We observed that several genes related to the phytohormones, gibberellins, jasmonate, and indole acetic acid, were differentially expressed in the NILs. Our findings provide a broad account of the numbers, distribution, and expression profiles of acyl lipid metabolism genes, as well as gene networks that potentially control oil accumulation in B. napus seeds. The upregulation of key regulatory and structural genes related to lipid biosynthesis likely plays a major role for the increased seed oil in YC13-559.

  13. Quantification of a cardiac biomarker in human serum using extraordinary optical transmission (EOT.

    Directory of Open Access Journals (Sweden)

    Tao Ding

    Full Text Available Nanoimprinting lithography (NIL is a manufacturing process that can produce macroscale surface areas with nanoscale features. In this paper, this technique is used to solve three fundamental issues for the application of localized surface plasmonic resonance (LSPR in practical clinical measurements: assay sensitivity, chip-to-chip variance, and the ability to perform assays in human serum. Using NIL, arrays of 140 nm square features were fabricated on a sensing area of 1.5 mm x 1.5 mm with low cost. The high reproducibility of NIL allowed for the use of a one-chip, one-measurement approach with 12 individually manufactured surfaces with minimal chip-to-chip variations. To better approximate a real world setting, all chips were modified with a biocompatible, multi-component monolayer and inter-chip variability was assessed by measuring a bioanalyte standard (2.5-75 ng/ml in the presence of a complex biofluid, human serum. In this setting, nanoimprinted LSPR chips were able to provide sufficient characteristics for a 'low-tech' approach to laboratory-based bioanalyte measurement, including: 1 sufficient size to interface with a common laboratory light source and detector without the need for a microscope, 2 high sensitivity in serum with a cardiac troponin limit of detection of 0.55 ng/ml, and 3 very low variability in chip manufacturing to produce a figure of merit (FOM of 10.5. These findings drive LSPR closer to technical comparability with ELISA-based assays while preserving the unique particularities of a LSPR based sensor, suitability for multiplexing and miniaturization, and point-of-care detections.

  14. Delimitation of the Earliness per se D1 (Eps-D1) flowering gene to a subtelomeric chromosomal deletion in bread wheat (Triticum aestivum).

    Science.gov (United States)

    Zikhali, Meluleki; Wingen, Luzie U; Griffiths, Simon

    2016-01-01

    Earliness per se (Eps) genes account for the variation in flowering time when vernalization and photoperiod requirements are satisfied. Genomics and bioinformatics approaches were used to describe allelic variation for 40 Triticum aestivum genes predicted, by synteny with Brachypodium distachyon, to be in the 1DL Eps region. Re-sequencing 1DL genes revealed that varieties carrying early heading alleles at this locus, Spark and Cadenza, carry a subtelomeric deletion including several genes. The equivalent region in Rialto and Avalon is intact. A bimodal distribution in the segregating Spark X Rialto single seed descent (SSD) populations enabled the 1DL QTL to be defined as a discrete Mendelian factor, which we named Eps-D1. Near isogenic lines (NILs) and NIL derived key recombinants between markers flanking Eps-D1 suggest that the 1DL deletion contains the gene(s) underlying Eps-D1. The deletion spans the equivalent of the Triticum monoccocum Eps-A (m) 1 locus, and hence includes MODIFIER OF TRANSCRIPTION 1 (MOT1) and FTSH PROTEASE 4 (FTSH4), the candidates for Eps-A (m) 1. The deletion also contains T. aestivum EARLY FLOWERING 3-D1 (TaELF3-D1) a homologue of the Arabidopsis thaliana circadian clock gene EARLY FLOWERING 3. Eps-D1 is possibly a homologue of Eps-B1 on chromosome 1BL. NILs carrying the Eps-D1 deletion have significantly reduced total TaELF3 expression and altered TaGIGANTEA (TaGI) expression compared with wild type. Altered TaGI expression is consistent with an ELF3 mutant, hence we propose TaELF3-D1 as the more likely candidate for Eps-D1. This is the first direct fine mapping of Eps effect in bread wheat. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  15. New Results on Plasma Activated Bonding of Imprinted Polymer Features for Bio MEMS Applications

    International Nuclear Information System (INIS)

    Kettner, P; Pelzer, R L; Glinsner, T; Farrens, S; Lee, D

    2006-01-01

    Nanoimprint Lithography is a well-acknowledged low cost, high resolution, large area 3D patterning process for polymers. It includes the most promising methods: high pressure hot embossing (HE) and UV-Nanoimprint Lithography (UV-NIL). Curing of the imprinted structures is either done by cooling down below the glass transition temperature of the thermoplastic polymer in case of HE or by subsequent UV-light exposure and cross-linking in case of UV-NIL. Both techniques allow rapid prototyping for high volume production of fully patterned substrates for a wide range of materials. The advantages of using polymer substrates over common Micro-Electro-Mechanical Systems (MEMS) processing materials like glass, silicon or quartz are: bio-compatible surfaces, easy manufacturability, low cost for high volume production, suitable for use in micro- and nano-fabrication, low conductivity, wide range of optical properties just to name a few. We will present experimental results on HE processes with PMMA as well as UV-NIL imprints in selected UV-curable resists. In the second part of the work we will describe the bonding techniques for packaging of the micro or nano structures. Packaging of the imprinted features is a key technology for a wide variety of field of applications: μ-TAS, biochemistry, micro-mixers, micro-reactors, electrophoresis cells, life science, micro-optical and nano-optical applications (switches) nanofluidics, data storage, etc. for features down to sub-100 nm range. Most bonding techniques for polymer use adhesives as intermediate layers. We will demonstrate a promising technique for dense and very strong bonds using plasma activation of polymers and glass. This bonding technology allows for bonding at low temperatures well below the glass transition temperature of the polymers, which will ensure that the structures are not deformed

  16. Morphology and physiology of the marine straminipilan fungi, the aplanochytrids isolated from the equatorial Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Damare, V.; Raghukumar, S.

    cysteine and the aromatic amino acids did not induce any growth. Enzymatic studies−Ten isolates showed degrada-tion of milk protein indicating production of protease enzyme but none of the isolates produced lipase, amylase or chitinase enzymes (Table 4... represents 5 µm. Table 4Protease activity of 14 isolates of aplanochytrids isolated from equatorial Indian Ocean, as observed by the zone of clearance of milk protein. Isolate no. Zone of clearance of milk protein (mm) S1961 16.5 S1962 nil S1963 18...

  17. Material and construction of primary components

    International Nuclear Information System (INIS)

    Kaser, A.; Wallner, F.

    1978-01-01

    The construction of SNR's requires specific properties of the materials, i.e. high strength at temperatures of 600 0 C, adequate creep rupture strength, low long-time embrittlement. Aspects are given for optimalization of the mentioned properties with regard to safe manufacture especially good weldability. The austenitic material X6CrNil811 similar the type AISI 304 SS finally was chosen. Besides the fundamental analysis of the material properties it will be reported about the experiences gained during the manufacturing of the essential components. (author)

  18. Inhaled Steroids: First Line Treatment of Adult Asthma

    Directory of Open Access Journals (Sweden)

    André Cartier

    1995-01-01

    Full Text Available Corticosteroids are the most potent inhaled anti-inflammatory drugs for asthma treatment. This paper reviews the clinical evidence supporting the early use of inhaled steroids in asthma as a first line treatment. Inhaled steroids can probably alter the course of asthma, especially in mild asthmatics. Once they have been shown to improve control of asthma and even if the need for beta2-agonists is virtually nil, their use should be continued at low doses (ie, equivalent to 400 to 500 μg of budesonide or beclomethasone for at least one year before attempting to reduce the dosage.

  19. The beliefs in the inheritance of risk factors for suicide scale (BIRFSS): cross-cultural validation in Estonia, Malaysia, Romania, the United Kingdom, and the United States.

    Science.gov (United States)

    Voracek, Martin; Loibl, Lisa Mariella; Swami, Viren; Vintilă, Mona; Kõlves, Kairi; Sinniah, Dhachayani; Pillai, Subash Kumar; Ponnusamy, Subramaniam; Sonneck, Gernot; Furnham, Adrian; Lester, David

    2008-12-01

    The genetics of suicide is increasingly recognized and relevant for mental health literacy, but actual beliefs may lag behind current knowledge. We examined such beliefs in student samples (total N = 686) from Estonia, Malaysia, Romania, the United Kingdom, and the United States with the Beliefs in the Inheritance of Risk Factors for Suicide Scale. Cultural effects were small, those of key demographics nil. Several facets of construct validity were demonstrated. Marked differences in perceived plausibility of evidence about the genetics of suicide according to research design, observed in all samples, may be of general interest for investigating lay theories of abnormal behavior and communicating behavioral and psychiatric genetic research findings.

  20. A new Ni(II complex as a novel and efficient recyclable catalyst for the synthesis of pyrano[2,3-d]pyrimidines

    Directory of Open Access Journals (Sweden)

    M. Habibi Kheirabadi

    2016-12-01

    Full Text Available A simple and highly efficient one-pot three-component synthesis of a series of pyrido[2,3-d]pyrimidines from the condensation of barbituric acid, malononitrile and aromatic aldehydes using catalytic amount of a new Ni(II complex based on 5-nitro-N1-((pyridin-2-ylmethylene benzene-1,2-diamine (NiL is reported. This new heterogeneous catalyst has the advantages of being environmentally friendly, simple work-up and high yields character.

  1. Time-Efficient High-Resolution Large-Area Nano-Patterning of Silicon Dioxide

    DEFF Research Database (Denmark)

    Lin, Li; Ou, Yiyu; Aagesen, Martin

    2017-01-01

    A nano-patterning approach on silicon dioxide (SiO2) material, which could be used for the selective growth of III-V nanowires in photovoltaic applications, is demonstrated. In this process, a silicon (Si) stamp with nanopillar structures was first fabricated using electron-beam lithography (EBL....... In addition, high time efficiency can be realized by one-spot electron-beam exposure in the EBL process combined with NIL for mass production. Furthermore, the one-spot exposure enables the scalability of the nanostructures for different application requirements by tuning only the exposure dose. The size...

  2. Re-operation for aortic and mitral prosthetic dysfunctions.

    Science.gov (United States)

    Kaul, T K; Sastry, M R; Mercer, J L; Meade, J B

    1985-01-01

    The overall incidence of re-operation and prosthetic valve endocarditis was low in the present series as mechanical prostheses were used predominantly. The prosthetic dysfunctions were less frequent following the primary implantation with Bjork Shiley prostheses, but high operative risk was associated with the clotted Bjork Shiley prostheses. We also had unusual experience of strut fracture and sticking of Bjork Shiley discs in the closed position in both aortic and mitral positions. The early deaths were nil since the use of cardioplegic protection. Intra-operative bleeding due to adhesions can be minimised by using synthetic or heterologous pericardium during the primary operation.

  3. Navigation and offshore wind turbine arrays in the North Sea. Construction of deformable protective elements; Schifffahrt und Offshore-Windenergieanlagen in der Nordsee. Vorgelagerte Elemente als Knautschzone

    Energy Technology Data Exchange (ETDEWEB)

    Otte, Erhard

    2010-11-29

    With the construction of many new offshore wind turbines, the risk of collisions in the German part of the North Sea will increase considerably. While the collision risk can be reduced by specifying priority and safety zones, it cannot be reduced to nil. It is therefore necessary to take measures to reduce the consequences of potential collisions. The author proposes the construction of deformable elements around wind turbines which may also serve as wave energy plants. This will not only reduce the collision shock but may also make the system more profitable and give it political, economic and ecological advantages. (orig.)

  4. Assessment of weld heat-affected zones in a reactor vessel material

    International Nuclear Information System (INIS)

    Marston, T.U.; Server, W.

    1978-01-01

    The mechanical properties of weld heat-affected zones (HAZ's) associated with the heavy section, nuclear quality weldments are evaluated and found to be superior to those of the parent base material. The nil ductility transition temperature (NDTT), Charpy impact and static and dynamic fracture toughness properties of a HAZ associated with a submerged arc weld and one associated with a manual metal arc weld are directly compared with those of the parent base material. It is concluded that the stigma normally associated with HAZ is not justified for this grade and quality of material and weld procedure

  5. The Re-Fe-S system at 1200, 1100, 1000 and 900 degree C

    DEFF Research Database (Denmark)

    Karup-Møller, Sven; Makovicky, E.

    1999-01-01

    Phase relations in the dry condensed phase system Fe-Re-S from 1200oC down to 900oC involve S-poor Fe-S melt with up to 0.2 at.% dissolved Re, S-rich melt with 0.3-0.4 at.% dissolved Re at 1200oC, Fe1-xS with Re contents growing from nil for troilite to 0.2 at.% for S-richer compositions, gFe wit...

  6. Punk Rock and the Value of Auto-ethnographic Writing about Music

    OpenAIRE

    Attfield, Sarah

    2011-01-01

    Why do many of the books on punk rock and hardcore punk come with punk attitude? Why are a good number of the books written from a personal perspective? What kind of value do the diary entries of Nils Stevenson in 'Vacant: A Diary of the Punk Years 1976-79' have compared to an article on the rhetoric of class by David Simonelli in the journal 'Contemporary British History'? In some respects scholarly writing on punk rock seems like a contradiction. How can music so rooted in anti-establishmen...

  7. Evolution of DWI signal abnormalities after transient ischemic attack and minor ischaemic stroke

    LENUS (Irish Health Repository)

    Merwick, A

    2011-05-01

    Background: Diffusion weighted imaging (DWI) signal abnormality after transient ischaemic attack (TIA) predicts early stroke, independently of other risk markers included in the ABCD3-I score. Early stroke recurrence detected on follow-up DWI after the acute-phase DWI may identify patients at high risk for subsequent clinicalstrokesstroke, cognitive impairment, and seizures. We aimed to determine the evolution of acute DWI lesions and rate of new ischaemic lesion (NIL) occurrence on follow-up DWI after TIA and minor stroke.\\r\

  8. Colorectal cancer associated with abdominal aortic aneurysm: results of EVAR followed by colectomy.

    Science.gov (United States)

    Illuminati, Giulio; Ceccanei, Gianluca; Pacilè, Maria A; Pizzardi, Giulia; Palumbo, Piergaspare; Vietri, Francesco

    2013-01-01

    The association of colorectal cancer and abdominal aortic aneurysm (AAA) is infrequent but poses special problems of priority of treatment under elective circumstances. The purpose of this study was to retrospectively evaluate the outcome of 16 consecutive patients undergoing endovascular aneurysm repair (EVAR) followed by colectomy. Operative mortality was nil. Operative morbidity included two transient rise of serum creatinine level and one extraperitoneal anastomotic leakage which evolved favourably with conservative treatment. EVAR allowed a very short delay of treatment of colorectal cancer after aneurysm repair, minimizing operative complications.

  9. Dynamic Testing with the NSWC Three-Degree-of-Freedom Gas Bearing

    Science.gov (United States)

    1982-03-08

    Long Island, NY 11714 Mr. J. W. Faust 1 A . Martellucci 1 Marquardt Aircraft W. Daskin 1 Corporation J. D. Cresawll 1 16555 Saticoy Street J. Pettus 1...BEARING S. PERFORMING ORG. REPORT MUMMER 7. AUTHOR( a ) S. CONTRACT OR GRANT NUMUERia) F. J. REGAN S. PERFORMING ORGANIZATION NAME AND ADDRESS1.PRGA...ADDRESS 12. REPORT DATE 8 march 1982 1S. NUMBER OF PAGES 19’ MONITORING AGENCY NAME A ADDRESS(’lIf 0"#t bW CmoUIMd Office) 15. SECURITY CLASS. (Of Nil

  10. Proyecto de diseño de industria de procesado y exportación de tilapia y definición tipo de la obra civil e instalaciones en Huila (Colombia)

    OpenAIRE

    Contín Vital, Javier

    2015-01-01

    El presente Trabajo Fin de Grado (TFG) titulado “Diseño de industria de procesado y exportación de tilapia y definición tipo de la obra civil e instalaciones en Huila (Colombia)” tiene como objeto, el diseño de una industria de procesado de tilapia nilótica (Oreochromis niloticus) en fresco, como filete y pescado entero, y en congelado, como entero, para una capacidad de producción aproximada de 960 toneladas mensuales en el Departamento del Huila. Desarrollado con la estructur...

  11. Schwaebisch Hall West Germany. Limited Surface Observations Climatic Summary (LISOCS).

    Science.gov (United States)

    1984-01-25

    of distibution tables Dry-bulb temperature versus wet-bulb temperature Cumulative percentage frequency of distribution tables *GERMANY ( WEST ) * WEST ...48.55 56 % WIND DI R. . I SPEED NIlE . ’ ’ [. .. . ssE .41 ,j .... .~I ° Ř -- _--- _. --- j---F7i- ___________,.__ .27 1N 2 .21 -41 s __ _ 2. 21 4...PERCENTAGE FREQUENCY OF OCCURRENCE 7 -4 IFROM HOURLY OBSERVATIONS) VI5I81UT, STATjTE MIkES "- - 4 -3 o _>i2p A’ r. -E 5 a- A . 1Z)nr r. F Fta . r. S.D S

  12. Santiago, four Decades and a Half from the University of East

    Directory of Open Access Journals (Sweden)

    Reynier Rodríguez-Pérez

    2016-02-01

    Full Text Available The text introduces the Taller Literario and the Revista de la Universidad de Oriente as direct antecedent of the Santiago magazine, in that sense it places the magazine in the center of an editorial process generated by the university after the addition to the institution of Nils Castro, a professor from Panama. The text also values the circumstances of the period were the Santiago magazine abandons it printed format and projects the way followed by the institution in the next years. In adittion, the review celebrates the role of the editor of scientific magazines in the communication of science and technological innovation results of universities.

  13. Thermal-hydraulic analyses of pressurized-thermal-shock-induced vessel ruptures

    International Nuclear Information System (INIS)

    Dobranich, D.

    1982-05-01

    A severe overcooling transient was postulated to produce vessel wall temperatures below the nil-ductility transition temperature which in conjunction with system repressurization, led to vessel rupture at the core midplane. Such transients are referred to as pressurized-thermal-shock transients. A wide range of vessel rupture sizes were investigated to assess the emergency system's ability to cool the fuel rods. Ruptures greater than approximately 0.015 m 2 produced flows greater than those of the emergency system and resulted in core uncovery and subsequent core damage

  14. Why Recruits Separate Early

    Science.gov (United States)

    1991-01-01

    our sample were reportedly unable to adjust to the military environment due to social or emotional immaturity. This problem was especially prevalent...Table 9. Table 9 REASONS FOR EARLY SEPARATION 1. Mental health. Phobias , suicide threats and attempts, emotional immaturity, and personality and...hliurfl’lutf t’ htrtiuug tht .’ plinittol piioL’m.9 evIn’ thfll I b’ r i’lli. vre’.Ilv ifao~ , ýI ll.tv ill it](- rv ’: 111nil tln1 (i~..󈧏 4 P A W4.11

  15. Nanomanipulation of 2 inch wafer fabrication of vertically aligned carbon nanotube arrays by nanoimprint lithography

    DEFF Research Database (Denmark)

    Bu, Ian Y. Y.; Eichhorn, Volkmar; Carlson, Kenneth

    2011-01-01

    Carbon nanotube (CNT) arrays are typically defined by electron beam lithography (EBL), and hence limited to small areas due to the low throughput. To obtain wafer‐scale fabrication we propose large area thermal nanoimprint lithography (NIL). A 2‐inch stamp master is defined using EBL for subsequent......, efficient production of wafer‐scale/larger arrays of CNTs has been achieved. The CNTs have been deposited by wafer‐scale plasma enhanced chemical vapour deposition (PECVD) of C2H2/NH3. Substrates containing such nanotubes have been used to automate nanorobotic manipulation sequences of individual CNTs...

  16. 40_245 - 250_Hussaini, A. Ahmad and S. Sani

    African Journals Online (AJOL)

    user pc

    Bajopas Volume 10 Number 2 December, 2017. Table 4: Conductivity measurement of the complex compounds. Complexes. Concentration moldm-3. Electrical conductivity ohm-1 cm-1. Molar conductivity ohm-1cm2 mol-1. [NiL2]. 2H2O. 1 x 10-3. 9.40x10-6. 94.0. [CuL2]. 2H2O. 1 x 10-3. 6.85x10-6. 68.5. Table 5: Infrared ...

  17. Scientific Opinion on the substantiation of a health claim related to fat-free yogurts and fermented milks with live yogurt cultures complying with the specifications ?fat free?, ?low in sugars?, ?high protein?, ?source of calcium? and ?source of vitamin D? for nutrition claims and maintenance of lean body mass in the context of an energy-restricted diet pursuant to Article 13.5 of Regulation (EC) No 1924/2006

    OpenAIRE

    EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA)

    2015-01-01

    Following an application from Federación Nacional de Industrias Lácteas (FeNIL), submitted pursuant to Article 13.5 of Regulation (EC) No 1924/2006 via the Competent Authority of Spain, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the scientific substantiation of a health claim related to fat-free yogurts and fermented milks with live yogurt cultures complying with the specifications “fat free”, “low in sugars”, “high protein”, “source of ca...

  18. Genetic dissection of black grain rice by the development of a near isogenic line

    OpenAIRE

    Maeda, Hiroaki; Yamaguchi, Takuya; Omoteno, Motoyasu; Takarada, Takeshi; Fujita, Kenji; Murata, Kazumasa; Iyama, Yukihide; Kojima, Yoichiro; Morikawa, Makiko; Ozaki, Hidenobu; Mukaino, Naoyuki; Kidani, Yoshinori; Ebitani, Takeshi

    2014-01-01

    Rice (Oryza sativa L.) can produce black grains as well as white. In black rice, the pericarp of the grain accumulates anthocyanin, which has antioxidant activity and is beneficial to human health. We developed a black rice introgression line in the genetic background of Oryza sativa L. ‘Koshihikari’, which is a leading variety in Japan. We used Oryza sativa L. ‘Hong Xie Nuo’ as the donor parent and backcrossed with ‘Koshihikari’ four times, resulting in a near isogenic line (NIL) for black g...

  19. Myocardial scintigraphy using pyrophosphate-technetium 99m. 367 cases

    Energy Technology Data Exchange (ETDEWEB)

    Degeorges, M; Roucayrol, J C; Sol, C; Comet, M; Vassilopoulos, J [Hopital Cochin, 75 - Paris (France)

    1977-04-30

    Pyrophosphate-sup(99m)Tc injected intravenously, is almost invariably fixed in the infarcted zone in transmural infarctions less than 8 days old. Fixation occurs in only 2/3 of cases of rudimentary infarction. The degree of fixation is more or less proportional to the size of the peak of creatine phosphokinase. After the 8th day following infarction, fixation is slight or nil. It is inconstant in pre-infarction syndrome or simple angina. This examination complements clinical, electrocardiographic and enzyme findings, in particular in the case of difficult diagnosis.

  20. 2419-IJBCS-Article-Mouhamadou Amadou Ly

    African Journals Online (AJOL)

    hp

    La présente étude a été menée pour évaluer les effets de l'incorporation de la farine de soja dans le régime alimentaire des juvéniles de la perche du Nil. Ce travail est réalisé sur des juvéniles de 1g élevés dans des aquariums de 50 l. Cinq régimes alimentaires isoprotéiques (45% de protéines) contenant différents taux ...

  1. Quantization of Green-Schwarz superstring

    International Nuclear Information System (INIS)

    Kallosh, R.E.

    1987-04-01

    The problem of quantization of superstrings is traced back to the nil-potency of gauge generators of the first-generation ghosts. The quantization of such theories is performed. The novel feature of this quantization is the freedom in choosing the number of ghost generations as well as gauge conditions. As an example, we perform quantization of heterotic string in a gauge, which preserves space-time supersymmetry. The equations of motion are those of a free theory. (author). 12 refs, 2 figs

  2. Returns to Schooling in Less Developed Countries: New Evidence from Zambia

    DEFF Research Database (Denmark)

    Nielsen, Helena Skyt; Westergård-Nielsen, Niels Chr.

    2001-01-01

    In our analysis of returns to schooling in Zambia, we look at the rural and urban population separately, and estimate the returns to schooling in each region based on a selection model in two stages. For urban areas we find that the returns to primary schooling are nil whereas the returns to scho...... to schooling beyond primary school are higher. For rural areas we find that the returns to primary schooling are positive and no different from the returns to education beyond primary school. Udgivelsesdato: JAN...

  3. Ecological-photosynthetic system for the treatment of swine wastewater in farm; Proceso ecologico-fotosintetico para la depuracion de purines en grajas

    Energy Technology Data Exchange (ETDEWEB)

    Duran Barrantes, M. M.; Alvarez Mateos, P.; Carta Escobar, F.; Romero guzman, F. [Universidad de Sevilla (Spain); Fiestas Ros de Ursinos, J. A. [Instituto de la Grasa. Sevilla (Spain)

    2000-07-01

    The Ecological-Photosynthetic System (Paten n. 8901368, C.S.I.C.) is a low cost process of operational simplicity; his only energetic source is solar radiation. It is based on the ecological development of different communities of microorganisms in order to avoid negative interactions between them, immobilized on clayey support. The present work went in pursuit of the study of an integral biological plant in a piggery farm, from October of 1993 to June of 1995. Its high purification performance and nil running costs make it ideal for treating waste water from small farms. (Author) 13 refs.

  4. Prostate Cancer Research Training in Health Disparities for Undergraduates (PCaRT)

    Science.gov (United States)

    2011-03-01

    PORTION SIZE EACH TIME NIL NO RARE OCCAS SIONS SOME TIMES OTHER DAY DAILY MANY TIMES Chicken , Hen Turkey / Roast Turkey Smoked Poultry Duck 1/16 1/8...pc Beef/Steak, Roast beef Lamb, Goat Pork, Pork chop, Ham Smoked pork Bush meat * # M1/M3/Pc, # Kp Pig feet, Cow leg, Skin...65 years Chicken Rarely Sometimes Frequently 3(2.8) 57 (52.3) 49 (45.0) 5 (6.7) 36 (48.0) 34 (45.3) 0 (0.0) 30 (55.6) 24 (44.4) Beef ** Rarely

  5. Why two local BRS algebras in bosonic string theory

    International Nuclear Information System (INIS)

    Bouda, A.

    1993-01-01

    This paper is the first of a set of two articles in which a local Becchi-Rouet-Stora (BRS) operator for string and superstring theories is constructed by using a new procedure in which the nil potency is automatically guaranteed. In this article, it is shown that in bosonic string theory, there are two different methods of dilating the ghost which give rise to two different local BRS algebras. The first method leads to well-known results, already obtained by another procedure. The second method has been applied previously by the author. (author). 8 refs

  6. G 2.4 + 1.4: a supernova remnant or ring nebula around a peculiar star

    International Nuclear Information System (INIS)

    Johnson, H.M.

    1975-01-01

    G2.4+1.4 is a probable nonthermal radio source and an optical nebula which appears to be a supernova remnant (SNR). It also contains an O vi sequence star of great excitation. We present new radiofrequency continuum and (nil) H 92α observations, optical spectroscopy, and Fabry-Perot scanner observations of the nebula. The object distance (5 kpc), origin of gas kinematics (SNR expansion), and mode of excitation of the gas (photoexcitation and/or shock wave) remain uncertain. We discuss the possible roles of the O vi star as ''runaway'' in a SNR, as a source of photoexcitation, and as an ejector of a ''counterfeit'' SNR

  7. Proceedings of the Triservice Corrosion of Military Equipment Conference (1974) held at Dayton, Ohio on 29-31 Oct 1974. Volume II. Sessions IV through VII

    Science.gov (United States)

    1975-09-01

    assumed the copper is ionised as the cuprous or cupric ion. This order of magnitude is in agreement with that rlet-, Ied in electrochemical investigations...solution containing 1. 0 molar Ammnonium Chloride, 0.Z5 molar Ammoniun Nitrate, 0. 01 molar Ammonium Tartrate , and 3 g/l Hydrogen Peroxide (10 ml of 30...annmmoniunm tartrate 3 g/l hydrogen peroxide (10 nil of 301 stock solution per liter) The solution has a pH of about 5. Z to 5.4, Note: If a stock solution of

  8. Antibodies against high frequency Gerbich 2 antigen (anti-Ge2: A real challenge in cross matching lab

    Directory of Open Access Journals (Sweden)

    Ravindra P Singh

    2013-01-01

    Full Text Available Transfusion management of patients′ alloimmunized against high-prevalence erythrocyte antigens is often problematic in emergency situations. Gerbich (Ge is very common blood group system and Gerbich-2 (Ge-2 antigen present in high frequency and outside Papua New Guinea population, Ge-2 negative population almost nil. To manage such kind of problems with real emergencies, implementation of rare donor registry program, cryopreservation of red cells of rare donors and biological cross matching to assess significance of these antibodies is warranted.

  9. From Clerks to Corpora: essays on the English language yesterday and today

    OpenAIRE

    Shaw, Philip; Erman, Britt; Melchers , Gunnel; Sundkvist , Peter

    2015-01-01

    Why is the Isle of Dogs in the Thames called Isle of Dogs? Did King Canute’s men bring English usage back to Jutland? How can we find out where English speakers suck their breath in to give a short response? And what did the Brontës do about dialect and think about foreign languages? The answers are in this collection of empirical work on English past and present in honour of Nils-Lennart Johannesson, Professor of English Language at Stockholm University. The first five chapters report indivi...

  10. Selection of test and reference areas for the Indian Deepsea Environment Experiment (INDEX)

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, R.; Nath, B.N.

    50 3 50 cm and Okean grabs with camera and a sampling area of 0.25m2were used at 12–13 locations,for collecting nodule and sediment samples (Figure 1). Nod-ule abundance was estimated by dividing the weight of nodules in the sampler by its area...,and number of peaks (. 10 m) between the digitized points (Table 2).Results Nodule Distribution in Different AreasArea T1. Of the 13 sampled locations,nodule abundance at two locations was nil,and rangedbetwen 0.25 and 7.42 kg/m 2in the remaining 11 locations...

  11. AM Broadcast Emergency Relay (AMBER)

    Science.gov (United States)

    1990-07-01

    TIFTON GA US FC-n 3 5000 1000 31.456 -83.561 231 4989 1430 WMNC MORGANTOWN NC US F--n 3 5000 1000 35.752 -81.717 232 5080 1440 KODL THE DALLES OR US FC-n...Loring, ME Cutter, ME Alt. CINCSAC Plattsburgh, NY March AFB, CA Barksdale, LA Pease, Nil CINCLANT Griffiss, NY Norfolk, VA Sy Johnson, NC Robbins, GA ...retransmission. This process is repeated at AM stations located on the A k 0. AA 0o. .... - ° o" : 331 s os 0,u . psi risk area .. 001 0 00 ga Haqua

  12. Method of instantaneous approximation of the atmospheric dispersion

    International Nuclear Information System (INIS)

    Doury, A.

    1983-12-01

    A basic primary modelling, very simple and compatible with all the existing models. The problem, the simplifying hypothesis being given, amounts to calculating a concentration chi determined by a fixed quantity Q released instantaneously in a quasi nil volume and uniformly distributed after the time t after the emission in a rectangular parallelepipedic volume. An atmospheric dilution coefficient and an atmospheric transfer coefficient are defined. From these elements, such defined, it is possible to establish of ''short term'' and ''long term'' transfer coefficients and also transfer coefficients ''in the atmosphere'' and to the ''ground''. They are presented in a tabular form [fr

  13. The mystery of Japan's missing centenarians explained

    Directory of Open Access Journals (Sweden)

    Yasuhiko Saito

    2012-03-01

    Full Text Available This report elucidates the issue of Japan's missing centenarians, which was uncovered in 2010. We provide the latest figures from verification efforts, discuss sources of centenarian information in Japan, examine possible causes, and evaluate the effect of the missing centenarians on official statistics. In Japan 234,354 people registered before 1910 remained on the family registers in 2010, without being crossed out. They would have been 100 years old at least and represent 0.5Š of the births recorded between 1872 and 1910. The impact of this group on life expectancy statistics, however, is effectively nil.

  14. Fracture mechanics analysis of reactor pressure vessel under pressurized thermal shock - The effect of elastic-plastic behavior and stainless steel cladding -

    International Nuclear Information System (INIS)

    Joo, Jae Hwang; Kang, Ki Ju; Jhung, Myung Jo

    2002-01-01

    Performed here is an assessment study for deterministic fracture mechanics analysis of a pressurized thermal shock (PTS). The PTS event means an event or transient in pressurized water reactors (PWRs) causing severe overcooling (thermal shock) concurrent with or followed by significant pressure in the reactor vessel. The problems consisting of two transients and 10 cracks are solved and maximum stress intensity factors and maximum allowable nil-ductility reference temperatures are calculated. Their results are compared each other to address the general characteristics between transients, crack types and analysis methods. The effects of elastic-plastic material behavior and clad coating on the inner surface are explored

  15. Proceedings of Patient Reported Outcome Measure?s (PROMs) Conference Sheffield 2016: advances in patient reported outcomes research

    OpenAIRE

    Croudace, Tim; Brazier, John; Gutacker, Nils; Street, Andrew; Robotham, Dan; Waterman, Samantha; Rose, Diana; Satkunanathan, Safarina; Wykes, Til; Nasr, Nasrin; Enderby, Pamela; Carlton, Jill; Rowen, Donna; Elliott, Jackie; Brazier, John

    2016-01-01

    Table of contents S1 Using computerized adaptive testing Tim Croudace S2 Well-being: what is it, how does it compare to health and what are the implications of using it to inform health policy John Brazier O1 “Am I going to get better?”—Using PROMs to inform patients about the likely benefit of surgery Nils Gutacker, Andrew Street O2 Identifying Patient Reported Outcome Measures for an electronic Personal Health Record Dan Robotham, Samantha Waterman, Diana Rose, Safarina Satkunanathan, Til W...

  16. Multilingual Aeronautical Dictionary (Dictionnaire Aeronautique Multilingue)

    Science.gov (United States)

    1980-01-01

    8217See ’aerofoil profile’ DE Bord’Boden-Funkverkehr (ili 20~ AGARD MULTILINGUAL AERONAUTICAL DICTIONARY 10318 air mileage indicator (AMI) ES comunicacion ...Autogenschweissen (nil ES sistema fml autom~tico de comunicacion NE automatische besturing ES soldadura MI autdgena aire-tierra P otooWatmtc FR soudage Wm autogene...AERONAUTICAL DICTIONARY DE Fernmeldesatellit [m) RU 1. maPXWbPOBK& ff1 OTcOKOB RU onPe~ene~me Wn Aesma84HN Komnaca ES satelite Wm do comunicaciones 2

  17. THE MANAGEMENT OF HUMAN RESOURCE DEVELOPMENT IN AR RAIHAN BANDAR LAMPUNG JUNIOR HIGH SCHOOL

    Directory of Open Access Journals (Sweden)

    Betti Nuraini

    2014-11-01

    Full Text Available This case study portrays the human resources development management in Junior High School Ar Raihan Bandar Lampung. It was designed into five stages, i.e. planning, designing (determining, collecting data, analyzing data, and drawing conclusion. The study found that (1 the selection process the teachers’, librarians’ and laboratory personnels’ recruitment was nil; (2 the recruitment gave priority only to teachers, counselors, and administrative staff;; (3 the employment of librarians and laboratory assistants becomes a second priority compared to teachers, counselors, and administrative staff; (5 the school gave an equal renumeration to the teachers and the education personnel; (6 the focus of human development was on teachers.

  18. Partial response to proton pump inhibitor therapy for GERD: observational study of patient characteristics, burden of disease, and costs in the USA

    OpenAIRE

    St?lhammar, Nils-Olov; Spiegel, Brennan M; Granstedt L?fman, Helena; Karlsson, Maria; Wahlqvist, Peter; N?sdal, J?rgen; Nelson, M Todd; Despi?gel, Nicolas

    2012-01-01

    Nils-Olov Stålhammar,1 Brennan M Spiegel,2,3 Helena Granstedt Löfman,1 Maria Karlsson,1 Peter Wahlqvist,1 Jørgen Næsdal,4 M Todd Nelson,5 Nicolas Despiégel61Payer Evidence, AstraZeneca R&D, Mölndal, Sweden; 2Department of Gastroenterology, VA Greater Los Angeles Healthcare System, 3David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 4Medical Department, AstraZeneca R&D, Mölndal, Sweden; 5Late Phase...

  19. Environmental Inventory Report. East St. Louis and Vicinity, Cahokia Canal Drainage Area, Madison and St. Clair Counties, Illinois. Volume 2.

    Science.gov (United States)

    1981-05-01

    81 C A THORNTON OACV378-C-0055 WI-CLASSIFIED NIL all1 3. 11112. liii112.0 IIIJIL251 11111. MICROCOPY RESOLUTION .1TEST CH!ART SAA099708 LVEL EAST ST...achieving the annual arithmetic mean standard. Source: Larsen, Ralph I., Ph.D., "A Mathematical Model for Relating Air Quality Measurements to Air Quality...compari- son of the mathematically simulated isopleth values produced from the Illinois EPA short term model discussed later on. Unless pollu- tant

  20. Microbiological analysis of water used in hydrotherapy

    Directory of Open Access Journals (Sweden)

    M. F. Perestrelo

    2006-01-01

    Full Text Available Water used in hydrotherapy units of Nova Iguaçu and Nilópolis, Rio de Janeiro State, Brazil, was microbiologically analyzed. Thirty samples (5ml each were weekly collected from September 2001 to June 2002 before the beginning and after the end of activities in the units. For analysis, routine techniques were used, which showed the presence of Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Klebsiella spp, Candida spp, Penicillium spp, Epidermophyton spp, Aspergillus fumigatus, Aspergillus niger, Aspergillus spp, Cephalosporium spp, Cladosporium spp, Trichophyton rubrum, and Trichophyton spp. Results indicated a need for improving hygienic conditions, suggesting that water might be a contamination source in the evaluated units.

  1. Fine Mapping of qroot-yield-1.06, a QTL for Root, Plant Vigor and Yield in Maize

    OpenAIRE

    Martinez Ascanio, Ana Karine

    2015-01-01

    Root-yield-1.06 is a major QTL affecting root system architecture (RSA) and other agronomic traits in maize. The effect of this QTL has been evaluated with the development of near isogenic lines (NILs) differing at the QTL position. The objective of this study was to fine map qroot-yield-1.06 by marker-assisted searching for chromosome recombinants in the QTL interval and concurrent root phenotyping in both controlled and field conditions, through successive generations. Complementary approac...

  2. ANTHOCYANIN PIGMENTATION IN TRITICUM AESTIVUM L.: GENETIC BASIS AND ROLE UNDER ABIOTIC STRESS CONDITIONS

    Directory of Open Access Journals (Sweden)

    Tereshchenko O.Yu.

    2012-08-01

    Full Text Available Anthocyanins are secondary metabolites of plants. They have a wide range of biological activity such as antioxidant, photoprotection, osmoregulation, heavy metal ions chelation, antimicrobial and antifungal activities, which help plants to survive under different stress conditions. Bread wheat (T. aestivum L. can have purple pigmentation provided by anthocyanin compounds in different organs, such as grain pericarp, coleoptile, culm, leaf blades, leaf sheaths, glumes and anthers. However, the genetic mechanisms underlying formation of these traits as well as contribution of the pigmentation to stress tolerance have not been widely studied in wheat. The aim of the current study was to investigate molecular-genetic mechanisms underlying anthocyanin pigmentation in different wheat organs and to estimate the role of the pigmentation under different abiotic stress conditions in wheat seedlings. In the current study, near-isogenic lines (NILs: cv. ‘Saratovskaya 29’ (‘S29’ and lines i:S29Pp1Pp2PF and i:S29Pp1Pp3P developed on the ‘S29’ background but having grain pericarp coloration (genes Pp and more intense coleoptile (Rc, culm (Pc, leaf blade (Plb, leaf sheath (Pls pigmentation in comparison with ‘S29’, were used. Comparative transcriptional analysis of the five structural genes Chs, Chi, F3h, Dfr, Ans, encoding enzymes participating in the anthocyanin biosynthesis, was performed in different organs of NILs. It was shown that the presence of the Rc, Pc, Plb, Pls and Pp alleles conferring strong anthocyanin pigmentation induced more intense transcription of the structural genes, suggesting the genes Rc, Pc, Plb, Pls and Pp to play a regulatory role in anthocyanin biosynthesis network. To evaluate the role of anthocyanins in stress response at the seedling stage, growth ability of the NILs and anthocyanin content in their coleoptiles were assessed after treatments with NaCl (100 and 200 mM, CdCl2 (25 and 50 μM and 15% PEG 6000

  3. Physically consistent diffusion in media with memory

    International Nuclear Information System (INIS)

    Caputo, M.

    1999-01-01

    In order to obtain a better representation of the flow and pressure of fluids in media, the law of D'Arcy was modified introducing instead of the pressure gradient its time derivative of fractional order z. However, the new law implies a filtering of the pressure gradient with response curves which are singular or nil at zero or infinite frequency. In this note the law of D'Arcy has been extended introducing a memory formalism operating on the flow as well as on the pressure gradient which implies a filtering of the pressure gradient without singularities; the properties of the filtering are also described

  4. Thermal expansion and phase transformations of nitrogen-expanded austenite studied with in situ synchrotron X-ray diffraction

    DEFF Research Database (Denmark)

    Brink, Bastian; Ståhl, Kenny; Christiansen, Thomas Lundin

    2014-01-01

    Nitrogen-expanded austenite, _N, with high and low nitrogen contents was produced from AISI 316 grade stainless steel powder by gaseous nitriding in ammonia/hydrogen gas mixtures. In situ synchrotron X-ray diffraction was applied to investigate the thermal expansion and thermal stability...... as a fitting parameter. The stacking fault density is constant for temperatures up to 680 K, whereafter it decreases to nil. Surprisingly, a transition phase with composition M4N (M = Fe, Cr, Ni, Mo) appears for temperatures above 770 K. The linear coefficient of thermal expansion depends on the nitrogen...

  5. Propuesta de fortalecimiento del Oratorio San Juan Bosco en el ámbito de le espiritualidad, en el Colegio Spellman Femenino durante el año 2007-2008

    OpenAIRE

    Zapata Jácome, Ligia.

    2007-01-01

    PARA LOGRAR ESTA PROPUESTA DE FORTALECIMIENTO EN EL 9MBITO DE LA ESPIRITUALIDAD , SE HA HECHO UNA INVESTIGACIóN DE LAS FUENTES Y ORíGENES DEL ORATORIO, CON SUS PRINCIPALES CARACTERíSTICAS Y RESPUESTAS SIGNIFICATIVAS QUE SE DEBEN DAR EN HOY. ¾NICIAMOS RECORDANDO QUE EN EL AlO 1841, ÐON BOSCO INICIó LA OBRA SALESIANA, FUNDANDO EL ORATORIO FESTIVO CON LOS NIlOS Y JóVENES M9S POBRES Y NECESITADOS. SIENDO LA PRINCIPAL RESPUESTA PASTORAL A LA NECESIDAD DE LOS JóVENES DE ESE TIEMPO, ...

  6. Nanoimprint lithography for microfluidics manufacturing

    Science.gov (United States)

    Kreindl, Gerald; Matthias, Thorsten

    2013-12-01

    The history of imprint technology as lithography method for pattern replication can be traced back to 1970's but the most significant progress has been made by the research group of S. Chou in the 1990's. Since then, it has become a popular technique with a rapidly growing interest from both research and industrial sides and a variety of new approaches have been proposed along the mainstream scientific advances. Nanoimprint lithography (NIL) is a novel method for the fabrication of micro/nanometer scale patterns with low cost, high throughput and high resolution. Unlike traditional optical lithographic approaches, which create pattern through the use of photons or electrons to modify the chemical and physical properties of the resist, NIL relies on direct mechanical deformation of the resist and can therefore achieve resolutions beyond the limitations set by light diffraction or beam scattering that are encountered in conventional lithographic techniques. The ability to fabricate structures from the micro- to the nanoscale with high precision in a wide variety of materials is of crucial importance to the advancement of micro- and nanotechnology and the biotech- sciences as a whole and will be discussed in this paper. Nanoimprinting can not only create resist patterns, as in lithography, but can also imprint functional device structures in various polymers, which can lead to a wide range of applications in electronics, photonics, data storage, and biotechnology.

  7. Test--retest variability of Randot stereoacuity measures gathered in an unselected sample of UK primary school children.

    Science.gov (United States)

    Adler, Paul; Scally, Andrew J; Barrett, Brendan T

    2012-05-01

    To determine the test-retest reliability of the Randot stereoacuity test when used as part of vision screening in schools. Randot stereoacuity (graded-circles) and logMAR visual acuity measures were gathered in an unselected sample of 139 children (aged 4-12, mean 8.1±2.1 years) in two schools. Randot testing was repeated on two occasions (average interval between successive tests 8 days, range: 1-21 days). Three Randot scores were obtained in 97.8% of children. Randot stereoacuity improved by an average of one plate (ie, one test level) on repeat testing but was little changed when tested on the third occasion. Within-subject variability was up to three test levels on repeat testing. When stereoacuity was categorised as 'fine', 'intermediate' or 'coarse', the greatest variability was found among younger children who exhibited 'intermediate' or 'coarse'/nil stereopsis on initial testing. Whereas 90.8% of children with 'fine' stereopsis (≤50 arc-seconds) on the first test exhibited 'fine' stereopsis on both subsequent tests, only ∼16% of children with 'intermediate' (>50 but ≤140 arc-seconds) or 'coarse'/nil (≥200 arc-seconds) stereoacuity on initial testing exhibited stable test results on repeat testing. Children exhibiting abnormal stereoacuity on initial testing are very likely to exhibit a normal result when retested. The value of a single, abnormal Randot graded-circles stereoacuity measure from school screening is therefore questionable.

  8. Simple and cost-effective fabrication of size-tunable zinc oxide architectures by multiple size reduction technique

    Directory of Open Access Journals (Sweden)

    Hyeong-Ho Park, Xin Zhang, Seon-Yong Hwang, Sang Hyun Jung, Semin Kang, Hyun-Beom Shin, Ho Kwan Kang, Hyung-Ho Park, Ross H Hill and Chul Ki Ko

    2012-01-01

    Full Text Available We present a simple size reduction technique for fabricating 400 nm zinc oxide (ZnO architectures using a silicon master containing only microscale architectures. In this approach, the overall fabrication, from the master to the molds and the final ZnO architectures, features cost-effective UV photolithography, instead of electron beam lithography or deep-UV photolithography. A photosensitive Zn-containing sol–gel precursor was used to imprint architectures by direct UV-assisted nanoimprint lithography (UV-NIL. The resulting Zn-containing architectures were then converted to ZnO architectures with reduced feature sizes by thermal annealing at 400 °C for 1 h. The imprinted and annealed ZnO architectures were also used as new masters for the size reduction technique. ZnO pillars of 400 nm diameter were obtained from a silicon master with pillars of 1000 nm diameter by simply repeating the size reduction technique. The photosensitivity and contrast of the Zn-containing precursor were measured as 6.5 J cm−2 and 16.5, respectively. Interesting complex ZnO patterns, with both microscale pillars and nanoscale holes, were demonstrated by the combination of dose-controlled UV exposure and a two-step UV-NIL.

  9. Coupling ultraviolet light and ultrasound irradiation with Conductive-Diamond Electrochemical Oxidation for the removal of progesterone

    International Nuclear Information System (INIS)

    Vidales, María J. Martín de; Barba, Silvia; Sáez, Cristina; Cañizares, Pablo; Rodrigo, Manuel A.

    2014-01-01

    Highlights: • Single sonolysis and photolysis technologies entail a slight progesterone removal and nil mineralization. • Synergistic effects of irradiating UV light and US are clearly observed in the oxidation rate. • The energy required by CDSEO and CDSPEO prevents against their application. • CDSEO mainly favors the mass transfer of organics to the conductive-diamond surface. • CDPEO promotes the formation of radicals in the bulk solution. - Abstract: This work focusses on the improvement of the efficiency of Conductive Diamond Electrochemical Oxidation (CDEO) by coupling US and UV irradiation in the degradation of progesterone from wastewater. Results show that CDEO is a promising technology for the degradation of progesterone, just the opposite of that observed for single sonolysis and photolysis technologies, which only entail a slight removal of progesterone and nil mineralization. Coupling UV light and US irradiations with CDEO seems to have a very positive effect, improving results obtained by single CDEO very significantly. Conductive Diamond Sono Electrochemical Oxidation (CDSEO) mainly seems to improve the transfer of pollutants to the conductive-diamond surface, while Conductive Diamond Photo Electrochemical Oxidation (CDPEO) seems to promote the formation of radicals from oxidants produced electrochemically. Soft oxidation conditions are obtained with the single application of both irradiation technologies, whereas an efficient mineralization is attained with CDEO, CDSEO, CDPEO and Conductive Diamond Sono-Photo Electrochemical Oxidation (CDSPEO). However, the high energy demands of US irradiation technologies advices against the use of CDSEO and CDSPEO

  10. Accelerated Generation of Selfed Pure Line Plants for Gene Identification and Crop Breeding

    Directory of Open Access Journals (Sweden)

    Guijun Yan

    2017-10-01

    Full Text Available Production of pure lines is an important step in biological studies and breeding of many crop plants. The major types of pure lines for biological studies and breeding include doubled haploid (DH lines, recombinant inbred lines (RILs, and near isogenic lines (NILs. DH lines can be produced through microspore and megaspore culture followed by chromosome doubling while RILs and NILs can be produced through introgressions or repeated selfing of hybrids. DH approach was developed as a quicker method than conventional method to produce pure lines. However, its drawbacks of genotype-dependency and only a single chance of recombination limited its wider application. A recently developed fast generation cycling system (FGCS achieved similar times to those of DH for the production of selfed pure lines but is more versatile as it is much less genotype-dependent than DH technology and does not restrict recombination to a single event. The advantages and disadvantages of the technologies and their produced pure line populations for different purposes of biological research and breeding are discussed. The development of a concept of complete in vitro meiosis and mitosis system is also proposed. This could integrate with the recently developed technologies of single cell genomic sequencing and genome wide selection, leading to a complete laboratory based pre-breeding scheme.

  11. Oxytocin and prolactin release after hypertonic saline administration in melatonin-treated male Syrian hamsters

    Energy Technology Data Exchange (ETDEWEB)

    Juszczak, M.; Steger, R.W.; Fadden, C.; Bartke, A. [Southern Illinois Univ., Carbondale, IL (United States)

    1996-12-31

    The aim of the present investigations was to examine the effects of melatonin (Mel) on oxytocin (OT) release under conditions of osmotic stimulation, brought about by hypertonic saline administration, as well as to determine whether osmotically stimulated OT release in Mel-treated Syrian hamster is associated with alterations in the release of prolactin (PRL) and in norepinephrine (NE) and dopamine (DA) content in the hypothalamus. In both Mel- and vehicle-treated hamsters, injection of hypertonic saline was followed by a significant decrease in OT content in the pituitary neurointermediate lobe (NIL) and elevation of plasma OT and PRL levels. Melatonin injections had no significant affect on NIL OT content in either isotonic- or hypertonic-saline treated animals. Pretreatment with Mel did not alter plasma OT or PRL levels in isotonic saline-injected animals. However, Mel facilitated the release of OT, but prevented the release of PRL after hypertonic saline administration. Melatonin treatment reduced hypothalamic NE content (but not that of DA) in isotonic-saline treated animals. After osmotic stimulation, hypothalamic content of NE and DA was significantly lower in Mel-treated than in vehicle-treated animals. Data from the present study suggest that the osmotically-stimulated release of OT and PRL seems to be related to the activation of noradrenergic rather than dopaminergic transmission. Both dopaminergic and noradrenergic transmission may be, however, involved in mediating the effects of Mel on the osmotically-activated OT and PRL release. (author). 48 refs, 3 figs.

  12. Direct fabrication of integrated 3D Au nanobox arrays by sidewall deposition with controllable heights and thicknesses

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Nam-Goo; Lee, Bong Kuk; Kanki, Teruo; Lee, Hea Yeon; Kawai, Tomoji; Tanaka, Hidekazu, E-mail: h-tanaka@sanken.osaka-u.ac.j [Institute of Scientific and Industrial Research, Osaka University, 8-1 Mihogaoka, Ibaraki, Osaka 567-0047 (Japan)

    2009-09-30

    This paper provides a unique strategy for controlling integrated hollow nanostructure arrays such as boxes or pillars at the nanometer scale. The key merit of this technique is that it can overcome resolution limits by sidewall deposition and deposit various materials using a sputtering method. The sputtering method can be replaced by other dry deposition techniques such as pulsed laser deposition (PLD) for complex functional materials. Furthermore, it can produce low-cost large-area fabrication and high reproducibility using the NIL (nanoimprint lithograph) process. The fabrication method consists of a sequence of bilayer spin-coating, UV-NIL, RIE (reactive ion etching), sputtering, ion milling and piranha cleaning processes. By changing the deposition time and molds, various thicknesses and shapes can be fabricated, respectively. Furthermore, the fabricated Au box nanostructure has a bending zone of the top layer and a {approx}17 nm undercut of the bottom layer as observed by SEM (scanning electron microscope). The sidewall thickness was changed from 12 to 61 nm by controlling the deposition time, and was investigated to understand the relationship with blanket thicknesses and geometric effects. The calculated sidewall thickness matched well with experimental results. Using smaller hole-patterned molds, integrated nanobox arrays, with inner squares measuring {approx}160 nm, and nanopillar arrays, with inside pores measuring {approx}65 nm, were fabricated under the same conditions.

  13. Safety highlights of UP2 reprocessing in La Hague

    International Nuclear Information System (INIS)

    Marc, A.; Dubois, G.

    1998-01-01

    The UP2-800 reprocessing plant basically implements the same proven process (PUREX) as UP3 plant. However, some evolutions and additions have been realised: - to reprocess high burn up and MOX fuel assemblies; - to dissolve scraps from reprocessing facilities or from the fabrication of MOX fuels such as UO 2 - PuO 2 powders; - to recover plutonium from ash resulting from alpha waste incineration prior to ash conditioning; - to reduce solid waste alpha activity below the regulatory limits for shallow land disposal. Safety considerations relating to these functions have been taken into account in each step of process design. Safety design rules have been implemented for the UP2-800 plant with the same goals as for the UP3 plant: - keeping the discharge of radioactive liquids and gas within the annual limits authorized under normal operating conditions; - reducing the personnel exposure to a minimum so that 'the number of operators whose integrated dose over a year exceeds 5 mSv be nil or practically nil under normal operating conditions'; - preventing the accidental situations and having at one's disposal the dysfunction monitoring and detection systems and the means to limit their consequences. Particular risks prevention related to the UP2-800 specific functions are described in this paper. (author)

  14. Thermo-curable epoxy systems for nanoimprint lithography

    International Nuclear Information System (INIS)

    Wu, Chun-Chang; Hsu, Steve Lien-Chung

    2010-01-01

    In this work, we have used solvent-free thermo-curable epoxy systems for low-pressure and moderate-temperature nanoimprint lithography (NIL). The curing kinetic parameters and conversion of diglycidyl ether of bisphenol A (DGEBA) resin with different ambient-cure 930 and 954 hardeners were studied by the isothermal DSC technique. They are useful for the study of epoxy resins in the imprinting application. The DGEBA/930 and DGEBA/954 epoxy resists can be imprinted to obtain high-density nano- and micro-scale patterns on a flexible indium tin oxide/poly(ethylene terephthalate) (ITO/PET) substrate. The DGEBA/930 epoxy resin is not only suitable for resist material, but also for plastic mold material. Highly dense nanometer patterns can be successfully imprinted using a UV-curable resist from the DGEBA/930 epoxy mold. Using the replicated DGEBA/930 epoxy mold instead of the expensive master can prevent brittle failure of the silicon molds in the NIL

  15. Fabrication of nano-electrode arrays of free-standing carbon nanotubes on nano-patterned substrate by imprint method

    Energy Technology Data Exchange (ETDEWEB)

    Chang, W.S., E-mail: paul@kimm.re.kr [Department of Nano Mechanics, Korea Institute of Machinery and Materials, 104 Sinseongno, Yuseong-gu Daejeon 305-343 (Korea, Republic of); Kim, J.W. [Gyeongbuk Hybrid Technology Institute, 36 Goeyeon-dong, Yeongcheon, Gyeongbuk 770-170 (Korea, Republic of); Choi, D.G. [Department of Nano Mechanics, Korea Institute of Machinery and Materials, 104 Sinseongno, Yuseong-gu Daejeon 305-343 (Korea, Republic of); Han, C.S. [Gyeongbuk Hybrid Technology Institute, 36 Goeyeon-dong, Yeongcheon, Gyeongbuk 770-170 (Korea, Republic of)

    2011-01-15

    The synthesis of isolated carbon nanotubes with uniform outer diameters and ordered spacing over wafer-scale areas was investigated for fabrication of nano-electrode arrays on silicon wafers for field emission and sensor devices. Multi-walled carbon nanotubes (MWCNTs) were grown on TiN electrode layer with iron catalyst patterned by nano-imprint lithography (NIL), which allows the precise placement of individual CNTs on a substrate. The proposed techniques, including plasma-enhanced chemical vapor deposition (PECVD) and NIL, are simple, inexpensive, and reproducible methods for fabrication of nano-scale devices in large areas. The catalyst patterns were defined by an array of circles with 200 nm in diameter, and variable lengths of pitch. The nano-patterned master and Fe catalyst were observed with good pattern fidelity over a large area by atomic force microscope (AFM) and scanning electron microscopy (SEM). Nano-electrodes of MWCNTs had diameters ranging from 50 nm to 100 nm and lengths of about 300 nm. Field emission tests showed the reducing ignition voltage as the geometry of nanotube arrays was controlled by catalyst patterning. These results showed a wafer-scale approach to the control of the size, pitch, and position of nano-electrodes of nanotubes for various applications including electron field-emission sources, electrochemical probes, functionalized sensor elements, and so on.

  16. Physico-chemical studies of effluents and emission of ghee/edible oil industries in Pakistan

    International Nuclear Information System (INIS)

    Ahmed, I.; Ali, S.; Jan, M.R.

    1999-01-01

    Samples of the effluents from various Ghee/Edible Oil Industries were collected on fortnightly basis from July 1993 to June 1994 and the emissions from January to April 1994. Parameters such as temperature, pH, conductivity, total dissolved solids (TDS), total suspended solids (TSS), total alkalinity total acidity, total hardness, chemical oxygen demand (COD). chlorides, sulphates, phosphates, silica, calcium magnesium, sodium, and iron were determined in the effluents, Trace metals like copper, manganese, nickel, and zinc were determined by atomic absorption spectroscopy, whereas SO/sub 2/, CO CO/sub 2/, hydrocarbons, hydrogen, nitrogen, oxygen and argon were examined in the flue gases by Gas Chromatography and other standard techniques such as Orsat Gas Analyzer and Dragger Detection Tubes. Remedial measures were suggested for the pollutants exceeding the National Environmental Quality Standards, (NEQS). Parameters like chlorine, ammonia, sulphides, arsenic, cadmium, chromium, cobalt, lead and tin were also analyzed in the effluents and were found to be nil or below the detection limit, while particulate matters, HCl, chlorine, HF, H/sub 2/S, mercaptans and NH/sub 3/ were found to be nil in the flue gases. (author)

  17. Teorias econômicas marxistas e a Grande Recessão

    Directory of Open Access Journals (Sweden)

    ALEX WILHANS ANTONIO PALLUDETO

    Full Text Available RESUMO O presente artigo dedica-se ao exame de algumas das principais interpretações de inspiração marxista acerca da Grande Recessão que se apresentam publicadas sob a forma de livros. Do amplo conjunto de publicações sobre o tema, as seguintes obras foram analisadas: The Great Financial Crisis, de John Bellamy Foster e Fred Magdoff (2009; The Enigma of Capital, de David Harvey (2011, publicada originalmente em 2010; The Crisis of Neoliberalism, de Gérard Duménil e Dominique Lévy (2011; e The Failure of Capitalist Production, de Andrew Kliman (2012. Argumenta-se que o debate marxista em torno das causas últimas da Grande Recessão pode ser sistematizado a partir da seguinte clivagem: 1 de um lado, os autores que atribuem a turbulência à forma política/econômica/institucional específica assumida pelo sistema capitalista ao longo das últimas décadas; 2 de outro, aqueles que interpretam a crise recente como uma manifestação própria da dinâmica capitalista em geral - e não do modo particular que esta supostamente apresenta. Enquanto Foster e Magdoff (2009, Harvey (2011 e Duménil e Lévy (2011 compõem o primeiro grupo, Kliman (2012 pode ser visto como representante da segunda vertente.

  18. Molecular tagging of the Bph1 locus for resistance to brown planthopper (Nilaparvata lugens Stål) through representational difference analysis.

    Science.gov (United States)

    Park, Dong-Soo; Song, Min-Young; Park, Soo-Kwon; Lee, Sang-Kyu; Lee, Jong-Hee; Song, Song-Yi; Eun, Moo Young; Hahn, Tae-Ryong; Sohn, Jae-Keun; Yi, Gihwan; Nam, Min-Hee; Jeon, Jong-Seong

    2008-08-01

    During brown planthopper (BPH) feeding on rice plants, we employed a modified representational difference analysis (RDA) method to detect rare transcripts among those differentially expressed in SNBC61, a BPH resistant near-isogenic line (NIL) carrying the Bph1 resistance gene. This identified 3 RDA clones: OsBphi237, OsBphi252 and OsBphi262. DNA gel-blot analysis revealed that the loci of the RDA clones in SNBC61 corresponded to the alleles of the BPH resistant donor Samgangbyeo. Expression analysis indicated that the RDA genes were up-regulated in SNBC61 during BPH feeding. Interestingly, analysis of 64 SNBC NILs, derived from backcrosses of Samgangbyeo with a BPH susceptible Nagdongbyeo, using a cleaved amplified polymorphic sequence (CAPS) marker indicated that OsBphi252, which encodes a putative lipoxygenase (LOX), co-segregates with BPH resistance. Our results suggest that OsBphi252 is tightly linked to Bph1, and may be useful in marker-assisted selection (MAS) for resistance to BPH.

  19. The identification of candidate rice genes that confer resistance to the brown planthopper (Nilaparvata lugens) through representational difference analysis.

    Science.gov (United States)

    Park, Dong-Soo; Lee, Sang-Kyu; Lee, Jong-Hee; Song, Min-Young; Song, Song-Yi; Kwak, Do-Yeon; Yeo, Un-Sang; Jeon, Nam-Soo; Park, Soo-Kwon; Yi, Gihwan; Song, You-Chun; Nam, Min-Hee; Ku, Yeon-Chung; Jeon, Jong-Seong

    2007-08-01

    The development of rice varieties (Oryza sativa L.) that are resistant to the brown planthopper (BPH; Nilaparvata lugens Stål) is an important objective in current breeding programs. In this study, we generated 132 BC(5)F(5) near-isogenic rice lines (NILs) by five backcrosses of Samgangbyeo, a BPH resistant indica variety carrying the Bph1 locus, with Nagdongbyeo, a BPH susceptible japonica variety. To identify genes that confer BPH resistance, we employed representational difference analysis (RDA) to detect transcripts that were exclusively expressed in one of our BPH resistant NIL, SNBC61, during insect feeding. The chromosomal mapping of the RDA clones that we subsequently isolated revealed that they are located in close proximity either to known quantitative trait loci or to an introgressed SSR marker from the BPH resistant donor parent Samgangbyeo. Genomic DNA gel-blot analysis further revealed that loci of all RDA clones in SNBC61 correspond to the alleles of Samgangbyeo. Most of the RDA clones were found to be exclusively expressed in SNBC61 and could be assigned to functional groups involved in plant defense. These RDA clones therefore represent candidate defense genes for BPH resistance.

  20. Simple and cost-effective fabrication of size-tunable zinc oxide architectures by multiple size reduction technique

    International Nuclear Information System (INIS)

    Park, Hyeong-Ho; Hwang, Seon-Yong; Jung, Sang Hyun; Kang, Semin; Shin, Hyun-Beom; Kang, Ho Kwan; Ko, Chul Ki; Zhang Xin; Hill, Ross H; Park, Hyung-Ho

    2012-01-01

    We present a simple size reduction technique for fabricating 400 nm zinc oxide (ZnO) architectures using a silicon master containing only microscale architectures. In this approach, the overall fabrication, from the master to the molds and the final ZnO architectures, features cost-effective UV photolithography, instead of electron beam lithography or deep-UV photolithography. A photosensitive Zn-containing sol–gel precursor was used to imprint architectures by direct UV-assisted nanoimprint lithography (UV-NIL). The resulting Zn-containing architectures were then converted to ZnO architectures with reduced feature sizes by thermal annealing at 400 °C for 1 h. The imprinted and annealed ZnO architectures were also used as new masters for the size reduction technique. ZnO pillars of 400 nm diameter were obtained from a silicon master with pillars of 1000 nm diameter by simply repeating the size reduction technique. The photosensitivity and contrast of the Zn-containing precursor were measured as 6.5 J cm −2 and 16.5, respectively. Interesting complex ZnO patterns, with both microscale pillars and nanoscale holes, were demonstrated by the combination of dose-controlled UV exposure and a two-step UV-NIL.

  1. Design and Preparation of a Micro-Pyramid Structured Thin Film for Broadband Infrared Antireflection

    Directory of Open Access Journals (Sweden)

    Shaobo Ge

    2018-05-01

    Full Text Available A micro-pyramid structured thin film with a broad-band infrared antireflection property is designed and fabricated by using the single-point diamond turning (SPDT technique and combined with nano-imprint lithography (NIL. A structure with dimensions of 10 μm pitch and 5 μm height is transferred from the copper mold to the silicon nitride optical film by using NIL and proportional inductively-coupled plasma (ICP etching. Reflectance of the micro-optical surface is reduced below 1.0% over the infrared spectral range (800–2500 nm. A finite-difference-time-domain (FDTD analysis indicates that this micro-structure can localize photons and enhance the absorption inside the micro-pyramid at long wavelengths. As described above, the micro-pyramid array has been integrated in an optical film successfully. Distinguishing from the traditional micro-optical components, considering the effect of refraction and diffraction, it is a valuable and flexible method to take account of the interference effect of optical film.

  2. Interactions of nickel(II) with histones. Stability and solution structure of complexes with CH3CO-Cys-Ala-Ile-His-NH2, a putative metal binding sequence of histone H3.

    Science.gov (United States)

    Bal, W; Lukszo, J; Jezowska-Bojczuk, M; Kasprzak, K S

    1995-01-01

    Nickel(II) compounds are established human carcinogens, but the molecular mechanisms underlying their activity are only partially known. One mechanism may include mediation by nickel of promutagenic oxidative DNA damage that depends on Ni(II) binding to chromatin. To characterize such binding at the histone moiety of chromatin, we synthesized the peptide CH3CO-Cys-Ala-Ile-His-NH2 (L), a model of the evolutionarily conserved motif in histone H3 with expected affinity for transition metals, and evaluated its reactivity toward Ni(II). Combined spectroscopic (UV/vis, CD, NMR) and potentiometric measurements showed that, at physiological pH, mixtures of Ni(II) and L yielded unusual macrochelate complexes, NiL and NiL2, in which the metal cation was bound through Cys and His side chains in a square-planar arrangement. Above pH 9, a NiH-3L complex was formed, structurally analogous to typical square-planar nickel complexes. These complexes are expected to catalyze oxidation reactions, and therefore, coordination of Ni(II) by the L motif in core histone H3 may be a key event in oxidative DNA base damage observed in the process of Ni(II)-induced carcinogenesis.

  3. Recombination suppression at the dominant Rhg1/Rfs2 locus underlying soybean resistance to the cyst nematode.

    Science.gov (United States)

    Afzal, Ahmed J; Srour, Ali; Saini, Navinder; Hemmati, Naghmeh; El Shemy, Hany A; Lightfoot, David A

    2012-04-01

    Host resistance to "yellow dwarf" or "moonlight" disease cause by any population (Hg type) of Heterodera glycines I., the soybean cyst nematode (SCN), requires a functional allele at rhg1. The host resistance encoded appears to mimic an apoptotic response in the giant cells formed at the nematode feeding site about 24-48 h after nematode feeding commences. Little is known about how the host response to infection is mediated but a linked set of 3 genes has been identified within the rhg1 locus. This study aimed to identify the role of the genes within the locus that includes a receptor-like kinase (RLK), a laccase and an ion antiporter. Used were near isogeneic lines (NILs) that contrasted at their rhg1 alleles, gene-based markers, and a new Hg type 0 and new recombination events. A syntenic gene cluster on Lg B1 was found. The effectiveness of SNP probes from the RLK for distinguishing homolog sequence variants on LgB1 from alleles at the rhg1 locus on LgG was shown. The resistant allele of the rhg1 locus was shown to be dominant in NILs. None of the recombination events were within the cluster of the three candidate genes. Finally, rhg1 was shown to reduce the plant root development. A model for rhg1 as a dominant multi-gene resistance locus based on the developmental control was inferred.

  4. Hydrogenation of CO 2 in Water Using a Bis(diphosphine) Ni–H Complex

    Energy Technology Data Exchange (ETDEWEB)

    Burgess, Samantha A. [Catalysis; Kendall, Alexander J. [Department; Tyler, David R. [Department; Linehan, John C. [Catalysis; Appel, Aaron M. [Catalysis

    2017-03-17

    The water soluble Ni bis(diphosphine) complex [NiL2](BF4)2 (L = 1,2- bis(di(methoxypropyl)phosphino)ethane) and the corresponding hydride, [HNiL2]BF4, were synthesized and characterized. For HNiL2+, the hydricity was determined to be 23.2(3) kcal/mol in aqueous solution. Based on the hydricity of formate of 24.1 kcal/mol, the transfer of a hydride from HNiL2 + to CO2 to produce formate is favorable by 1 kcal/mol. Starting from either NiL2 2+ or HNiL2 + in water, catalytic hydrogenation of CO2 was observed with NaHCO3 (0.8 M) as the only additive. A maximum turnover frequency of 3.6(8) h–1 was observed at 80 °C and 51 atm of a 1:1 mixture of CO2 and H2.

  5. Effects of polymer surface energy on morphology and properties of silver nanowire fabricated via nanoimprint and E-beam evaporation

    Science.gov (United States)

    Zhao, Zhi-Jun; Hwang, Soon Hyoung; Jeon, Sohee; Jung, Joo-Yun; Lee, Jihye; Choi, Dae-Geun; Choi, Jun-Hyuk; Park, Sang-Hu; Jeong, Jun-Ho

    2017-10-01

    In this paper, we demonstrate that use of different nanoimprint resins as a polymer pattern has a significant effect on the morphology of silver (Ag) nanowires deposited via an E-beam evaporator. RM-311 and Ormo-stamp resins are chosen as a polymer pattern to form a line with dimensions of width (100 nm) × space (100 nm) × height (120 nm) by using nanoimprint lithography (NIL). Their contact angles are then measured to evaluate their surface energies. In order to compare the properties of the Ag nanowires deposited on the various polymer patterns with different surface energies, hydrophobic surface treatment of the polymer pattern surface is implemented using self-assembled monolayers. In addition, gold and aluminum nanowires are fabricated for comparison with the Ag nanowires, with the differences in the nanowire morphologies being determined by the different atomic properties. The monocrystalline and polycrystalline structures of the various Ag nanowire formations are observed using transmission electron microscopy. In addition, the melting temperatures and optical properties of four kinds of Ag nanowire morphologies deposited on various polymer patterns are evaluated using a hot plate and an ultraviolet-visible (UV-vis) spectrometer, respectively. The results indicate that the morphology of the Ag nanowire determines the melting temperature and the transmission. We believe that these findings will greatly aid the development of NIL, along with physical evaporation and chemical deposition techniques, and will be widely employed in optics, biology, and surface wettability applications.

  6. Oxytocin and prolactin release after hypertonic saline administration in melatonin-treated male Syrian hamsters

    International Nuclear Information System (INIS)

    Juszczak, M.; Steger, R.W.; Fadden, C.; Bartke, A.

    1996-01-01

    The aim of the present investigations was to examine the effects of melatonin (Mel) on oxytocin (OT) release under conditions of osmotic stimulation, brought about by hypertonic saline administration, as well as to determine whether osmotically stimulated OT release in Mel-treated Syrian hamster is associated with alterations in the release of prolactin (PRL) and in norepinephrine (NE) and dopamine (DA) content in the hypothalamus. In both Mel- and vehicle-treated hamsters, injection of hypertonic saline was followed by a significant decrease in OT content in the pituitary neurointermediate lobe (NIL) and elevation of plasma OT and PRL levels. Melatonin injections had no significant affect on NIL OT content in either isotonic- or hypertonic-saline treated animals. Pretreatment with Mel did not alter plasma OT or PRL levels in isotonic saline-injected animals. However, Mel facilitated the release of OT, but prevented the release of PRL after hypertonic saline administration. Melatonin treatment reduced hypothalamic NE content (but not that of DA) in isotonic-saline treated animals. After osmotic stimulation, hypothalamic content of NE and DA was significantly lower in Mel-treated than in vehicle-treated animals. Data from the present study suggest that the osmotically-stimulated release of OT and PRL seems to be related to the activation of noradrenergic rather than dopaminergic transmission. Both dopaminergic and noradrenergic transmission may be, however, involved in mediating the effects of Mel on the osmotically-activated OT and PRL release. (author). 48 refs, 3 figs

  7. Atomistic simulation of nanoformed metallic glass

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Cheng-Da, E-mail: nanowu@cycu.edu.tw

    2015-07-15

    Highlights: • STZ forms at substrate surface underneath punch. • Atoms underneath punch have higher speeds at larger mold displacement. • Stick-slip phenomenon becomes more obvious with increasing imprint speed. • Great pattern transfer is obtained with unloading at low temperatures. - Abstract: The effects of forming speed and temperature on the forming mechanism and mechanics of Cu{sub 50}Zr{sub 25}Ti{sub 25} metallic glass are studied using molecular dynamics simulations based on the second-moment approximation of the many-body tight-binding potential. These effects are investigated in terms of atomic trajectories, flow field, slip vectors, internal energy, radial distribution function, and elastic recovery of nanoimprint lithography (NIL) patterns. The simulation results show that a shear transformation zone (STZ) forms at the substrate surface underneath the mold during the forming process. The STZ area increases with mold displacement (D). The movement speed of substrate atoms underneath the mold increases with increasing D value. The movement directions of substrate atoms underneath the mold are more agreeable for a larger D value. The stick-slip phenomenon becomes more obvious with increasing D value and imprint speed. The substrate energy increases with increasing imprint speed and temperature. Great NIL pattern transfer is obtained with unloading at low temperatures (e.g., room temperature)

  8. Lack of chemically induced mutation in repair-deficient mutants of yeast

    International Nuclear Information System (INIS)

    Prakash, L.

    1974-01-01

    Two genes, rad6 and rad9, that confer radiation sensitivity in the yeast Saccharomyces cerevisiae also greatly reduce the frequency of chemically-induced reversions of a tester mutant cyc1-131, which is a chain initiation mutant in the structural gene determining iso-1-cytochrome c. Mutations induced by ethyl methanesulfonate (EMS), diethyl sulfate (DES), methyl methanesulfonate (MMS), dimethyl sulfate (DMS), nitroquinoline oxide (NQO), nitrosoguanidine (NTG), nitrogen mustard (HN2), β-propiolactone, and tritiated uridine, as well as mutations induced by ultraviolet light (UV) and ionizing radiation were greatly diminished in strains homozygous for either the rad6 or rad9 gene. Nitrous acid and nitrosoimidazolidone (NIL), on the other hand, were highly mutagenic in these repair-deficient mutants, and at low doses, these mutagens acted with about the same efficiency as in the normal RAD strain. At high doses of either nitrous acid or NIL, however, reversion frequencies were significantly reduced in the two rad mutants compared to normal strains. Although both rad mutants are immutable to about the same extent, the rad9 strains tend to be less sensitive to the lethal effect of chemical mutagens than rad6 strains. It is concluded that yeast requires a functional repair system for mutation induction by chemical agents. (auth)

  9. Lack of chemically induced mutation in repair-deficient mutants of yeast.

    Science.gov (United States)

    Prakash, L

    1974-12-01

    Two genes, rad6 and rad9, that confer radiation sensitivity in the yeast Saccharomyces cerevisiae also greatly reduce the frequency of chemically-induced reversions of a tester mutant cyc1-131, which is a chain initiation mutant in the structural gene determining iso-1-cytochrome c. Mutations induced by ethyl methanesulfonate (EMS), diethyl sulfate (DES), methyl methanesulfonate (MMS), dimethyl sulfate (DMS), nitroquinoline oxide (NQO), nitrosoguanidine (NTG), nitrogen mustard (HN2), beta-propiolactone, and tritiated uridine, as well as mutations induced by ultraviolet light (UV) and ionizing radiation were greatly diminished in strains homozygous for either the rad6 or rad9 gene. Nitrous acid and nitrosoimidazolidone (NIL), on the other hand, were highly mutagenic in these repair-deficient mutants, and at low doses, these mutagens acted with about the same efficiency as in the normal RAD strain. At high doses of either nitrous acid or NIL, however, reversion frequencies were significantly reduced in the two rad mutants compared to normal strains. Although both rad mutants are immutable to about the same extent, the rad9 strains tend to be less sensitive to the lethal effect of chemical mutagens than rad6 strains. It is concluded that yeast requires a functional repair system for mutation induction by chemical agents.

  10. Efficient low bandgap polymer solar cell with ordered heterojunction defined by nanoimprint lithography.

    Science.gov (United States)

    Yang, Yi; Mielczarek, Kamil; Zakhidov, Anvar; Hu, Walter

    2014-11-12

    In this work, we demonstrate the feasibility of using nanoimprint lithography (NIL) to make efficient low bandgap polymer solar cells with well-ordered heterojunction. High quality low bandgap conjugated polymer poly[2,6-(4,4-bis(2-ethylhexyl)-4H-cyclopenta[2,1-b;3,4-b']-dithiophene)-alt-4,7-(2,1,3-benzothiadiazole)] (PCPDTBT) nanogratings are fabricated using this technique for the first time. The geometry effect of PCPDTBT nanostructures on the solar cell performance is investigated by making PCPDTBT/C70 solar cells with different feature sizes of PCPDTBT nanogratings. It is found that the power conversion efficiency (PCE) increases with increasing nanograting height, PCPDTBT/C70 junction area, and decreasing nanograting width. We also find that NIL makes PCPDTBT chains interact more strongly and form an improved structural ordering. Solar cells made on the highest aspect ratio PCPDTBT nanostructures are among the best reported devices using the same material with a PCE of 5.5%.

  11. An interim report on shallow-flaw fracture technology development

    International Nuclear Information System (INIS)

    Pennell, W.E.; Bass, B.R.; Bryson, J.W.; McAfee, W.J.

    1995-01-01

    Shallow-flaw fracture technology is being developed for application to the safety assessment of radiation-embrittled nuclear reactor pressure vessels (RPVS) containing flaws. Fracture mechanics tests on RPV steel, coupled with detailed elastic-plastic finite-element analyses of the crack-tip stress fields, have shown that (1) constraint relaxation at the crack tip of shallow surface flaws results in increased data scatter but no increase in the lower-bound fracture toughness, (2) the nil ductility temperature (NDT) performs better than the reference temperature for nil ductility transition (RT NDT ) as a normalizing parameter for shallow-flaw fracture toughness data, (3) biaxial loading can reduce the shallow-flaw fracture toughness, (4) stress-based dual-parameter fracture toughness correlations cannot predict the effect of biaxial loading on shallow-flaw fracture toughness because in-plane stresses at the crack tip are not influenced by biaxial loading, and (5) a strain-based dual-parameter fracture toughness correlation can predict the effect of biaxial loading on shallow-flaw fracture toughness

  12. Constrained State Estimation for Individual Localization in Wireless Body Sensor Networks

    Directory of Open Access Journals (Sweden)

    Xiaoxue Feng

    2014-11-01

    Full Text Available Wireless body sensor networks based on ultra-wideband radio have recently received much research attention due to its wide applications in health-care, security, sports and entertainment. Accurate localization is a fundamental problem to realize the development of effective location-aware applications above. In this paper the problem of constrained state estimation for individual localization in wireless body sensor networks is addressed. Priori knowledge about geometry among the on-body nodes as additional constraint is incorporated into the traditional filtering system. The analytical expression of state estimation with linear constraint to exploit the additional information is derived. Furthermore, for nonlinear constraint, first-order and second-order linearizations via Taylor series expansion are proposed to transform the nonlinear constraint to the linear case. Examples between the first-order and second-order nonlinear constrained filters based on interacting multiple model extended kalman filter (IMM-EKF show that the second-order solution for higher order nonlinearity as present in this paper outperforms the first-order solution, and constrained IMM-EKF obtains superior estimation than IMM-EKF without constraint. Another brownian motion individual localization example also illustrates the effectiveness of constrained nonlinear iterative least square (NILS, which gets better filtering performance than NILS without constraint.

  13. Constrained State Estimation for Individual Localization in Wireless Body Sensor Networks

    Science.gov (United States)

    Feng, Xiaoxue; Snoussi, Hichem; Liang, Yan; Jiao, Lianmeng

    2014-01-01

    Wireless body sensor networks based on ultra-wideband radio have recently received much research attention due to its wide applications in health-care, security, sports and entertainment. Accurate localization is a fundamental problem to realize the development of effective location-aware applications above. In this paper the problem of constrained state estimation for individual localization in wireless body sensor networks is addressed. Priori knowledge about geometry among the on-body nodes as additional constraint is incorporated into the traditional filtering system. The analytical expression of state estimation with linear constraint to exploit the additional information is derived. Furthermore, for nonlinear constraint, first-order and second-order linearizations via Taylor series expansion are proposed to transform the nonlinear constraint to the linear case. Examples between the first-order and second-order nonlinear constrained filters based on interacting multiple model extended kalman filter (IMM-EKF) show that the second-order solution for higher order nonlinearity as present in this paper outperforms the first-order solution, and constrained IMM-EKF obtains superior estimation than IMM-EKF without constraint. Another brownian motion individual localization example also illustrates the effectiveness of constrained nonlinear iterative least square (NILS), which gets better filtering performance than NILS without constraint. PMID:25390408

  14. [Nickel levels in female dermatological patients].

    Science.gov (United States)

    Schwegler, U; Twardella, D; Fedorov, M; Darsow, U; Schaller, K-H; Habernegg, R; Behrendt, H; Fromme, H

    2009-07-01

    Nickel levels in urine were determined among 163 female dermatological patients aged 18 to 46 years. Data on life-style factors were collected in parallel via a questionnaire. Urinary nickel excretion was in the normal range of the German female population (0.2-46.1 microg Ni/g creatinine). The 95th percentile (3.9 microg Ni/l urine) exceeded the German reference value (3.0 microg Ni/l urine). In the multivariate regression analyses we found a statistically significant increase of ln-transformed nickel levels with increase in age and in women using dietary supplements. The following variables were not associated with Nickel urine levels: suffering from nickel eczema, smoking, drinking stagnated water, eating foods with high nickel contents and using nickel-containing kitchen utensils as, for example, an electric kettle with an open heater coil. We conclude that personal urinary levels should be assessed with simultaneous consideration of habits and life-style factors. A German national survery would be useful. Those patients who experience the exacerbation of their eczema in cases of oral provocation, for example, by a high nickel diet should be aware of potential sources of nickel, such as supplements.

  15. Reactor pressure vessel structural integrity research

    International Nuclear Information System (INIS)

    Pennell, W.E.; Corwin, W.R.

    1994-01-01

    Development continues on the technology used to assess the safety of irradiation-embrittled nuclear reactor pressure vessels (RPVs) containing flaws. Fracture mechanics tests on RPV steel, coupled with detailed elastic-plastic finite-element analyses of the crack-tip stress fields, have shown that (1) constraint relaxation at the crack tip of shallow surface flaws results in increased data scatter but no increase in the lower-bound fracture toughness, (2) the nil ductility temperature (NDT) performs better than the reference temperature for nil ductility transition (RT NDT ) as a normalizing parameter for shallow-flaw fracture toughness data, (3) biaxial loading can reduce the shallow-flaw fracture toughness, (4) stress-based dual-parameter fracture toughness correlations cannot predict the effect of biaxial loading on shallow-flaw fracture toughness because in-plane stresses at the crack tip are not influenced by biaxial loading, and (5) an implicit strain-based dual-parameter fracture toughness correlation can predict the effect of biaxial loading on shallow-flaw fracture toughness. Experimental irradiation investigations have shown that (1) the irradiation-induced shift in Charpy V-notch vs temperature behavior may not be adequate to conservatively assess fracture toughness shifts due to embrittlement, and (2) the wide global variations of initial chemistry and fracture properties of a nominally uniform material within a pressure vessel may confound accurate integrity assessments that require baseline properties

  16. Effects of extremely low frequency electromagnetic fields on liver enzymes in Guinea pig

    International Nuclear Information System (INIS)

    Zare, S.; Hayatgeiby, H.; Alivandy Farkhad, S.; Tagizadeh, A.

    2007-01-01

    Electromagnetic field has various effects on living organisms such as blood composition or enzymatic changes. The effects depend on the electromagnetic intensity and the time of exposure. This study has been carried out to measure the variations of liver enzymes SGOT and SGPT Levels in 36 adult male, Guinea Pigs, that have been divided into 6 groups. Group A, as the control, exposed to nil electromagnetic field for two hours per day for 5 days. Group B, exposed to 0.013 micro T in 5 Hz for the same period. Group C, exposed to 0.207 micro T in 50 Hz in the similar condition. Group D, exposed for' four hours per day for 5 days in 0.013 micro T in 5Hz. Group E, tested in 0.207 micro T in 50 Hz as the group D. Group F, used as the controlled group exposed for four hours per day in nil electromagnetic field. Blood of the Guinea pigs were analysed after 5 days. The results have shown significant differences among different groups, regarding the SCOT and SGPT when compared with those of the controlled group. Statistically, they are meaningful when measured by Dunnett test indicating a significant difference between the controlled group and the tested group, soas the SGOT and SGPT have decreased in both cases

  17. Crystal structure, DNA binding, cleavage, antioxidant and antibacterial studies of Cu(II), Ni(II) and Co(III) complexes with 2-((furan-2-yl)methylimino)methyl)-6-ethoxyphenol Schiff base

    Science.gov (United States)

    Venkateswarlu, Kadtala; Kumar, Marri Pradeep; Rambabu, Aveli; Vamsikrishna, Narendrula; Daravath, Sreenu; Rangan, Krishnan; Shivaraj

    2018-05-01

    Three novel binary metal complexes; 1 [Cu(L)2], 2 [Ni(L)2] and 3 [Co(L)3] where, L (2-(((furan-2-yl) methylimino)methyl)-6-ethoxyphenol, C14H15NO3), were synthesized and characterized by various spectral techniques. Based on spectral studies square planar geometry is assigned for Cu(II) and Ni(II) complexes, whereas Co(III) owned octahedral geometry. Ligand, [Cu(L)2] and [Ni(L)2] are crystallized and found to be monoclinic crystal systems. CT-DNA absorption binding studies revealed that the complexes show good binding propensity (Kb = 5.02 × 103 M-1, 2.77 × 103 M-1, 1.63 × 104 M-1 for 1, 2 and 3 respectively). The role of these complexes in the oxidative and photolytic cleavage of supercoiled pBR322 DNA was studied and found that the complexes cleave the pBR322 DNA effectively. The catalytic ability of 1, 2 and 3 follows the order: 3 > 1 >2. Antioxidant studies of the new complexes revealed that they exhibit significant antioxidant activity against DPPH radical. The Schiff base and its metal complexes have been screened for antibacterial studies by Minimum Inhibitory Concentration method. It is observed that all metal complexes showed more activity than free ligand.

  18. Identification and Characterization of Quantitative Trait Loci for Shattering in Japonica Rice Landrace Jiucaiqing from Taihu Lake Valley, China

    Directory of Open Access Journals (Sweden)

    Jinping Cheng

    2016-11-01

    Full Text Available Easy shattering reduces yield from grain loss during rice ( L. harvest. We characterized a nonshattering rice landrace Jiucaiqing from Taihu Lake valley in China. The breaking tensile strength (BTS; grams force, gf of the grain pedicel was measured using a digital force gauge to evaluate the degree of shattering at 0, 7, 14, 21, 28, and 35 d after heading (DAH. The BTS of Jiucaiqing did not significantly decrease with increasing DAH, maintaining a level of 152.2 to 195.9 gf, while that of IR26 decreased greatly during 0 to 14 DAH and finally stabilized at ∼100 gf. Then the chromosome segment substitution lines (CSSLs and near isogenic lines (NILs of Jiucaiqing in IR26 background were developed for quantitative trait loci (QTL mapping. Four putative QTL (, , , and for shattering were detected, and the was confirmed on chromosome 1. We further mapped to a 98.4-kb region, which contains 14 genes. Os01g62920 was considered to be a strong candidate for , which colocated with . Further quantitative real-time polymerase chain reaction (PCR analyses confirmed that the QTL can significantly decrease the expression of shattering related genes (, , , , and especially at the middle development stage at 10 and 15 cm panicle length, which causes rice shattering decrease. The elite allele and the NIL with desirable agronomic traits identified in this study could be useful for rice breeding.

  19. Fabrication of high-brightness GaN-based light-emitting diodes via thermal nanoimprinting of ZnO-nanoparticle-dispersed resin

    International Nuclear Information System (INIS)

    Byeon, Kyeong-Jae; Cho, Joong-Yeon; Jo, Han-Byeol; Lee, Heon

    2015-01-01

    Highlights: • A various high-refractive-index ZnO patterns were formed on LED using imprinting. • Mechanism of light extraction enhancement was demonstrated by simulation and EL. • Light output power of patterned LED was improved up 19.6% by light waveguide effect. - Abstract: We fabricated high-brightness GaN-based light-emitting diodes (LEDs) with highly refractive patterned structures by using a thermal nanoimprint lithography (NIL). A highly refractive ZnO-nanoparticle-dispersed resin (ZNDR) was used in NIL, and a submicron hole, a submicron high-aspect-ratio pillar, and microconvex arrays were fabricated on the indium tin oxide (ITO) top electrode of GaN-based LED devices. We analyzed the light extraction mechanism for each of the three types of patterns by using a finite element method simulation, and found that the high-aspect-ratio pillar had a great ability to improve light extraction owing to its waveguide effect and prominent scattering effect. As a result, the light output power, which was measured in an integrating sphere, of the LED device was enhanced by up to 19.6% when the high-aspect-ratio pillar array was formed on the top ITO electrode of the device. Further, the electrical properties of none of the patterned LED devices fabricated using ZNDR degraded in comparison to those of bare LED devices

  20. Constrained state estimation for individual localization in wireless body sensor networks.

    Science.gov (United States)

    Feng, Xiaoxue; Snoussi, Hichem; Liang, Yan; Jiao, Lianmeng

    2014-11-10

    Wireless body sensor networks based on ultra-wideband radio have recently received much research attention due to its wide applications in health-care, security, sports and entertainment. Accurate localization is a fundamental problem to realize the development of effective location-aware applications above. In this paper the problem of constrained state estimation for individual localization in wireless body sensor networks is addressed. Priori knowledge about geometry among the on-body nodes as additional constraint is incorporated into the traditional filtering system. The analytical expression of state estimation with linear constraint to exploit the additional information is derived. Furthermore, for nonlinear constraint, first-order and second-order linearizations via Taylor series expansion are proposed to transform the nonlinear constraint to the linear case. Examples between the first-order and second-order nonlinear constrained filters based on interacting multiple model extended kalman filter (IMM-EKF) show that the second-order solution for higher order nonlinearity as present in this paper outperforms the first-order solution, and constrained IMM-EKF obtains superior estimation than IMM-EKF without constraint. Another brownian motion individual localization example also illustrates the effectiveness of constrained nonlinear iterative least square (NILS), which gets better filtering performance than NILS without constraint.

  1. Fabrication of sub-wavelength photonic structures by nanoimprint lithography

    Energy Technology Data Exchange (ETDEWEB)

    Kontio, J.

    2013-11-01

    Nanoimprint lithography (NIL) is a novel but already a mature lithography technique. In this thesis it is applied to the fabrication of nanophotonic devices using its main advantage: the fast production of sub-micron features in high volume in a cost-effective way. In this thesis, fabrication methods for conical metal structures for plasmonic applications and sub-wavelength grating based broad-band mirrors are presented. Conical metal structures, nanocones, with plasmonic properties are interesting because they enable concentrating the energy of light in very tight spots resulting in very high local intensities of electromagnetic energy. The nanocone formation process is studied with several metals. Enhanced second harmonic generation using gold nanocones is presented. Bridged-nanocones are used to enhance Raman scattering from a dye solution. The sub-wavelength grating mirror is an interesting structure for photonics because it is very simple to fabricate and its reflectivity can be extended to the far infrared wavelength range. It also has polarization dependent properties which are used in this thesis to stabilize the output beam of infrared semiconductor disk laser. NIL is shown to be useful a technique in the fabrication of nanophotonic devices in the novel and rapidly growing field of plasmonics and also in more traditional, but still developing, semiconductor laser applications (orig.)

  2. Pre-procedural fasting for coronary interventions: is it time to change practice?

    Science.gov (United States)

    Hamid, Tahir; Aleem, Qaiser; Lau, Yeecheng; Singh, Ravi; McDonald, John; Macdonald, John E; Sastry, Sanjay; Arya, Sanjay; Bainbridge, Anthony; Mudawi, Telal; Balachandran, Kanarath

    2014-04-01

    Traditionally, patients are kept nil-per-os/nil-by-mouth (NPO/NBM) prior to invasive cardiac procedures, yet there exists neither evidence nor clear guidance about the benefits of this practice. To demonstrate that percutaneous cardiac catheterisation does not require prior fasting. The data source is a retrospective analysis of data registry of consecutive patients who underwent percutaneous coronary intervention (PCI) for acute coronary syndrome (ACS) and stable angina at two district general hospitals in the UK with no on-site cardiac surgery services. A total of 1916 PCI procedures were performed over a 3-year period. None of the patients were kept NPO/NBM prior to their coronary procedures. The mean age was 67±16 years. 1349 (70%) were men; 38.5% (738/1916) had chronic stable angina, while the rest had ACS. 21% (398/1916) were diabetics while 53% (1017/1916) were hypertensive. PCI was technically successful in 95% (1821/1916) patients. 88.5% (1697/1916) had transradial approach. 77% (570/738) of elective PCI patients were discharged within 6 h postprocedure. No patients required emergency endotracheal intubation and there were no occurrences of intraprocedural or postprocedural aspiration pneumonia. Our observational study demonstrates that patients undergoing PCI do not need to be fasted prior to their procedures.

  3. Composition and functional analysis of low-molecular-weight glutenin alleles with Aroona near-isogenic lines of bread wheat

    Directory of Open Access Journals (Sweden)

    Zhang Xiaofei

    2012-12-01

    Full Text Available Abstract Background Low-molecular-weight glutenin subunits (LMW-GS strongly influence the bread-making quality of bread wheat. These proteins are encoded by a multi-gene family located at the Glu-A3, Glu-B3 and Glu-D3 loci on the short arms of homoeologous group 1 chromosomes, and show high allelic variation. To characterize the genetic and protein compositions of LMW-GS alleles, we investigated 16 Aroona near-isogenic lines (NILs using SDS-PAGE, 2D-PAGE and the LMW-GS gene marker system. Moreover, the composition of glutenin macro-polymers, dough properties and pan bread quality parameters were determined for functional analysis of LMW-GS alleles in the NILs. Results Using the LMW-GS gene marker system, 14–20 LMW-GS genes were identified in individual NILs. At the Glu-A3 locus, two m-type and 2–4 i-type genes were identified and their allelic variants showed high polymorphisms in length and nucleotide sequences. The Glu-A3d allele possessed three active genes, the highest number among Glu-A3 alleles. At the Glu-B3 locus, 2–3 m-type and 1–3 s-type genes were identified from individual NILs. Based on the different compositions of s-type genes, Glu-B3 alleles were divided into two groups, one containing Glu-B3a, B3b, B3f and B3g, and the other comprising Glu-B3c, B3d, B3h and B3i. Eight conserved genes were identified among Glu-D3 alleles, except for Glu-D3f. The protein products of the unique active genes in each NIL were detected using protein electrophoresis. Among Glu-3 alleles, the Glu-A3e genotype without i-type LMW-GS performed worst in almost all quality properties. Glu-B3b, B3g and B3i showed better quality parameters than the other Glu-B3 alleles, whereas the Glu-B3c allele containing s-type genes with low expression levels had an inferior effect on bread-making quality. Due to the conserved genes at Glu-D3 locus, Glu-D3 alleles showed no significant differences in effects on all quality parameters. Conclusions This work

  4. The human volatilome: volatile organic compounds (VOCs) in exhaled breath, skin emanations, urine, feces and saliva.

    Science.gov (United States)

    Amann, Anton; Costello, Ben de Lacy; Miekisch, Wolfram; Schubert, Jochen; Buszewski, Bogusław; Pleil, Joachim; Ratcliffe, Norman; Risby, Terence

    2014-09-01

    Breath analysis is a young field of research with its roots in antiquity. Antoine Lavoisier discovered carbon dioxide in exhaled breath during the period 1777-1783, Wilhelm (Vilém) Petters discovered acetone in breath in 1857 and Johannes Müller reported the first quantitative measurements of acetone in 1898. A recent review reported 1765 volatile compounds appearing in exhaled breath, skin emanations, urine, saliva, human breast milk, blood and feces. For a large number of compounds, real-time analysis of exhaled breath or skin emanations has been performed, e.g., during exertion of effort on a stationary bicycle or during sleep. Volatile compounds in exhaled breath, which record historical exposure, are called the 'exposome'. Changes in biogenic volatile organic compound concentrations can be used to mirror metabolic or (patho)physiological processes in the whole body or blood concentrations of drugs (e.g. propofol) in clinical settings-even during artificial ventilation or during surgery. Also compounds released by bacterial strains like Pseudomonas aeruginosa or Streptococcus pneumonia could be very interesting. Methyl methacrylate (CAS 80-62-6), for example, was observed in the headspace of Streptococcus pneumonia in concentrations up to 1420 ppb. Fecal volatiles have been implicated in differentiating certain infectious bowel diseases such as Clostridium difficile, Campylobacter, Salmonella and Cholera. They have also been used to differentiate other non-infectious conditions such as irritable bowel syndrome and inflammatory bowel disease. In addition, alterations in urine volatiles have been used to detect urinary tract infections, bladder, prostate and other cancers. Peroxidation of lipids and other biomolecules by reactive oxygen species produce volatile compounds like ethane and 1-pentane. Noninvasive detection and therapeutic monitoring of oxidative stress would be highly desirable in autoimmunological, neurological, inflammatory diseases and cancer

  5. Time series analysis of temporal networks

    Science.gov (United States)

    Sikdar, Sandipan; Ganguly, Niloy; Mukherjee, Animesh

    2016-01-01

    "Temporal Network Theory and Applications", edited by Petter Holme.

  6. Gross and fine motor function in fibromyalgia and chronic fatigue syndrome

    Directory of Open Access Journals (Sweden)

    Rasouli O

    2017-02-01

    Full Text Available Omid Rasouli,1,2 Egil A Fors,3 Petter Chr Borchgrevink,4,5 Fredrik Öhberg,6 Ann-Katrin Stensdotter1 1Department of Neuromedicine and Movement Science, Faculty of Medicine and Health Sciences, Norwegian University of Science and Technology, Trondheim, Norway; 2Department of Public Health and Nursing, Faculty of Medicine and Health Sciences, Norwegian University of Science and Technology, Trondheim, Norway; 3Department of Public Health and Nursing, General Practice Research Unit, Norwegian University of Science and Technology, Trondheim, Norway; 4Department of Circulation and Medical Imaging, Pain and Palliation Research Group, Faculty of Medicine and Health Sciences, Norwegian University of Science and Technology, Trondheim, Norway; 5National Competence Centre for Complex Symptom Disorders, St. Olav’s University Hospital, Trondheim, Norway; 6Department of Radiation Sciences, Biomedical Engineering, Umeå University, Umeå, Sweden Purpose: This paper aimed to investigate motor proficiency in fine and gross motor function, with a focus on reaction time (RT and movement skill, in patients with fibromyalgia (FM and chronic fatigue syndrome (CFS compared to healthy controls (HC.Methods: A total of 60 individuals (20 CFS, 20 FM, and 20 HC, age 19–49 years, participated in this study. Gross motor function in the lower extremity was assessed using a RT task during gait initiation in response to an auditory trigger. Fine motor function in the upper extremity was measured during a precision task (the Purdue Pegboard test where the number of pins inserted within 30 s was counted.Results: No significant differences were found between FM and CFS in any parameters. FM and CFS groups had significantly longer RT than HC in the gait initiation (p=0.001, and p=0.004 respectively. In the Purdue Pegboard test, 20% in the FM group, 15% in the CFS groups, and 0% of HC group, scored below the threshold of the accepted performance. However, there were no

  7. Water uptake by biomass burning aerosol at sub- and supersaturated conditions: closure studies and implications for the role of organics

    Directory of Open Access Journals (Sweden)

    U. Dusek

    2011-09-01

    Full Text Available We investigate the CCN activity of freshly emitted biomass burning particles and their hygroscopic growth at a relative humidity (RH of 85%. The particles were produced in the Mainz combustion laboratory by controlled burning of various wood types. The water uptake at sub- and supersaturations is parameterized by the hygroscopicity parameter, κ (c.f. Petters and Kreidenweis, 2007. For the wood burns, κ is low, generally around 0.06. The main emphasis of this study is a comparison of κ derived from measurements at sub- and supersaturated conditions (κG and κCCN, in order to see whether the water uptake at 85% RH can predict the CCN properties of the biomass burning particles. Differences in κGand κCCN can arise through solution non-idealities, the presence of slightly soluble or surface active compounds, or non-spherical particle shape. We find that κG and κCCN agree within experimental uncertainties (of around 30% for particle sizes of 100 and 150 nm; only for 50 nm particles is κCCN larger than κG by a factor of 2. The magnitude of this difference and its dependence on particle size is consistent with the presence of surface active organic compounds. These compounds mainly facilitate the CCN activation of small particles, which form the most concentrated solution droplets at the point of activation. The 50 nm particles, however, are only activated at supersaturations higher than 1% and are therefore of minor importance as CCN in ambient clouds. By comparison with the actual chemical composition of the biomass burning particles, we estimate that the hygroscopicity of the water-soluble organic carbon (WSOC fraction can be represented by a κWSOC value of approximately 0.2. The effective hygroscopicity of a typical wood burning particle can therefore be represented by a linear mixture of an inorganic component with κ ≅ 0.6, a WSOC

  8. Use of QuantiFERON®-TB Gold in-tube culture supernatants for measurement of antibody responses.

    Directory of Open Access Journals (Sweden)

    Simon G Kimuda

    Full Text Available QuantiFERON®-TB Gold in-tube (QFT-GIT supernatants may be important samples for use in assessment of anti-tuberculosis (TB antibodies when only limited volumes of blood can be collected and when a combination of antibody and cytokine measurements are required. These analytes, when used together, may also have the potential to differentiate active pulmonary TB (APTB from latent TB infection (LTBI. However, few studies have explored the use of QFT-GIT supernatants for investigations of antibody responses. This study determined the correlation and agreement between anti-CFP-10 and anti-ESAT-6 antibody concentrations in QFT-GIT nil supernatant and serum pairs from 68 TB household contacts. We also explored the ability of Mycobacterium tuberculosis (M.tb specific antibodies, or ratios of antibody to interferon gamma (IFN-γ in QFT-GIT supernatants, to differentiate 97 APTB cases from 58 individuals with LTBI. Sputum smear microscopy was used to define APTB, whereas the QFT-GIT and tuberculin skin test were used to define LTBI. There were strong and statistically significant correlations between anti-CFP-10 and anti-ESAT-6 antibodies in unstimulated QFT-GIT supernatants and sera (r = 0.89; p<0.0001 for both, and no significant differences in antibody concentration between them. Anti-CFP-10 & anti-ESAT-6 antibodies differentiated APTB from LTBI with sensitivities of 88.7% & 71.1% and specificities of 41.4% & 51.7% respectively. Anti-CFP-10 antibody/M.tb specific IFN-γ and anti-ESAT-6 antibody/M.tb specific IFN-γ ratios had sensitivities of 48.5% & 54.6% and specificities of 89.7% and 75.9% respectively. We conclude that QFT-GIT nil supernatants may be used in the place of sera when measuring antibody responses, reducing blood volumes needed for such investigations. Antibodies in QFT-GIT nil supernatants on their own discriminate APTB from LTBI with high sensitivity but have poor specificity, whereas the reverse is true when antibodies are used in

  9. Genetic Basis of Variation in Rice Seed Storage Protein (Albumin, Globulin, Prolamin, and Glutelin) Content Revealed by Genome-Wide Association Analysis.

    Science.gov (United States)

    Chen, Pingli; Shen, Zhikang; Ming, Luchang; Li, Yibo; Dan, Wenhan; Lou, Guangming; Peng, Bo; Wu, Bian; Li, Yanhua; Zhao, Da; Gao, Guanjun; Zhang, Qinglu; Xiao, Jinghua; Li, Xianghua; Wang, Gongwei; He, Yuqing

    2018-01-01

    Rice seed storage protein (SSP) is an important source of nutrition and energy. Understanding the genetic basis of SSP content and mining favorable alleles that control it will be helpful for breeding new improved cultivars. An association analysis for SSP content was performed to identify underlying genes using 527 diverse Oryza sativa accessions grown in two environments. We identified more than 107 associations for five different traits, including the contents of albumin (Alb), globulin (Glo), prolamin (Pro), glutelin (Glu), and total SSP (Total). A total of 28 associations were located at previously reported QTLs or intervals. A lead SNP sf0709447538, associated for Glu content in the indica subpopulation in 2015, was further validated in near isogenic lines NIL(Zhenshan97) and NIL(Delong208), and the Glu phenotype had significantly difference between two NILs. The association region could be target for map-based cloning of the candidate genes. There were 13 associations in regions close to grain-quality-related genes; five lead single nucleotide polymorphisms (SNPs) were located less than 20 kb upstream from grain-quality-related genes ( PG5a , Wx , AGPS2a , RP6 , and, RM1 ). Several starch-metabolism-related genes ( AGPS2a , OsACS6 , PUL , GBSSII , and ISA2 ) were also associated with SSP content. We identified favorable alleles of functional candidate genes, such as RP6 , RM1 , Wx , and other four candidate genes by haplotype analysis and expression pattern. Genotypes of RP6 and RM1 with higher Pro were not identified in japonica and exhibited much higher expression levels in indica group. The lead SNP sf0601764762, repeatedly detected for Alb content in 2 years in the whole association population, was located in the Wx locus that controls the synthesis of amylose. And Alb content was significantly and negatively correlated with amylose content and the level of 2.3 kb Wx pre-mRNA examined in this study. The associations or candidate genes identified would

  10. Upper mantle beneath foothills of the western Himalaya: subducted lithospheric slab or a keel of the Indian shield?

    Science.gov (United States)

    Vinnik, L.; Singh, A.; Kiselev, S.; Kumar, M. Ravi

    2007-12-01

    The fate of the mantle lithosphere of the Indian Plate in the India-Eurasia collision zone is not well understood. Tomographic studies reveal high P velocity in the uppermost mantle to the south of the western Himalaya, and these high velocities are sometimes interpreted as an image of subducting Indian lithosphere. We suggest that these high velocities are unrelated to the ongoing subduction but correspond to a near-horizontal mantle keel of the Indian shield. In the south of the Indian shield upper-mantle velocities are anomalously low, and relatively high velocities may signify a recovery of the normal shield structure in the north. Our analysis is based on the recordings of seismograph station NIL in the foothills of the western Himalaya. The T component of the P receiver functions is weak relative to the Q component, which is indicative of a subhorizontally layered structure. Joint inversion of the P and S receiver functions favours high uppermost mantle velocities, typical of the lithosphere of Archean cratons. The arrival of the Ps converted phase from 410 km discontinuity at NIL is 2.2 s earlier than in IASP91 global model. This can be an effect of remnants of Tethys subduction in the mantle transition zone and of high velocities in the keel of the Indian shield. Joint inversion of SKS particle motions and P receiver functions reveals a change in the fast direction of seismic azimuthal anisotropy from 60° at 80-160 km depths to 150° at 160-220 km. The fast direction in the lower layer is parallel to the trend of the Himalaya. The change of deformation regimes at a depth of 160 km suggests that this is the base of the lithosphere of the Indian shield. A similar boundary was found with similar techniques in central Europe and the Tien Shan region, but the base of the lithosphere in these regions is relatively shallow, in agreement with the higher upper-mantle temperatures. The ongoing continental collision is expressed in crustal structure: the crust

  11. Short-term contributions of cover crop surface residue return to soil carbon and nitrogen contents in temperate Australia.

    Science.gov (United States)

    Zhou, Xiaoqi; Wu, Hanwen; Li, Guangdi; Chen, Chengrong

    2016-11-01

    Cover crop species are usually grown to control weeds. After cover crop harvest, crop residue is applied on the ground to improve soil fertility and crop productivity. Little information is available about quantifying the contributions of cover crop application to soil total carbon (C) and nitrogen (N) contents in temperate Australia. Here, we selected eight cover crop treatments, including two legume crops (vetch and field pea), four non-legume crops (rye, wheat, Saia oat, and Indian mustard), a mixture of rye and vetch, and a nil-crop control in temperate Australia to calculate the contributions of cover crops (crop growth + residue decomposition) to soil C and N contents. Cover crops were sown in May 2009 (autumn). After harvest, the crop residue was placed on the soil surface in October 2009. Soil and crop samples were collected in October 2009 after harvest and in May 2010 after 8 months of residue decomposition. We examined cover crop residue biomass, soil and crop total C and N contents, and soil microbial biomass C and N contents. The results showed that cover crop application increased the mean soil total C by 187-253 kg ha -1 and the mean soil total N by 16.3-19.1 kg ha -1 relative to the nil-crop treatment, except for the mixture treatment, which had similar total C and N contents to the nil-crop control. Cover crop application increased the mean soil microbial biomass C by 15.5-20.9 kg ha -1 and the mean soil microbial biomass N by 4.5-10.2 kg ha -1 . We calculated the apparent percentage of soil total C derived from cover crop residue C losses and found that legume crops accounted for 10.6-13.9 %, whereas non-legume crops accounted for 16.4-18.4 % except for the mixture treatment (0.2 %). Overall, short-term cover crop application increased soil total C and N contents and microbial biomass C and N contents, which might help reduce N fertilizer use and improve sustainable agricultural development.

  12. Genetic Basis of Variation in Rice Seed Storage Protein (Albumin, Globulin, Prolamin, and Glutelin Content Revealed by Genome-Wide Association Analysis

    Directory of Open Access Journals (Sweden)

    Pingli Chen

    2018-05-01

    Full Text Available Rice seed storage protein (SSP is an important source of nutrition and energy. Understanding the genetic basis of SSP content and mining favorable alleles that control it will be helpful for breeding new improved cultivars. An association analysis for SSP content was performed to identify underlying genes using 527 diverse Oryza sativa accessions grown in two environments. We identified more than 107 associations for five different traits, including the contents of albumin (Alb, globulin (Glo, prolamin (Pro, glutelin (Glu, and total SSP (Total. A total of 28 associations were located at previously reported QTLs or intervals. A lead SNP sf0709447538, associated for Glu content in the indica subpopulation in 2015, was further validated in near isogenic lines NIL(Zhenshan97 and NIL(Delong208, and the Glu phenotype had significantly difference between two NILs. The association region could be target for map-based cloning of the candidate genes. There were 13 associations in regions close to grain-quality-related genes; five lead single nucleotide polymorphisms (SNPs were located less than 20 kb upstream from grain-quality-related genes (PG5a, Wx, AGPS2a, RP6, and, RM1. Several starch-metabolism-related genes (AGPS2a, OsACS6, PUL, GBSSII, and ISA2 were also associated with SSP content. We identified favorable alleles of functional candidate genes, such as RP6, RM1, Wx, and other four candidate genes by haplotype analysis and expression pattern. Genotypes of RP6 and RM1 with higher Pro were not identified in japonica and exhibited much higher expression levels in indica group. The lead SNP sf0601764762, repeatedly detected for Alb content in 2 years in the whole association population, was located in the Wx locus that controls the synthesis of amylose. And Alb content was significantly and negatively correlated with amylose content and the level of 2.3 kb Wx pre-mRNA examined in this study. The associations or candidate genes identified would provide

  13. DNA analysis by single molecule stretching in nanofluidic biochips

    DEFF Research Database (Denmark)

    Abad, E.; Juarros, A.; Retolaza, A.

    2011-01-01

    Imprint Lithography (NIL) technology combined with a conventional anodic bonding of the silicon base and Pyrex cover. Using this chip, we have performed single molecule imaging on a bench-top fluorescent microscope system. Lambda phage DNA was used as a model sample to characterize the chip. Single molecules of λ-DNA......Stretching single DNA molecules by confinement in nanofluidic channels has attracted a great interest during the last few years as a DNA analysis tool. We have designed and fabricated a sealed micro/nanofluidic device for DNA stretching applications, based on the use of the high throughput Nano...... stained with the fluorescent dye YOYO-1 were stretched in the nanochannel array and the experimental results were analysed to determine the extension factor of the DNA in the chip and the geometrical average of the nanochannel inner diameter. The determination of the extension ratio of the chip provides...

  14. Acupuncture for pilocarpine-resistant xerostomia following radiotherapy for head and neck malignancies

    International Nuclear Information System (INIS)

    Johnstone, Peter A.S.; Peng, Y. Peter; May, Byron C.; Inouye, Warren S.; Niemtzow, Richard C.

    2001-01-01

    Objective: Xerostomia is a frequent and potentially debilitating toxicity of radiotherapy (XRT) for cancers of the head and neck. This report describes the use of acupuncture as palliation for such patients. Methods and Materials: Eighteen patients with xerostomia refractory to pilocarpine therapy after XRT for head and neck malignancy were offered acupuncture as palliation. All patients are without evidence of cancer recurrence at the primary site. Acupuncture was provided to three auricular points and one digital point bilaterally, with electrostimulation used variably. The Xerostomia Inventory (XI) was administered retrospectively to provide an objective measure of efficacy. Results: Acupuncture contributed to relief from xerostomia to varying degrees. Palliative effect as measured by the XI varied from nil to robust (pre- minus post- therapy values of over 20 points). Nine patients had benefit of over 10 points on the XI. Conclusions: Acupuncture reduces xerostomia in some patients who are otherwise refractory to best current management

  15. Ionising treatment of food - disinfestation entomology

    International Nuclear Information System (INIS)

    Shipp, E.

    1985-01-01

    The main insects for which this type of treatment may be considered belong to three broad groups, the Coleoptera (beetles), the Lepidoptera (moths) and the Diptera (flies). The desirable effects of ionizing energy on insect pests include reproductive sterilisation as well as killing. The dose levels required for the former are generally considerably lower than for killing. As mortality may, at lower doses, be by starvation, due to damage to cells of the alimentary canal, death is generally not immediate, but may be delayed for a number of days. This may be a disadvantage for this method of control, especially if the product is for immediate export and there is a NIL live insect requirement. Lepidoptera are generally more resistant to irradiation than Coleoptera or Diptera

  16. Water Pollution and Treatments Part II: Utilization of Agricultural Wastes to Remove Petroleum Oils From Refineries Pollutants Present in Waste Water

    International Nuclear Information System (INIS)

    Ali, N.A.; El-Emary, M.M.

    2011-01-01

    Several natural agricultural wastes, of lignocellulose nature, such as Nile flower plant (ward El-Nil), milled green leaves, sugar cane wastes, palm tree leaves (carina), milled cotton stems, milled linseed stems, fine sawdust, coarse sawdust and palm tree cover were dried and then crushed to suitable size to be evaluated and utilized as adsorbents to remove oils floating or suspended in the waste water effluents from refineries and petroleum installations. The parameters investigated include effect of adsorbent type (adsorptive efficiency), adsorbate (type and concentration), mixing time, salinity of the water, adsorbent ratio to treated water, temperature, ph and stirring. Two different Egyptian crude oils varying in their properties and several refined products such as gasoline, kerosene, gas oil, diesel oil, fuel oil and lubricating oil were employed in this work in addition to the skimmed oil from the skim basin separator. Most of the agricultural wastes proved to be very effective in adsorbing oils from waste water effluents.

  17. Pretty leprosy: Another face of Hansen’s disease! A review

    Directory of Open Access Journals (Sweden)

    P. Prem Anand

    2014-10-01

    Full Text Available Pretty leprosy is one of the rare severe forms of lepromatous leprosy. It is a reaction pattern that occurs in untreated pure primitive diffuse lepromatous leprosy or lepromatous leprosy. The skin of the patient is diffusely infiltrated and shiny, so that natural wrinkles are obliterated. It generates a moist and myxoedematous complexion imparting a healthy aspect to the patient. Thus the disease got the name. In this review we have reviewed almost all available literature to point more light toward the clinical variant pretty leprosy. A search was made in PubMed central to know the availability of information about pretty leprosy, but the response was nil for pretty leprosy. 37 articles were spotted in PubMed media on Lucioleprosy; 3 review articles are present and the rest were case reports.

  18. Investigating temporal changes in the yeast phosphoproteome upon fatty acid starvation

    DEFF Research Database (Denmark)

    Pultz, Dennis; Bennetzen, Martin; Andersen, Jens S.

    2011-01-01

    under nutrition but not malnutrition extends the life span of multiple species, ranging from single-celled organisms like yeast to mammals. This increase in longevity by dietary restriction (DR) is coupled to profound beneficial effects on age-related pathology. Despite the number of studies on DR......Investigating stemporal changes in the yeast phosphoproteome upon fatty acid starvation Dennis Pultz*, Martin Bennetzen*, Jens S. Andersen and Nils J.Færgeman. Department of Biochemistry and Molecular Biology, University of Southern Denmark, Odense, Denmark, 5230 Reducing food intake to induce...... and the physiological changes DR induces, only little is known about the genetics and signalling networks which regulate the DR response. We have recently shown that inhibition of fatty acid synthesis in Saccharomyces cerevisiae results in a dependency on autophagy in maintaining normal life span. We further believe...

  19. Effects of social support and self-esteem on depressive symptoms in Japanese middle-aged and elderly people.

    Science.gov (United States)

    Fukukawa, Y; Tsuboi, S; Niino, N; Ando, F; Kosugi, S; Shimokata, H

    2000-04-01

    We examined the relationship among social support, self-esteem, and depression. The subjects were 1,116 Japanese community-dwelling adults aged between 40-79, who were the first wave participants of the National Institute for Longevity Sciences--Longitudinal Study of Aging (NILS-LSA). Exploratory and confirmatory factor analyses were performed on the Rosenberg's self-esteem scale that supported the superiority of the bi-dimensional structure of the scale marked by self-confidence and self-deprecation subscales. The subsequent causal analyses, using structural equation modeling, demonstrated that social support reduced depressed affect through an increase in self-confidence and a decrease in self-deprecation. By contrast, social support did not show a direct effect on depressed affect. The findings suggest the importance of esteem-improving elements of social support in reducing depressive symptoms.

  20. Comparison of 5 health care professionals’ratings of the clinical significance of drug related problems

    DEFF Research Database (Denmark)

    Villesen, Christine; Hojsted, Jette; Kjeldsen, Lene Juel

    2014-01-01

    to a mutual agreement on the level of clinical significance. However, to what degree does the panel agree?Purpose To compare the agreement between different health care professionals who have evaluated the clinical significance of DRPs.Materials and methods DRPs were identified in 30 comprehensive medicines...... reviews conducted by a clinical pharmacist. Two hospital pharmacists, a general practitioner and two specialists in pain management from hospital care (the Panel) evaluated each DRP considering the potential clinical outcome for the patient. The DRPs were rated either nil, low, minor, moderate or highly...... clinically significant. Agreement was analysed using Kappa statistics. A Kappa value of 0.8 to 1.0 indicated nearly perfect agreement between ratings of the Panel members.Results The Panel rated 45 percent of the total 162 DRPs as of moderate clinical significance. However, the overall kappa score was 0...

  1. Barrier-free public transport in the Stuttgart region. Results of a round table with disabled persons on entrance to S-Bahn carriages; Barrierefreiheit im oeffentlichen Personennahverkehr (OePNV) in der Region Stuttgart. Ergebnisse eines Runden Tisches mit Betroffenen zum Problembereich Fahrzeugzugang bei S-Bahnen

    Energy Technology Data Exchange (ETDEWEB)

    Pauls, K. (ed.)

    2001-06-01

    On July, 18{sup th}, 2000, the Centre of Technology Assessment in Baden-Wuerttemberg invited representatives of organisations for the disabled to take part in a round table in order to discuss barrierfree public transport in the region of Stuttgart with Dr. Witgar Weber, vice regional director of the Verband Region Stuttgart and Mr. Nils Himmelmann, representative of Switch Transit Consult. In the first lecture, Dr. Witgar Weber explained tasks of the Verband Region Stuttgart concerning public transport, especially the S-Bahn. Mr. Nils Himmelmann explained the work he is doing on instruction for the Verband Region Stuttgart, at finding solutions to reduce the problem of a vertical and horizontal interval at the entrance of S-Bahn carriages. As a result of the round table, a profile of requirements was compiled by participants, including preferences for a barrierfree use of the S-Bahn. For the S-Bahn system they demand a partial raise of platforms and where a static raise is not possible there should be a dynamic partial raise. This measure should be combined with an extending step at the entrances of the S-Bahn to solve both horizontal and vertical intervals. Further, the integration of disabled and handicapped people in planning is essential at an early stage. Not only for new projects but also for the modifications of trails or carriages. Therewith, concrete problems can be identified immediately which leads to a reduction of costs in realising requirements for a barrierfree public transport instead of very expensive modifications afterwards. (orig.) [German] Auf Einladung der Akademie fuer Technikfolgenabschaetzung in Baden-Wuerttemberg kamen am 18.07.00 Vertreterinnen und Vertreter von Behindertenverbaenden zu einem Runden Tisch, um das Thema, Barrierefreiheit im OePNV in der Region Stuttgart' zusammen mit Dr. Witgar Weber, stellvertretender Regionaldirektor beim Verband Region Stuttgart (VRS), und Nils Himmelmann von der Firma Switch Transit Consult zu

  2. Effects of nuclear radiation on the optical properties of cerium-doped glass (accelerator applications)

    CERN Document Server

    McGrath, B; Van de Voorde, M H

    1976-01-01

    Some twenty types of glass containing 0.5-4% CeO/sub 2/ have been irradiated in a /sup 60/Co gamma cell and in the mixed neutron-gamma field of a nuclear reactor, at total integrated doses of up to 5*10 /sup 9/ rad (CH). The resulting colouration has been assessed quantitatively by measuring the light transmission with reference to air, in the range 360-510 nm. From the results, certain types of glass suitable for applications in nuclear engineering can be selected. Specifically, it was found that 1-2% CeO/sub 2/ content is usually sufficient to obtain radiation-resistant optical glass: the reduction in light transmission above 450 nm is nil at 10/sup 8/ rad (CH), below 10% at 10/sup 9/ rad (CH), and below 20% at 5*10/sup 9/ rad (CH); the post-irradiation fading is negligible.

  3. Bilateral acute retinal necrosis associated with bilateral uveal effusion in an immunocompetent patient: A challenging association

    Directory of Open Access Journals (Sweden)

    S Bala Murugan

    2018-01-01

    Full Text Available Bilateral uveal effusion syndrome associated with bilateral acute retinal necrosis is a diagnostic and therapeutic challenge. A 52 year old man presented with bilateral angle closure with choroidal detachment. With restricted fundus view, parenteral steroid was started. During close follow up bilateral discrete areas of peripheral retinitis were noted. Parenteral steroids were promptly stopped and parenteral antivirals with oral steroids were continued. It showed healing response with nil recurrences till last follow up. Aggressive treatment of bilateral uveal effusion with parenteral steroids can cause progression of bilateral acute retinal necrosis leading to phthisis bulbi. However early diagnosis, prompt intervention and close follow up are the key elements to therapeutic success even during diagnostic surprises and avoid costly mistakes.

  4. Exogenously triggered response inhibition in developmental stuttering.

    Science.gov (United States)

    Eggers, Kurt; De Nil, Luc F; Van den Bergh, Bea R H

    2018-06-01

    The purpose of the present study was to examine relations between children's exogenously triggered response inhibition and stuttering. Participants were 18 children who stutter (CWS; mean age = 9;01 years) and 18 children who not stutter (CWNS; mean age = 9;01 years). Participants were matched on age (±3 months) and gender. Response inhibition was assessed by a stop signal task (Verbruggen, Logan, & Stevens, 2008). Results suggest that CWS, compared to CWNS, perform comparable to CWNS in a task where response control is externally triggered. Our findings seem to indicate that previous questionnaire-based findings (Eggers, De Nil, & Van den Bergh, 2010) of a decreased efficiency of response inhibition cannot be generalized to all types of response inhibition. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Potential hazard of zoonotic parasites present in canine feces in Puerto Escondido, Oaxaca

    Directory of Open Access Journals (Sweden)

    León Vélez-Hernández

    2014-11-01

    Full Text Available Objective. To estimate the zoonotic parasites prevalence in feral dog feces in Puerto Escondido. Material and methods. The fecalism frecuency was estimated in ten zones. To identify the parasites parasitological flotation and direct smear methods were used. The parasitic prevalence was estimated in the canine feces. Results. All the zones presented canine fecalism. The parasitic prevalence in the feces was 73.33%. The parasites with the highest prevalence were Toxocara canis (47.78%, Ancylostoma caninum (17.88%, and Dipylidium caninum (13.89%. Conclusion. Canine fecalism comes from strayed and owned dogs. 66.66% of the parasites found in the dog feces are zoonotics. The factors associated to this problem are the suburban habitat, waste mishandling and nil tenure of stray dogs.

  6. Crystallite growth in nanocrystalline tungsten; rate determining mechanism and the role of contaminations

    International Nuclear Information System (INIS)

    Hegedűs, Zoltán; Meka, Sai Ramudu; Mittemeijer, Eric J.

    2016-01-01

    The thermal stability of nanocrystalline tungsten was investigated by tracing the evolution of the microstructure as a function of (isothermal) annealing time at different temperatures (800−875 °C). To this end especially in situ X-ray diffraction and transmission electron microscopy methods were applied to ball milled tungsten powder. Initially the dislocation density and the crystallite/domain size decreased and increased rapidly, respectively. Upon prolonged annealing the crystallite growth rate decelerated and even became nil: a saturation crystallite size, increasing with increasing annealing temperature, was attained. Application of all available isothermal growth models to the experimental data resulted in very low values for the activation energy (60−120 kJ/mol) indicating that recovery of the deformed microstructure is the dominantly occurring process, leading to pronounced crystallite/domain growth. The effect on the growth kinetics of different levels of contaminations, which exert a drag force on the moving boundaries, was also investigated.

  7. Prevention of the hemoglobinopathies

    Directory of Open Access Journals (Sweden)

    Dimitris Loukopoulos

    2013-03-01

    Full Text Available The inherited hemoglobin disorders not only cause suffering and unhappiness to the patients but they also absorb a large part of resources and human effort in several countries which harbor the deleterious genes. Numbers are frightening! Africa, with several millions patients with sickle cell anemia; India with millions of patients with sickle cell disease and thalassemia, South East Asia with more millions of patients with hemoglobin E and a- or b-thalassemia. The offered treatment is suboptimal or nil and, and, in several places, patients are dying at infancy not only because of their hemoglobinopathy but mainly because of infections and malaria; in this way, nature took care of her own faults and eliminated them before they enter productive life...

  8. Secret Societies, Opaque Routes

    DEFF Research Database (Denmark)

    Garsten, Christina; Sörbom, Adrienne

    This paper departs from an interest in the involvement of business leaders in the sphere of politics, in the broad sense. At a general level, we are seeing a proliferation of usages of non-market corporate strategies, such as testimony, lobbying, interlocking of positions and other means...... as political. What is the role of business in the WEF, and how do business corporations advance their interests through the WEF? Inspired by Stephen Barley's (2010) work on how corporations have systematically built an institutional field to exert greater influence on the US Federal government, we aim...... with participants and organizers. Theoretically we will employ an organizational perspective, using the concept of "partial organization" as introduced by Göran Ahrne and Nils Brunsson (2011). The results show that corporations find a strategically positioned amplifier for their non-market interests in the WEF...

  9. Celebrities' Memorial Afterlives: Obituaries, Tributes, and Posthumous Gossip in the Romanian Media Deathscape.

    Science.gov (United States)

    Rusu, Mihai S

    2017-01-01

    Cross-culturally, dead are protected from posthumous negative evaluations by the universal "nil nisi bonum" precept that governs the ethics within the community of mourners. In this study, we set out to test the observance of this injunction against posthumous gossiping in the Romanian public deathscape. Obituaries and other posthumous articles ( N = 1,148) were collected that covered the deaths of 63 celebrities who passed away between 2013 and 2016. Materials were gathered from the digital archives of three Romanian news sources (a news agency, a "quality" newspaper, and a tabloid), published one week after the moment of death. The findings show that 22% of the articles do contain negative evaluations of the deceased. The percentage rises to 36.4% if we restrict the sample to only those celebrities with a controversial anthumous reputation (19 of 63). These results indicate that celebrities are not spared from critical assessments after they pass away.

  10. Differentiating clinical care from disease prevention: a prerequisite for practicing quaternary prevention

    Directory of Open Access Journals (Sweden)

    Charles Dalcanale Tesser

    Full Text Available Abstract: This article contends that the distinction between clinical care (illness and prevention of future disease is essential to the practice of quaternary prevention. The authors argue that the ongoing entanglement of clinical care and prevention transforms healthy into "sick" people through changes in disease classification criteria and/or cut-off points for defining high-risk states. This diverts health care resources away from those in need of care and increases the risk of iatrogenic harm in healthy people. The distinction in focus is based on: (a management of uncertainty (more flexible when caring for ill persons; (b guarantee of benefit (required only in prevention; (c harm tolerance (nil or minimal in prevention. This implies attitudinal differences in the decision-making process: greater skepticism, scientism and resistance towards preventive action. These should be based on high-quality scientific evidence of end-outcomes that displays a net positive harm/benefit ratio.

  11. Some aspects of barreling in sintered plain carbon steel powder metallurgy preforms during cold upsetting

    Directory of Open Access Journals (Sweden)

    Sumesh Narayan

    2012-04-01

    Full Text Available The present research establishes a relationship of bulged diameter with densification and hydrostatic stress in forming of sintered iron (Fe powder metallurgy preforms cold upset under two different frictional conditions, namely, nil/no and graphite lubricant condition. Sintered plain carbon steel cylindrical preforms with carbon (C contents of 0, 0.35, 0.75 and 1.1% with constant initial theoretical density of 84% and aspect ratio of 0.4 and 0.6 were prepared using a suitable die-set assembly on a 1 MN capacity hydraulic press and sintered for 90 minutes at 1200 °C. Each sintered preform was cold upset under two different frictional constraints. It is seen that the degree of bulging reduces with reducing frictional constraints at the die contact surface. Further, it is found that the bulging ratio changed as a function of relative density and hydrostatic stress, respectively, according to the power law equations.

  12. Retinopathy is associated with impaired myocardial function assessed by advanced echocardiography in type 1 diabetes patients – The Thousand & 1 Study

    DEFF Research Database (Denmark)

    Nouhravesh, Nina; Andersen, Henrik U; Jensen, Jan S

    2016-01-01

    AIMS: Retinopathy and heart disease in Type 1 Diabetes Mellitus (Type 1 DM) may be associated; however previous results have been conflicting. Tissue Doppler Imaging (TDI) and speckle-tracking echocardiography (STE) quantify myocardial function not assessable by conventional echocardiography. We...... investigated the association between severity of retinopathy and early myocardial dysfunction using conventional echocardiography, TDI and STE in Type 1 DM patients. METHODS: Type 1 Diabetes Mellitus patients without known heart disease were included from the Steno Diabetes Center. The cross sectional...... association between retinopathy and myocardial function was analyzed in uni-and multivariable models. Retinopathy was categorized as nil-, simplex- or proliferative retinopathy. RESULTS: A total of 1090 Type 1 Diabetes Mellitus patients were included, mean age was 49.6years and 53% were males. Left...

  13. Equation with the many fathers

    DEFF Research Database (Denmark)

    Kragh, Helge

    1984-01-01

    In this essay I discuss the origin and early development of the first relativistic wave equation, known as the Klein-Gordon equation. In 1926 several physicists, among them Klein, Fock, Schrödinger, and de Broglie, announced this equation as a candidate for a relativistic generalization of the us...... as electrodynamics. Although this ambitious attempt attracted some interest in 1926, its impact on the mainstream of development in quantum mechanics was virtually nil....... of the usual Schrödinger equation. In most of the early versions the Klein-Gordon equation was connected with the general theory of relativity. Klein and some other physicists attempted to express quantum mechanics within a five-dimensional unified theory, embracing general relativity as well...

  14. Synthesis, crystal structures, molecular docking and urease inhibition studies of Ni(II) and Cu(II) Schiff base complexes

    Science.gov (United States)

    Sangeeta, S.; Ahmad, K.; Noorussabah, N.; Bharti, S.; Mishra, M. K.; Sharma, S. R.; Choudhary, M.

    2018-03-01

    [Ni(L)2] 1 and [Cu(L)2] 2 [HL = 2-((E)-(2-methoxyphenylimino)methyl)-4,6-dichlorophenol] Schiff base complexes have been successfully synthesized and were characterized by FT-IR, UV-Vis, fluorescence spectroscopy and thermogravimetric analysis. The crystal structures of the two complexes were determined through X-ray crystallography. Its inhibitory activity against Helicobacter pylori urease was evaluated in vitro and showed strong inhibitory activity against H. pylori urease compared with acetohydroxamic acid (IC50 = 42.12 μmolL-1), which is a positive reference. A docking analysis using the AutoDock 4.0 program could explain the inhibitory activity of the complex against urease.

  15. The year-wise nodulation behavior and biological nitrogen fixation parameters of chickpea (cicer aritinum, L) at some selected sites in the southern zone of Pakistan during 1995-98

    International Nuclear Information System (INIS)

    Idris, M.

    2000-01-01

    Study was carried out during 1995-98 to know the location and year-wise nodulation response (number and weight of nodules/plant) and the related biological nitrogen fixation parameters (dry matter yield, n concentration and yield/plant) of the crop at some selected sites ( Peshawar, Kohat, Krak, Bannu and D. I. Khan ) under the agro climatic conditions prevailing in the southern zones of NWFP-Pakistan. The crop was found to be profusely nodulating under the agro climatic conditions prevailing at all sites except at Barani-Agricultural Research station (bars) Kohat, where the nodulation of the crop almost remained inclined to be nil. The nodulation behavior and biological nitrogen fixation parameters of chickpea during 1995-98 in the southern zone of NWFP- Pakistan has been described. (author)

  16. Nanoimprint Lithography on curved surfaces prepared by fused deposition modelling

    International Nuclear Information System (INIS)

    Köpplmayr, Thomas; Häusler, Lukas; Bergmair, Iris; Mühlberger, Michael

    2015-01-01

    Fused deposition modelling (FDM) is an additive manufacturing technology commonly used for modelling, prototyping and production applications. The achievable surface roughness is one of its most limiting aspects. It is however of great interest to create well-defined (nanosized) patterns on the surface for functional applications such as optical effects, electronics or bio-medical devices. We used UV-curable polymers of different viscosities and flexible stamps made of poly(dimethylsiloxane) (PDMS) to perform Nanoimprint Lithography (NIL) on FDM-printed curved parts. Substrates with different roughness and curvature were prepared using a commercially available 3D printer. The nanoimprint results were characterized by optical light microscopy, profilometry and atomic force microscopy (AFM). Our experiments show promising results in creating well-defined microstructures on the 3D-printed parts. (paper)

  17. French nuclear power plants for heat generation

    International Nuclear Information System (INIS)

    Girard, Y.

    1984-01-01

    The considerable importance that France attributes to nuclear energy is well known even though as a result of the economic crisis and the energy savings it is possible to observe a certain downward trend in the rate at which new power plants are being started up. In July 1983, a symbolic turning-point was reached - at more than 10 thousand million kW.h nuclear power accounted, for the first time, for more than 50% of the total amount of electricity generated, or approx. 80% of the total electricity output of thermal origin. On the other hand, the direct contribution - excluding the use of electricity - of nuclear energy to the heat market in France remains virtually nil. The first part of this paper discusses the prospects and realities of the application, at low and intermediate temperatures, of nuclear heat in France, while the second part describes the French nuclear projects best suited to the heat market (excluding high temperatures). (author)

  18. Disainikaart : Rootsi

    Index Scriptorium Estoniae

    2007-01-01

    Rohkeid disainiauhindu noppinud Rootsi disainerite loomingut, mis on silma paistnud oma ergonoomilisuse, funktsionaalsuse ja innovatiivsusega - Marten Calessoni, Eero Koivisto ja Ola Rune punane tugitool "Pebbles", Katarina Krebsi sinikollastes rahvusvärvides moekollektsioon (2002.a.), Anna von Scheweni disainitud köök 2001. aasta sisustusnäituseks ning tema toolid "Kallistus" ja "Suur kallistus", Baby-Björni laste toidukauss ja lusikas, Gunnar Leijonbergi patareidega muruniitja, Inese Ljunggreni robottolmuimeja "Trilobiit", Andrea Djerfi hambakujuline keraamiline anum, Carl Frans Lundströmi tormitikud (1857.a.), Ebehard Segeri disainitud tolmuimeja (1910.a.), Ericssoni mobiiltelefon, Nils Bohlini disainitud kolmepunktiturvavöö (1959.a.), Bertil Aldmani beebi turvaiste (1963.a.), Erik Wallenbergi ja Ruben Rausingi disainitud tetrapakk (1951.a.), Gustav de Lavali koorelahutaja (1878.a.)

  19. PC12 polarity on biopolymer nanogratings

    International Nuclear Information System (INIS)

    Cecchini, M; Ferrari, A; Beltram, F

    2008-01-01

    Cell differentiation properties are strongly entangled with the morphology and physical properties of the extracellular environment. A complete understanding of this interaction needs artificial scaffolds with controlled nano-/micro-topography. We induced specific topographies by nanoimprint lithography (NIL) on tissue culture polystyrene (TCPS) dishes substrates and, using light microscopy and high-magnification scanning-electron-microscopy, quantitatively compared the changes in PC12 differentiation phenotype induced by the periodicity of the nanopatterns. This analysis revealed that nanogratings reduce the number of neurites produced by PC12 cells upon treatment with NGF and that neuronal bipolarity correlated with an increased stretching of the cell body and a reduced length of the cell neuronal protrusions

  20. Sobre a Padronização de um Método Prático Para a Dosagem da Cafeína

    Directory of Open Access Journals (Sweden)

    Bührer Nilton E.

    2001-01-01

    Full Text Available In this work the author puts in evidence a practical and at the same time rapid method for the determination of the cafein quantity in erva-mate, that may be utilized to perfection in food and industrial analyses or others that not demand scientific rigour. The author presents a description of the method and makes a comparison with the classical method of Grandval-Lajoux, showing that the differences between the one and the other are practically nil. In conclusion, the result of the three analyses of the same sample of erva-mate, made by the Grandval-Lajoux method are cited, show that the same differences appear as those shown between the rapid method suggested by the author and the classical method. In this case, the maximum difference was 0,06% and the minimum 0,01%.