Forest resources of the Nez Perce National Forest
Michele Disney
2010-01-01
As part of a National Forest System cooperative inventory, the Interior West Forest Inventory and Analysis (IWFIA) Program of the USDA Forest Service conducted a forest resource inventory on the Nez Perce National Forest using a nationally standardized mapped-plot design (for more details see the section "Inventory methods"). This report presents highlights...
Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement Summary.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe`s culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement. Summary
International Nuclear Information System (INIS)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe's culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle
National Research Council Canada - National Science Library
Pfau, Scott E
2006-01-01
... Cavalry pursuit of the Nez Perce. Many of the tactics, techniques, and procedures used by the modern day warriors often derive from lessons learned in early US military confrontations, such as the Nez Perce, and are applicable...
Council of Energy Resources Tribes 1993 summer internship report: Nez Perce Tribe
Energy Technology Data Exchange (ETDEWEB)
Crow, J.S.
1993-08-01
This paper is designed to be a working part of a larger project which would deal with the topic of Tribal interests affected by the DOE Environmental Restoration and Waste Management program and the approaches by which those Tribal interests can be advanced. Topics discussed in this paper include: background history of the Nez Perce Tribe`s relations with the US government; a Nez Perce view of tribal interests affected by DOE activities at Hanford; and a Nez Perce framework for private/governmental/tribal interest.
Monitoring and evaluation plan for the Nez Perce Tribal Hatchery
Energy Technology Data Exchange (ETDEWEB)
Steward, C.R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan, the 1995 Supplement to the Master Plan, and the Nez Perce Tribal Hatchery Program Environmental Impact Statement. The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts.
Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho).
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management
Nez Perce Tribal Hatchery Program. Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, and the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia river juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increased competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management. Impacts to cultural resources can be avoided so impacts would be low. Soil impacts would be localized and their effects would be local and temporary during construction. Impacts to water quality would be low. Mitigation would be used if impacts to groundwater or surface water are greater than anticipated. No impacts to floodplains are expected. Impacts to all categories of fish range from no to high impacts
Energy Technology Data Exchange (ETDEWEB)
Harty, Harold R.; Lundberg, Jeffrey H.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-02-01
The Nez Perce Tribal Hatchery (NPTH) responds directly to a need to mitigate for naturally-reproducing salmon in the Clearwater River subbasin. The overall goal is to produce and release fish that will survive to adulthood, spawn in the Clearwater River subbasin and produce viable offspring that will support future natural production and genetic integrity. Several underlying purposes of fisheries management will be maintained through this program: (1) Protect, mitigate, and enhance Columbia River subbasin anadromous fish resources. (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater River subbasin. (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project completion. (4) Sustain long-term fitness and genetic integrity of targeted fish populations. (5) Keep ecological and genetic impacts to non-target populations within acceptable limits. (6) Promote Nez Perce Tribal Management of Nez Perce Tribal hatchery Facilities and production areas within Nez Perce Treaty lands. Nez Perce Tribal Hatchery is a supplementation program that will rear and release spring, fall, and early-fall stocks of chinook salmon. Two life stages of spring chinook salmon will be released: parr and presmolts. Fall and early-fall chinook salmon will be released as subyearling smolts. The intent of NPTHC is to use conventional hatchery and Natural Rearing Enhancement Systems (NATURES) techniques to develop, increase and restore natural populations of spring and fall chinook salmon in the Clearwater River subbasin.
Monitoring and Evaluation Plan for the Nez Perce Tribal Hatchery, 1996 Technical Report.
Energy Technology Data Exchange (ETDEWEB)
Steward, Cleveland R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan (Larson and Mobrand 1992), the 1995 Supplement to the Master Plan (Johnson et al. 1995), and the Nez Perce Tribal Hatchery Program Environmental Impact Statement (Bonneville Power Administration et al. 1996). The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine. whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts. Program success will be gauged primarily by changes in the abundance and distribution of supplemented chinook populations. The evaluation of project-related impacts will focus on the biological effects of constructing and operating NPTH hatchery facilities, introducing hatchery fish into the natural environment, and removing or displacing wild
2006-06-16
Battle in which US Regimental Commander, Captain David Perry, appeared in a US court of inquiry to explain his devastating loss to the Nez Perce. He...changed, however, with the massacre of a detachment of eighty men under the command of Captain William J. Fetterman on the morning of 21 December...University, Homepage; available from http://www.howard.edu; Internet; accessed on 26 April 2006. 14John H Eicher, and David J. Eicher, Civil War High
Energy Technology Data Exchange (ETDEWEB)
Backman, Thomas; Sprague, Sherman; Bretz, Justin [Nez Perce Tribe
2009-06-10
The Nez Perce Tribal Hatchery (NPTH) program has the following goals (BPA, et al., 1997): (1) Protect, mitigate, and enhance Clearwater Subbasin anadromous fish resources; (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater Subbasin; (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project initiation; (4) Sustain long-term fitness and genetic integrity of targeted fish populations; (5) Keep ecological and genetic impacts to non-target populations within acceptable limits; and (6) Promote Nez Perce Tribal management of Nez Perce Tribal Hatchery Facilities and production areas within Nez Perce Treaty lands. The NPTH program was designed to rear and release 1.4 million fall and 625,000 spring Chinook salmon. Construction of the central incubation and rearing facility NPTH and spring Chinook salmon acclimation facilities were completed in 2003 and the first full term NPTH releases occurred in 2004 (Brood Year 03). Monitoring and evaluation plans (Steward, 1996; Hesse and Cramer, 2000) were established to determine whether the Nez Perce Tribal Hatchery program is achieving its stated goals. The monitoring and evaluation action plan identifies the need for annual data collection and annual reporting. In addition, recurring 5-year program reviews will evaluate emerging trends and aid in the determination of the effectiveness of the NPTH program with recommendations to improve the program's implementation. This report covers the Migratory Year (MY) 2007 period of the NPTH Monitoring & Evaluation (M&E) program. There are three NPTH spring Chinook salmon treatment streams: Lolo Creek, Newsome Creek, and Meadow Creek. In 2007, Lolo Creek received 140,284 Brood Year (BY) 2006 acclimated pre-smolts at an average weight of 34.9 grams per fish, Newsome Creek received 77,317 BY 2006 acclimated pre-smolts at an average of 24
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2006-03-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2001 annual report combines information from two contracts with a combined value of $2,336,491. They are identified by Bonneville Power Administration as follows: (1) Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and (2) Planning and Design--Project No. 1983-350-00, Contract No. 4035. The Operations and Maintenance (O&M) budget of $2,166,110 was divided as follows: Facility Development and Fish Production Costs--$860,463; and Equipment Purchases as capital cost--$1,305,647 for equipment and subcontracts. The Planning and Design (P&D) budget of $170,381 was allocated to development of a Coho master planning document in conjunction with Nez Perce Tribal Hatchery. The O&M budget expenditures represent personnel and fish production expenses; e.g., administration, management, coordination, facility development, personnel training and fish production costs for spring Chinook and Coho salmon. Under Objective 1: Fish Culture Training and Education, tribal staff worked at Clearwater Anadromous Hatchery (CAFH) an Idaho Department of Fish and Game (IDFG) facility to produce spring Chinook smolt and parr for release that are intended to provide future broodstock for NPTH. As a training exercise, BPA allowed tribal staff to rear Coho salmon at Dworshak National Fish Hatchery, a U.S. Fish and Wildlife Service (USFWS) facility. This statement of work allows this type of training to prepare tribal staff to later rear salmon at Nez Perce Tribal Hatchery under Task 1.6. As a subset of the O&M budget, the equipment purchase budget of $1,305,647 less $82,080 for subcontracts provides operational and portable equipment necessary for NPTH facilities after construction. The equipment budget for the year was $1,223,567; this year's purchases amounted $287,364.48 (see
Dennis E. Ferguson; John C. Byrne; William R. Wykoff; Brian Kummet; Ted Hensold
2011-01-01
Stands of dense, natural ponderosa pine (Pinus ponderosa var. ponderosa) regeneration were operationally, precommercially thinned at seven sites - four on Nez Perce Tribal lands in northern Idaho and three on Spokane Tribal lands in eastern Washington. Five spacing treatments were studied - control (no thinning), 5x5 ft, 7x7 ft, 10x10 ft, and 14x14 ft. Sample trees...
International Nuclear Information System (INIS)
Liebow, E.B.; Younger, C.A.; Broyles, J.A.
1987-11-01
For the purposes of the Nuclear Waste Policy Act, the Confederated Tribes and Bands of the Yakima Indian Nation, the Confederated Tribes of the Umatilla Indian Reservation, and the Nez Perce Tribe have been accorded the status of ''Affected Indian Tribe'' and have become party to the proceedings to determine a suitable location for the nation's first commercial waste repository. Each of the Tribes has expressed concerns about the suitability of the Hanford Site in eastern Washington. These concerns, in general, address the proposed repository's effects on traditional spiritual beliefs and cultural practices, on tribal sovereignty and the Tribes' right to self-government, on the natural resources under tribal management jurisdiction, and on the health and socioeconomic characteristics of the Tribes' reservation communities. The Yakima, Umatilla, and Nez Perce have distinctive cultural traditions that may be adversely affected by activities related to the Basalt Waste Isolation Project (BWIP). Further, the Tribes enjoy a unique relationship with the federal government. Because of their distinctive cultures and governmental status, particular attention will be paid to expressed interests of the Tribes, and to ways in which these interests may be affected by the repository program. Monitoring is needed to describe current conditions among the Affected Tribes' populations, to describe BWIP site characterization activities affecting the Tribes, and to measure any changes in these conditions that may occur as a direct result of site characterization. This paper reports our first efforts at gathering historical information. It summarizes materials contained in two sources: the reports of field agents to the Commissioner of Indian Affairs (1854-1936), and the dockets of the Indian Claims Commission. 24 refs., 3 figs
International Nuclear Information System (INIS)
Larson, Roy Edward; Walker, Grant
2002-01-01
Nez Perce Tribal Hatchery (NPTH) Year-2000 Combined Maintenance and Operations (O and M) and Planning and Design (P and D) contract is hereby completed based on this annual report patterned after the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration. Primary project activities focused on completion of the Northwest Power Planning Council Step-3 process that: (1) Accepted final design, (2) Authorized a capital construction amount of $16,050,000, and (3) Authorized contractor selection, and (4) Provided construction site dedication, and (5) Implemented construction activities over an anticipated 2-year period of July 2000 through October 2002
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-12-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2002 annual report combines information from two contracts with a combined value of $3,036,014. Bonneville Power Administration identifies them as follows; (1) Part I--Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and $2,682,635 which includes--Equipment costs of $1,807,105. (2) Part II--Planning and Design--Project No. 1983-35-04, Contract No. 4035, $352,379 for Clearwater Coho Restoration Master Plan development Based on NPPC authorization for construction and operation of NPTH, the annual contracts were negotiated for the amounts shown above under (1) and (2). Construction contracts were handled by BPA until all facilities are completed and accepted.
Energy Technology Data Exchange (ETDEWEB)
Kucera, Paul A.; Johnson, David B. (Nez Perce Tribe, Lapwai, ID)
1986-08-01
A biological and physical inventory of selected tributaries in the lower Clearwater River basin was conducted to collect information for the development of alternatives and recommendations for the enhancement of the anadromous fish resources in streams on the Nez Perce Reservation. Five streams within the Reservation were selected for study: Bedrock and Cottonwood Creeks were investigated over a two year period (1983 to 1984) and Big Canyon, Jacks and Mission Creeks were studied for one year (1983). Biological information was collected and analyzed on the density, biomass, production and outmigration of juvenile summer steelhead trout. Physical habitat information was collected on available instream cover, stream discharge, stream velocity, water temperature, bottom substrate, embeddedness and stream width and depth. The report focuses on the relationships between physical stream habitat and juvenile steelhead trout abundance.
CERT tribal internship program. Final intern report: D`Lisa Penney, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
The purpose of this intern`s project was to: education the Nez Perce people of the Hanford situation; begin researching into past and present health effects from the Hanford site; and inform and educate the Nez Perce people of the Hanford site and past exposures. The specific objectives were to begin researching the history of Nez Perce people and Hanford; create an understanding for the importance of this research; define the radiation and risks and how they occur; inform the Nez Perce people of the issue; and write the paper so it is easy to understand. This intern report contains a copy of the final paper written for the Nez Perce people. Because the dose reconstruction for Hanford is not complete, the health effects section is informative, but not definitive.
Protect and Restore Red River Watershed, 2007-2008 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program
2009-05-04
The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).
Neutron Decay with PERC: a Progress Report
International Nuclear Information System (INIS)
Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J
2012-01-01
The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.
76 FR 44000 - Environmental Impact Statements; Notice of Availability
2011-07-22
..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
Red River Stream Improvement Final Design Nez Perce National Forest.
Energy Technology Data Exchange (ETDEWEB)
Watershed Consulting, LLC
2007-03-15
This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.
Lower Red River Meadow Stream Restoration Project
International Nuclear Information System (INIS)
1996-05-01
As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream
Directory of Open Access Journals (Sweden)
Jing Ma
2009-01-01
Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
International Nuclear Information System (INIS)
Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.
2010-01-01
Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
Simulation Tools for Forest Health Analysis: An Application in the Red River Watershed, Idaho
Andrew J. McMahan; Eric L. Smith
2006-01-01
Software tools for landscape analyses--including FVS model extensions, and a number of FVS-related pre- and post-processing âtoolsâ--are presented, using an analysis in the Red River Watershed, Nez Perce National Forest as an example. We present (1) a discussion of pre-simulation data analysis; (2) the Physiographic Information Extraction System (PIES), a tool that can...
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)
2005-09-01
White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates
José Miguel Jiménez receives Order of Alfonso X the Wise
CERN Bulletin
2016-01-01
On 12 July 2016, José Miguel Jiménez, Head of CERN Technology Department, has been awarded a spanish civil decoration — an encomienda — of the Order of Alfonso X the Wise (see here), for his outstanding experience in the field of research and scientific management in particle physics. The ceremony took place at the National Library of Spain, in Madrid, on 12 July. From left: Marcial Marín Hellín, Secretary of State for Education, Professional training and Universities; José María Lassalle Ruiz, Secretary of State for Culture; Íñigo Méndez de Vigo y Montojo, Ministry of Education, Culture and Sport; José Miguel Jiménez, Head of CERN Technology Department; Carmen Vela Olmo, Secretary of State for Investigation, Development and Innovation. (Photo: ©Javier Martínez de la Torre, M...
Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Juan Ramón Jiménez and Nietzsche
Directory of Open Access Journals (Sweden)
John P. Devlin
1983-01-01
Full Text Available The young Juan Ramón Jiménez shared the enthusiasm for the writings of Nietzsche prevalent among his contemporaries. More significant are the interest in and affinity with Nietzsche which persisted into the poet's maturity. Jiménez found in Nietzsche not only a man of ideas but a poet who claimed to be a potent spiritual force. Both writers held that the modern age could recover a sense of spiritual integrity through the will of the individual to live and interpret human existence as an aesthetic phenomenon. Nietzsche's views on the nature of art and the role of the artist helped to sustain Jiménez' exalted and elitist view of poetry and the poet's mission. Jiménez felt an ethical kinship with the philosopher who asserted the absolute uniqueness of the creative individual, the end of whose existence was self-realization through his art. Nietzsche's doctrine of heroic vitalism as an antidote to chronic spiritual malaise corresponds to Jiménez' revitalized vision of the poetic word proclaimed in the Diario and elaborated in subsequent verse and prose writings.
High precision neutron polarization for PERC
International Nuclear Information System (INIS)
Klauser, C.
2013-01-01
The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de
Coho Salmon Master Plan, Clearwater River Basin.
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe; FishPro
2004-10-01
The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these
Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules
Energy Technology Data Exchange (ETDEWEB)
Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)
2017-04-19
The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.
75 FR 28612 - Environmental Impact Statements; Notice of Availability
2010-05-21
... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...
Energy Technology Data Exchange (ETDEWEB)
Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley
2015-01-01
The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.
Tropic and race. Miguel Jiménez López and the Japanese Immigration in Colombia, 1920-1929
Directory of Open Access Journals (Sweden)
Abel Fernando Martínez Martín
2017-01-01
Full Text Available This article discusses the debate on immigration in Colombia, specifically focusing on Japanese immigration, an problem, by being so far from the desired European immigration. Likewise, the important role played by the psychiatrist and conservative Colombian politician Miguel Jiménez Lopez and his theory of degeneration of the Colombian race. Jiménez Lopez is the author of "The yellow immigration in the America", a publication of the National Academy of Medicine, written in response to the Ministry of Industries about the question for the possible impact of a Japanese immigration in the eastern plains. Jiménez Lopez maintains the problem from medicalization and biology, using more arguments from geographical determinism and racism that from eugenics, to justify that a Japanese immigration to Colombia was not advisable, because it jeopardizes the progressive bleaching managed —with the passage of time— by the Colombian race.
78 FR 24718 - Nez Perce-Clearwater National Forests; Idaho; Lolo Insect & Disease Project
2013-04-26
... Lolo Creek watershed. A total of 500 miles occurs within designated PACFISH buffers. Desired Condition... or displaced soil or loss of organic matter. Desired Condition: Soils are productive (functioning... riparian habitat conservation areas. Deferred maintenance opportunities (such as any needed reconstruction...
Directory of Open Access Journals (Sweden)
Peisheng Liu
2014-01-01
Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.
Plaidoyer pour le lavage de nez dans les pathologies naso ...
African Journals Online (AJOL)
Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.
78 FR 9029 - Nez Perce-Clearwater National Forests; ID; Clear Creek Integrated Restoration Project
2013-02-07
.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and..., and big game species. Fire dependent wildlife species would benefit from landscape burning. Watershed...
2012-02-17
.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and... mammals, and big game species. Fire dependent wildlife species would benefit from landscape burning...
77 FR 775 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project
2012-01-06
.... Shifting tree species composition by retaining and planting early seral species (i.e. ponderosa pine... such as insect, disease, and fire. Historical logging practices and fire suppression have created a... habitats by retaining large trees and promoting establishment of tall shrubs and hardwood tree by using...
2012-02-09
... patterns that more closely emulate natural mixed severity disturbance. Shifting tree species composition by... logging practices and fire suppression have created a landscape that is more highly fragmented than what... management would increase high quality early seral wildlife habitats by retaining large trees and promoting...
South Fork Salmon River Watershed Restoration, 2008-2009 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Reaney, Mark D. [Nez Perce Tribe Department of Fisheries Resource Management
2009-04-15
The watershed restoration work elements within the project area, the South Fork Salmon River Watershed, follow the watershed restoration approach adopted by the Nez Perce Tribe Department of Fisheries Resource Management (DFRM) - Watershed Division. The vision of the Nez Perce Tribe DFRM-Watershed Division focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects and strategies that rely on natural fish production and healthy river ecosystems. The Nez Perce Tribe DFRM-Watershed Division strives towards maximizing historic ecosystem productivity and health for the restoration of anadromous and resident fish populations and the habitat on which all depend on for future generations Originally, this project was funded to create a step/pool stream channel that was appropriate to restore fish passage where the 'Glory Hole Cascade' is currently located at the Stibnite Mine. Due to unforeseen circumstances at the time, the project is unable to move forward as planned and a request for a change in scope of the project and an expansion of the geographic area in which to complete project work was submitted. No additional funds were being requested. The ultimate goal of this project is to work with the holistic, ridge top to ridge top approach to protect and restore the ecological and biological functions of the South Fork Salmon River Watershed to assist in the recovery of threatened and endangered anadromous and resident fish species. FY 2008 Work Elements included two aquatic organism passage (AOP) projects to restore habitat connectivity to two fish-bearing tributaries to the East Fork South Fork Salmon River, Salt and Profile Creeks. The Work Elements also included road survey and assessment
Bisbee, Yolanda J. Guzman
2013-01-01
This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…
Energy Technology Data Exchange (ETDEWEB)
Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)
1998-06-01
Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.
Trophic structure and mercury biomagnification in tropical fish assemblages, Iténez River, Bolivia.
Directory of Open Access Journals (Sweden)
Marc Pouilly
Full Text Available We examined mercury concentrations in three fish assemblages to estimate biomagnification rates in the Iténez main river, affected by anthropogenic activities, and two unperturbed rivers from the Iténez basin, Bolivian Amazon. Rivers presented low to moderate water mercury concentrations (from 1.25 ng L(-1 to 2.96 ng L(-1 and natural differences in terms of sediment load. Mercury biomagnification rates were confronted to trophic structure depicted by carbon and nitrogen stable isotopes composition (δ(15N; δ(13C of primary trophic sources, invertebrates and fishes. Results showed a slight fish contamination in the Iténez River compared to the unperturbed rivers, with higher mercury concentrations in piscivore species (0.15 µg g(-1 vs. 0.11 µg g(-1 in the unperturbed rivers and a higher biomagnification rate. Trophic structure analysis showed that the higher biomagnification rate in the Iténez River could not be attributed to a longer food chain. Nevertheless, it revealed for the Iténez River a higher contribution of periphyton to the diet of the primary consumers fish species; and more negative δ(13C values for primary trophic sources, invertebrates and fishes that could indicate a higher contribution of methanotrophic bacteria. These two factors may enhance methylation and methyl mercury transfer in the food web and thus, alternatively or complementarily to the impact of the anthropogenic activities, may explain mercury differences observed in fishes from the Iténez River in comparison to the two other rivers.
Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana
2007-01-01
The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…
Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.
Energy Technology Data Exchange (ETDEWEB)
Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.
2000-04-01
Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in
Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)
1999-03-01
Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.
Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook
2018-05-01
Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.
Directory of Open Access Journals (Sweden)
Rafaél Maya
1979-10-01
Full Text Available La aparición de Aurelio Martínez Mutis en el escenario de las letras colombianas, hace unos treinta y cinco años, más o menos, fue súbita y fulgurante. Su "Epopeya del Cóndor", poesía premiada en el concurso abierto por la revista Mundial, que dirigía en París Rubén Darío, lo hizo célebre, de la noche a la mañana, entre los pueblos de habla hispana.
A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor
Sousa, Vasco Monteiro Carvalho de
2016-01-01
O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...
PERC 2 High-End Computer System Performance: Scalable Science and Engineering
Energy Technology Data Exchange (ETDEWEB)
Daniel Reed
2006-10-15
During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.
2013-07-11
... pursuant to the 2012 Forest Planning Rule. This process will ultimately result in a Forest Land Management... Planning Rule) which implements the NFMA. Forest Plans describe the strategic direction for management of... is the first phase of the planning process. Only informal public input is required at this stage (36...
DEFF Research Database (Denmark)
Jensen, Kim Ebensgaard
2014-01-01
A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)......A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)...
An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons
International Nuclear Information System (INIS)
Tano, M.L.; Powankee, D.; Lester, A.D.
1995-01-01
The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)
Energy Technology Data Exchange (ETDEWEB)
Williams, John G.; Bjornn (Bjomn), Theodore C.
1998-05-01
In 1996, the National Marine Fisheries Service, the Nez Perce Tribe, and the U.S. Fish and Wildlife Service completed the second year of cooperative research to investigate migrational characteristics of subyearling fall chinook salmon in the Snake River Basin. In spring and early summer, we captured natural subyearling fall chinook salmon by beach seine, PIT tagged them, and released them in two reaches of the Snake River. Also, subyearling fall chinook salmon reared at Lyons Ferry Hatchery were PIT tagged at the hatchery, transported, and released weekly at Pittsburg Landing on the Snake River and Big Canyon Creek on the Clearwater River to collect data on survival detection probabilities, and travel time.
Fish Passage Assessment: Big Canyon Creek Watershed, Technical Report 2004.
Energy Technology Data Exchange (ETDEWEB)
Christian, Richard
2004-02-01
This report presents the results of the fish passage assessment as outlined as part of the Protect and Restore the Big Canyon Creek Watershed project as detailed in the CY2003 Statement of Work (SOW). As part of the Northwest Power Planning Council's Columbia Basin Fish and Wildlife Program (FWP), this project is one of Bonneville Power Administration's (BPA) many efforts at off-site mitigation for damage to salmon and steelhead runs, their migration, and wildlife habitat caused by the construction and operation of federal hydroelectric dams on the Columbia River and its tributaries. The proposed restoration activities within the Big Canyon Creek watershed follow the watershed restoration approach mandated by the Fisheries and Watershed Program. Nez Perce Tribal Fisheries/Watershed Program vision focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects. We strive toward maximizing historic ecosystem productive health, for the restoration of anadromous and resident fish populations. The Nez Perce Tribal Fisheries/Watershed Program (NPTFWP) sponsors the Protect and Restore the Big Canyon Creek Watershed project. The NPTFWP has the authority to allocate funds under the provisions set forth in their contract with BPA. In the state of Idaho vast numbers of relatively small obstructions, such as road culverts, block thousands of miles of habitat suitable for a variety of fish species. To date, most agencies and land managers have not had sufficient, quantifiable data to adequately address these barrier sites. The ultimate objective of this comprehensive inventory and assessment was to identify all barrier crossings within the watershed. The barriers were then prioritized according to the
El Profesor Académico, Dr. Pablo Gómez Martínez.
Directory of Open Access Journals (Sweden)
Zoilo Cuéllar-Montoya
2007-12-01
Más adelante, en la misma Presidencia de la Academia del Profesor Pedro José Almánzar Vargas (1963 – 1965, fue promovido Gómez Martínez a la categoría de Miembro de Número(2,10 con el trabajo “Ilio-cisto-plastia con colgajo sero-muscular invertido y reconstrucción de vejigas funcionales” (2,11. En la sesión ordinaria de la Academia del día 12 de marzo de 1964, el Académico Correspondiente Gómez Martínez presentó el trabajo mencionado(2,12 y, en la sesión ordinaria del día 14 de mayo de 1964, en virtud de haber quedado vacantes las sillas de los Señores Académicos de Número Jaime Jaramillo Arango, fallecido en Bogotá, el 31 de julio de 1962(2,13, Manuel José Luque Guevara, retirado por precarias condiciones de salud(2,14, y Fernando Torres Restrepo, trasladado definitivamente a los Estados Unidos(2,15, la Academia, en votación secreta, eligió, como Miembros de Número, a los Señores Académicos Correspondientes Pablo Gómez Martínez, Alfredo Artunduaga y J. Hernando Hernández Garay(2,16...
Genetic diversity and conservation of Picea chihuahuana Martínez ...
African Journals Online (AJOL)
SAM
2014-07-09
Jul 9, 2014 ... individuals within a population and among populations within a species. Hence ... risks related to loss of species, populations and genetic resources; c) ... this spruce and two other congeners, Picea mexicana. Martínez and Picea .... high levels of self-fertilization and mating between closely related ...
Loyola University distingue al Ing. Martínez
Lezcano, Liseth
2011-01-01
El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.
Genetic diversity and conservation of Picea chihuahuana Martínez ...
African Journals Online (AJOL)
The conservation of genetic diversity in tree populations is an essential component of sustainable forest management. Picea chihuahuana Martínez is an endemic conifer species in Mexico and is considered to be endangered. P. chihuahuana covers a total area of no more than 300 ha at the Sierra Madre Occidental, ...
Več kot predgovor: "urednik" Pepite Jiménez:
Fock, Ignac
2014-01-01
The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) "editor". Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator - ficti...
Controversy, Conflict and Compromise: A History of the Lower Snake River Development
1994-01-01
river, farmers cultivated the loess-covered hills, and ranchers grazed sheep and cattle in the Channeled Scablands. Towns grew up to serve the...North America, the Nez Perce and Palouse practiced selective breeding. They castrated poorer stallions and traded inferior stock to neighboring...rains," making it impossible for "some kinds of grain [to] flourish," he noted that cattle and horses grew fat on the rich bunchgrass, and, like Lewis
International Nuclear Information System (INIS)
Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo
2006-01-01
To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi
Directory of Open Access Journals (Sweden)
Teresa Cabruja-Ubach
2014-12-01
Full Text Available Se trata de una reseña de la “Guía para incorporar la perspectiva de género a la investigación en salud” de María del Mar García Calvente , María Luisa Jiménez rodrigo y Emilia Martínez Morante, de la Escuela Andaluza de Salud Pública, 2010, que consiste en un documento de ayuda a la investigación en salud pues a partir de exponer los sesgos androcéntricos y patriarcales de la investigación en salud, organiza un sistema de buenas prácticas para cada uno de los pasos en el proceso de investigación. Trabajo muy riguroso e indispensable para colaborar en una investigación y atención en la salud más justa e igualitaria.
Directory of Open Access Journals (Sweden)
Elisa Kern de Castro
2015-07-01
Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.
Las “Historias ilustrativas de la violencia” de Edilberto Jiménez: narrativa, testimonio y memoria
Directory of Open Access Journals (Sweden)
Elisa Cairati
2013-06-01
Full Text Available This work aims to analyse the cultural contents and aesthetic position of Edilberto Jiménez Quispe’s illustrations of the age of violence, presented in Chungui: violencia y trazos de memoria (Lima, 2009. Jiménez, through the plastic and figurative traditional style, makes public the concealed and denied memory of the Internal Armed Conflict. The combination of testimonies and paintings is concerned as an emotional significance of memory: a space of re-established dialogue after the age of violence, in the direction of the elaboration of identity in the region of Ayacucho.
Martínez Sanabria en un país de artesanos
Jimena Montaña Cuéllar
2011-01-01
De la arquitectura orgánica a la arquitectura del lugar en las casas Wilkie (1962) y Calderón (1963) de Fernando Martínez Sanabria. Germán Darío Rodríguez Botero. Universidad Nacional de Colombia (Sede Bogotá), Facultad de Artes, Colección Punto aparte, Bogotá, 2007, 232 págs.
Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin
2015-01-01
ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...
Directory of Open Access Journals (Sweden)
Diego Augusto Santos Silva
2012-06-01
Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.
International Nuclear Information System (INIS)
Blutke, A.S.; Vavruska, J.S.; Serino, J.F.
1996-01-01
Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment
Lago artificial de Martiánez Canarias – España
Directory of Open Access Journals (Sweden)
Amigó, Juan A.
1980-06-01
Full Text Available In this article a technical description is given of the works of the Artificial Lake of Martiánez.
This work that was executed after gaining some 33,000 m2 from the sea mainly consisted of creating a small artificial lake of seawater surrounded by solariums, beaches and gardens.
Inside the lake — that has an area of some 15,000 m2 — five natural islands were formed, most of which have tourist complexes built on them, consisting of: night club, restaurants, bars, terraces, etc.
En este artículo se hace una descripción técnica de las obras del Lago Artificial de Martiánez.
Esta obra, realizada tras ganar al mar unos 33.000 m2 consistió, principalmente, en la creación de un pequeño lago artificial de agua de mar rodeado de solarios, playas y jardines.
En el interior del lago —cuya superficie es de unos 15.000 m2— se formaron cinco islas naturales, en la mayor de las cuales se construyó un complejo turístico que consta de: sala de fiestas, restaurantes, bares, terrazas, etc.
Libertad e inconformismo: sobre la concepción del relato de José Jiménez Lozano
Directory of Open Access Journals (Sweden)
Moreno González, Santiago
2010-12-01
Full Text Available José Jiménez Lozano is a unique writer in the Hispanic literary scene of these last decades. His work is vast and diverse, and this initial observation does not escape his narrative, which genre the write demonstrates more prolifically. Despite the apparent diversity, there is outstanding unity underlying Jiménez Lozano´s entire work. This unity lies not only on the constant return to the same matters, but also on the approaches or the reasons, from which his literary work begins. The writer reflects over his work and lets his ideas expand through the diverse manifestations of his ideas on prose. It is a talk about the rhetorical writing of this article, valuing the coherent existence between reflection and literary practice.José Jiménez Lozano es un escritor singular dentro del panorama literario hispánico de las últimas décadas. Su obra es vasta y diversa y a esta observación inicial no escapa su narrativa, género en el que el escritor se muestra más prolífico. A pesar de la diversidad aparente, existe una notable unidad subyacente a toda la obra de Jiménez Lozano. Esta unidad reposa no sólo sobre el regreso constante a unos mismos asuntos sino también sobre los planteamientos o fundamentos de los que parte su creación literaria. El escritor reflexiona sobre su labor y deja diseminado, a través de las diversas manifestaciones de su prosa de ideas, un discurso sobre la escritura que este artículo sintetiza, valorando, asimismo, la coherencia existente entre esta reflexión y la praxis literaria.
El acontecimiento en el cuento: nueva lectura de José Jiménez Lozano
Martínez-Illán, A. (Antonio)
2010-01-01
Se reseña un libro que estudia como un todo los cuentos de Jiménez Lozano publicados hasta la fecha (y, en particular, La Piel de los tomates) a la luz de una teoría del cuento desde la categoría del acontecimiento.
Big Canyon Creek Ecological Restoration Strategy.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn; Richardson, Shannon
2007-10-01
He-yey, Nez Perce for steelhead or rainbow trout (Oncorhynchus mykiss), are a culturally and ecologically significant resource within the Big Canyon Creek watershed; they are also part of the federally listed Snake River Basin Steelhead DPS. The majority of the Big Canyon Creek drainage is considered critical habitat for that DPS as well as for the federally listed Snake River fall chinook (Oncorhynchus tshawytscha) ESU. The Nez Perce Soil and Water Conservation District (District) and the Nez Perce Tribe Department of Fisheries Resources Management-Watershed (Tribe), in an effort to support the continued existence of these and other aquatic species, have developed this document to direct funding toward priority restoration projects in priority areas for the Big Canyon Creek watershed. In order to achieve this, the District and the Tribe: (1) Developed a working group and technical team composed of managers from a variety of stakeholders within the basin; (2) Established geographically distinct sub-watershed areas called Assessment Units (AUs); (3) Created a prioritization framework for the AUs and prioritized them; and (4) Developed treatment strategies to utilize within the prioritized AUs. Assessment Units were delineated by significant shifts in sampled juvenile O. mykiss (steelhead/rainbow trout) densities, which were found to fall at fish passage barriers. The prioritization framework considered four aspects critical to determining the relative importance of performing restoration in a certain area: density of critical fish species, physical condition of the AU, water quantity, and water quality. It was established, through vigorous data analysis within these four areas, that the geographic priority areas for restoration within the Big Canyon Creek watershed are Big Canyon Creek from stream km 45.5 to the headwaters, Little Canyon from km 15 to 30, the mainstem corridors of Big Canyon (mouth to 7km) and Little Canyon (mouth to 7km). The District and the Tribe
Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana
2015-11-27
As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and
Directory of Open Access Journals (Sweden)
Armiche Carrillo Delgado
2015-06-01
Full Text Available Aunque tradicionalmente se consideró a los cómics como un simple entretenimiento juvenil, lo cierto es que en realidad constituyen una herramienta para la transmisión de concepciones ideológicas y valores. A través del análisis de la obra de Carlos Giménez, publicada en El Papus, veremos como la historieta es perfectamente capaz de convertirse en una forma de lucha ideológica.Although traditionally considered to comics as a mere youth entertainment, the truth is that actually constitute a tool for the transmission of values and ideological concepts. Through the analysis of the work of Carlos Giménez, published in El Papus, we see how the comic-strip is perfectly capable of becoming a form of ideological struggle.
CERT tribal internship program. Final intern report: David Conrad, 1993
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
The intern`s report contains a Master`s thesis entitled, ``An implementation analysis of the US Department of Energy`s American Indian policy as part of its environmental restoration and waste management mission.`` This thesis examines the implementation of a working relationship between the Nez Perce Tribe and the US Department of Energy`s Office of Environmental Restoration and Waste Management at the Hanford reservation. It examines the relationship using a qualitative methodology and three generations of policy analysis literature to gain a clear understanding of the potential for successful implementation.
Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634
Directory of Open Access Journals (Sweden)
Coello de la Rosa, Alexandre
2009-06-01
Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.
Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V
2015-10-13
Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Tania Diz
2016-11-01
Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.
More than a Preface: the »Editor« of Pepita Jiménez
Ignac Fock
2014-01-01
The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) “editor”. Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator – ficti...
An Indian tribal view of the back end of the nuclear fuel cycle: Historical and cultural lessons
International Nuclear Information System (INIS)
Tano, M.L.; Reuben, J.H.; Powaukee, D.; Lester, A.D.
1996-01-01
Indian tribes of the western United States, including the Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and the Yakama Indian Nation, have entered into cooperative agreements with the U.S. Department of Energy to oversee the cleanup of the Hanford Reservation, in Washington state. These and other tribes considering involvement in nuclear waste management programs have been subjected to severe criticism from some Indians and non-Indians, accusing them of aiding and abetting the violation of Mother Earth by acquiescing in the contamination of lands by radioactive wastes. We'd like to suggest that this view of the Indian relationship to nature and the environment is too narrow. While the purpose of this article is not to suggest that Indian beliefs support the location of waste management facilities on Indian lands, we will describe aspects of Indian religion and culture that support tribal involvement in radioactive waste management and environmental restoration, and participation in radioactive waste management decision making
Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O
2016-03-01
The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.
Directory of Open Access Journals (Sweden)
Aline Vauchelle-Haquet
2006-12-01
Full Text Available In 1830, the philologist Pedro Martínez López was forced to go into exile in France for political reasons. In 1832, he published Representación a Fernando VII, rey de España, a lampoon in which he made a whole string of accusations against the tyrant. At the end of the following year, he published España en 1833, al expirar Fernando VII, another lampoon in which he blamed the king's despotic reign for the country's disastrous situation and asserted that such abuses and injustices could only be remedied by re-establishing the Constitution of Cádiz of 1812. In 1834, he ceased to rail against his political enemies, changed strategy, and using his considerable imagination, wrote a kind of fable entitled Una noche en el infierno, vista entre sueños. With a mixture of humour and acid wit, it told of how all the devils in the Kingdom of Darkness, embracing the «sacred» cause of liberalism, vented their anger on the deceased Ferdinand and his followers, who were still in power. It would appear that the work was a success, since it was republished in 1836. In 1835, disillusioned with the tepid and conservative liberal regime of the Estatuto Real, Martínez López wrote another story, Las Brujas en Zugarramurdi, in which different satanic creatures, this time sorceresses, take it upon themselves to defeat moderantismo and establish a progressive regime. After this, he ceased to publish lampoons and political parables and devoted himself to producing learned works, bringing out various dictionaries and grammars which were republished several times. | En 1830, el filólogo Pedro Martínez López tuvo que exiliarse a Francia por motivos políticos. En 1832, sacó a luz en Burdeos una Representación a Fernando VII, rey de España, panfleto en el que espetaba toda una sarta de acusaciones contra el tirano. A finales del año siguiente, publicó La España en 1833, al expirar Fernando VII, otro libelo en que responsabilizaba al despotismo de la
New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856
Directory of Open Access Journals (Sweden)
José Manuel Izquierdo König
2017-07-01
Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.
La influencia de Javier Marías en la traducción española de Martínez-Lage de Absalom, Absalom!
Alpuente Civera, Miguel; Marco Borillo, Josep; Martínez Vilinsky, Bárbara
2013-01-01
En el posfacio a su traducción de Absalom, Absalom!, Miguel Martínez-Lage declara haber tomado como «modelos estilísticos» a aquellos narradores en lengua española cuya prosa muestra sin lugar a dudas la influencia de Faulkner. En el presente artículo nos proponemos identificar, en primer lugar, los rasgos de estilo comunes a la traducción de Martínez-Lage y a uno de los modelos estilísticos mencionados –la novela Fiebre y lanza, de Javier Marías– y, en segundo lugar, los aspectos de la tradu...
Vida y obra de Luis Jiménez Moreno (1929-2007
Directory of Open Access Journals (Sweden)
Antonio Jiménez García
2008-10-01
Full Text Available Luis Jiménez Moreno passed away on 27 of October, 2007, 77 years old. For the last 30 years he was professor at Universidad Complutense de Madrid. He became Full Professor. He had studied in Salamanca, Roma, Valencia and München. He got a Ph. Degree whith a tesis about Nietzsche`s Antropological Thought by leading of José Luis López Aranguren. He was High School Teacher in Andujar, Ávila and Badalona; after he was professor at Universities of Barcelona and Madrid. This article develops information about his life and his works: books, articles, essays, conferences, papers to Congress, Symposios, Scientic meetings…
Realismo, margen y fragmentariedad en la narrativa de Ezequiel Martínez Estrada
Gasillón, María Lourdes
2012-01-01
En primer lugar, este trabajo intenta analizar los ensayos escritos por Ezequiel Martínez Estrada sobre Franz Kafka (1967) para luego reconocer sus influencias en el concepto de lo real y realismo en sus propias narraciones ficcionales. En este caso, se abordará uno de sus cuentos más conocidos, “Marta Riquelme”, que construye discursivamente una imagen de lo/s otro/s en distintos planos textuales: autor, narrador, organización, género, personajes, etc. Tanto el ensayista argentino como el es...
Directory of Open Access Journals (Sweden)
María Alegra García García
2014-02-01
Full Text Available Juan Martínez Siliceo (c. 1477-1557 was a Roman Catholic cardinal and archbishop and a distinguished humanist and mathematician who played an important role in the History and culture of Toledo and Spain during the 16th century. Furthermore, he was admired and recognized even after his death thanks to different literary sources and historiography. This article aims to approach his iconography through a selection of the most important literary and artistic sources from the 16th and 17th Centuries.Juan Martínez Silíceo (c.1477-1557, además de cardenal y arzobispo de Toledo, fue un importante humanista y matemático que desempeñó un destacado papel en la historia y cultura del Toledo y la España del siglo XVI y que gozó de gran admiración y reconocimiento más allá de su muerte, tal como evidencian las fuentes literarias y la historiografía posterior. Sin embargo, aún quedan pendientes de estudio pormenorizado algunos aspectos relativos a su relación con las artes. Este artículo pretende plantear un primer acercamiento a la iconografía de Silíceo a través de una selección de las fuentes literarias y visuales de los siglos XVI al XVIII consideradas más relevantes.
Enfermedad y muerte de Don Gonzalo Jiménez de Quesada
Directory of Open Access Journals (Sweden)
Fernando Serpa Florez
1997-12-01
Full Text Available
La lepra es una enfermedad que se caracteriza por la insidia de su presencia, su lenta evolución y la progresiva incapacidad que en sus víctimas causa.
Esto y el temor que ha infundido desde tiempos bíblicos, han hecho que ante ella se haya mantenido una actitud ambivalente de negación hasta donde es posible y de rechazo irracional a quien la padece, por temor al contagio.
Ejemplo de ello es el aura de sagrado misterio que envuelve la leyenda de los padecimientos del Adelantado don Gonzalo Jiménez de Quesada (1509-1579, conquistador del Nuevo Reino de Granada y fundador de Santafé de Bogotá en el año de 1538, muerto a la edad, avanzada para la época, de setenta años.
No se puede afirmar, en forma definitiva, que el conquistador fuera leproso. Se acepta, acogiendo el argumento de autoridad que tiene el primer historiador médico entre nosotros, don Pedro María Ibáñez, quien escribió en 1884, en las Memorias para la Historia de la Medicina en Santa Fe, que en “1579 falleció en la ciudad de Mariquita, y de mal de lepra o elefancía de los
Coincide ello con lo que consigna don José María Vergara y Vergara en su Cuadro Cronológico de la Nueva Granada (hoi Estados Unidos de Colombia, desde los cipas hasta nuestros días (se ha conservado la ortografía usada a mediados del siglo XIX, preconizada por don Andrés Bello, estudio publicado en 1866, en que informa que a poco de posesionarse el tercer Presidente del Nuevo Reino, don Lope Díez Aux de Armendáriz: “ocurrió la muerte del adelantado Gonzalo Jiménez de Quesada que tuvo lugar en Mariquita el 16 de febrero de 1579, a la edad de ochenta años no cumplidos (sic, i de enfermedad de lepra (…” (2.
Estos conceptos fueron debatidos por contemporáneos de Vergara y de Ibáñez como el doctor Juan de Dios Carrasquilla aduciendo, entre otros argumentos, que la lepra no fue mencionada por los coetáneos del conquistador. Y que la sífilis, com
Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João
2017-10-01
Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Salmon and the Adaptive Capacity of Nimiipuu (Nez Perce) Culture to Cope with Change
Colombi, Benedict J.
2012-01-01
Change due to natural disturbances and disasters, population growth and decline, economic crises, and environmental and climate change creates significant cultural challenges. Rapid change and the transformation it brings also involve complex relationships between sovereign tribes, resources, and the global system. This article explores how salmon…
Trayectos de lectura de Espacio, de Juan Ramón Jiménez
Luján Atienza, Ángel Luis
2013-01-01
El estudio de Espacio, de Juan Ramón Jiménez, a partir de la teoría cognitiva de las metáforas conceptuales y la fusión de dominios conceptuales (blending), en confluencia con la filosofía heideggeriana, descubre en el poema dos movimientos contradictorios: el de la fuga y de la búsqueda de un centro, que se pueden poner en relación con dos trayectos de lectura y dos tendencias hermenéuticas: la modernista y la post-modernista. En este contexto se tratan de explicar las paradojas y complejida...
Leoncio Martínez Un personaje que marcó pauta en la disidencia
Omaira Zambrano Roa
2014-01-01
Cuando se analiza la historia política de un país, se observa énfasis en el estudio de sus períodos gubernamentales y en sus partidos políticos, en los cuales existen personajes que marcaron pauta en su desarrollo de la Nación. Durante la dictadura del general Juan Vicente Gómez (1908-1935) uno de estos personajes característicos fue Leoncio Martínez, quien ostenta entre sus labores más conocidas la fundación del semanario humorístico Fantoches junto a Francisco Pimentel (Job Pim). En el año...
Perceções de carreira e de sucesso em função do género
Tocalino, Renata Leone Pio Galveia
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...
Directory of Open Access Journals (Sweden)
Javier Muñoz Soro
2006-12-01
Full Text Available The biography of Joaquín Ruiz-Giménez is a virtual paradigm of two historical phenomena which distinguished the last two decades of the Franco regime and, to a large extent, paved the way for the future democracy: on the one hand, the rift between Catholic and Falangist intellectuals and the regime which they had enthusiastically helped to establish after the civil war; and on the other, the secularization of its political thinking and practice. Ruíz-Giménez, ambassador and minister under Franco, was an exception among the Catholic laity that collaborated with the dictatorship, in that he held high government positions and, despite all the reservations concerning his personal development, for many of his peers as well as many aspiring figures of the coming generations, he symbolized the definitive renunciation of all legitimacy of power based on victory in battle or on Catholic natural law, and the definitive adoption of the language of human rights and democracy. | La biografía de Joaquín Ruiz-Giménez representa casi de manera paradigmática dos fenómenos históricos que caracterizaron las dos últimas décadas del franquismo y sentaron, en buena medida las bases de la futura democracia: por un lado, el alejamiento de los intelectuales católicos y falangistas respecto al régimen que habían contribuido a levantar con entusiasmo tras la guerra civil; por otro, la secularización de su pensamiento y práctica política. Ruiz-Giménez, embajador y ministro de Franco, fue una excepción entre los seglares católicos que colaboraron con la dictadura desempeñando altas responsabilidades de gobierno y, pese a todas las cautelas de su evolución personal, simbolizó para bastantes compañeros de su generación, así como para muchos jóvenes alumnos de las nuevas generaciones, la renuncia definitiva a toda legitimación del poder basada en la victoria de las armas o en el iusnaturalismo católico y la adopción irreversible del lenguaje de
International Nuclear Information System (INIS)
Ashe, B.L.; Miller, A.C.; Kucera, P.A.; Blenden, M.L.
1995-01-01
In 1994, the Nez Perce Tribe began a smolt monitoring study on the Imnaha River in cooperation with the Fish Passage Center (FPC). A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from March 1 to June 15, 1994. We PIT tagged and released 956 wild chinook salmon, 661 hatchery chinook salmon, 1,432 wild steelhead trout and 2,029 hatchery steelhead trout. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 62.2% for wild chinook salmon, 45.2% for hatchery chinook salmon, 51.3% for wild steelhead trout, and 34.3% for hatchery steelhead trout
Directory of Open Access Journals (Sweden)
Victor Aguilar-Soto
2015-03-01
Full Text Available Species distribution models (SDMs help identify areas for the development of populations or communities to prevent extinctions, especially in the face of the global environmental change. This study modeled the potential distribution of the tree Picea chihuahuana Martínez, a species in danger of extinction, using the maximum entropy modeling method (MaxEnt at three scales: local, state and national. We used a total of 38 presence data from the Sierra Madre Occidental. At the local scale, we compared MaxEnt with the reclassification and overlay method integrated in a geographic information system. MaxEnt generated maps with a high predictive capability (AUC > 0.97. The distribution of P. chihuahuana is defined by vegetation type and minimum temperature at national and state scales. At the local scale, both models calculated similar areas for the potential distribution of the species; the variables that better defined the species distribution were vegetation type, aspect and distance to water flows. Populations of P. chihuahuana have always been small, but our results show potential habitat greater than the area of the actual distribution. These results provide an insight into the availability of areas suitable for the species’ regeneration, possibly through assisted colonization.
Ces silences de la narration qui rapprochèrent Jean Giono et Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Dominique Bonnet
2010-01-01
Full Text Available This article intends to show how JeanGiono discovered a purity of writing inJuan Ramón Jiménez that he practicedhimself in his elliptical narratives. Thus,this purifying desire that both sought intheir writings would be one of the commonpoints that would persuade Jean Giono todo the film adaptation of Platero y yo.
En memoria de Michael Jiménez (1948-2001
Directory of Open Access Journals (Sweden)
Mauricio Archila Neira
2001-01-01
Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.
El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda
Directory of Open Access Journals (Sweden)
Calvo López, José
2009-03-01
Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.
El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.
Directory of Open Access Journals (Sweden)
Michael J. Drescher
2017-09-01
Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Directory of Open Access Journals (Sweden)
Elisabete Matos Freitas
2015-05-01
Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.
Directory of Open Access Journals (Sweden)
Amán Rosales Rodríguez
2010-01-01
Full Text Available The purpose of this paper is to critically review some of the main theoretical tenets in Ezequiel Martínez Estrada’s pessimistic stance about the Argentinean history and society of his time. Focusing on his critical remarks about the so-called «literatura o poesía gauchesca» as well as on his enthusiastic assessment of José Hernández’ Martín Fierro, the achievements and missing points in Martínez Estrada’s skeptical diagnosis will be underlined and put in broader philosophical context. For the Argentinean writer the controversial notion of a “superimposed reality” – as he infers its existence from the Martín Fierro – captures a kind of ambivalent metaphysical concurrence among the literary creation, the geographical setting and the sociopolitical state of the country.
International Nuclear Information System (INIS)
Johnson, B.J.Bradley J.
2002-01-01
The Asotin County Conservation District (ACCD) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in Water Resource Inventory Area (WRIA) 35. According to Washington Department of Fish and Wildlife's (WDFW) Priority WRIA's by ''At-Risk Stock Significance Map'', it is the highest priority WRIA in southeastern Washington. Summer steelhead, bull trout, and Snake River spring chinook salmon which are listed under the Endangered Species Act (ESA), are present in the watershed. WDFW manages it as a Wild Steelhead Reserve; no hatchery fish have been released here since 1997. The ACCD has been working with landowners, Bonneville Power Administration (BPA), Washington State Conservation Commission (WCC), Natural Resource Conservation Service (NRCS), Washington Department of Fish and Wildlife (WDFW), U.S. Forest Service, Pomeroy Ranger District (USFS), Nez Perce Tribe, Washington Department of Ecology (DOE), National Marine Fisheries Service (NMFS), and U.S. Fish and Wildlife Service (USFWS) to address habitat projects in Asotin County. Local students, volunteers and Salmon Corps members from the Nez Perce Tribe have been instrumental in the success of the Model Watershed Program on Asotin Creek. ACCD began coordinating habitat projects in 1995 with the help of BPA funding. Approximately two hundred and seventy-six projects have been implemented as of 1999. The Washington State Legislature was successful in securing funding for endangered salmon and steelhead recovery throughout the State in 1998. While these issues were new to most of the State, the ACCD has been securing and administering funding for endangered salmonids since 1994. The ''Asotin Creek Riparian Planting 2000-053-00 and Asotin Creek Riparian Fencing 2000-054-00'' teamed BPA and the Governor's Salmon Recovery Funding to plant approximately 84
International Nuclear Information System (INIS)
Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.
1997-04-01
For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts
International Nuclear Information System (INIS)
Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.
1997-01-01
For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts
Napal, María Celeste
2016-01-01
Napal, M. C. (2016). La presidencia de María Estela Martínez de Perón: la búsqueda de legitimidad y la descalificación del “otro” (1974-1976). Divulgatio, 1(1). El presente artículo busca analizar, a través de los discursos presidenciales, la imagen que la presidente María Estela Martínez de Perón (Isabel) construye del “otro” no partidario en un contexto político en el que se ve cuestionada su propia legitimidad. Partimos de la idea de que el período de su presidencia (1° de julio de 1974...
Directory of Open Access Journals (Sweden)
Gutiérrez Pastor, Ismael
2005-09-01
Full Text Available Por adquisición en el comercio de antigüedades francés se conserva en una colección particular de Bilbao el Retrato de una niña (fig. 2, pintura de carácter velazqueño, que puede ser clasificada perfectamente como obra indiscutible del pintor Juan Bautista Martínez del Mazo (¿Beteta?, Cuenca, 1611-Madrid, 1667, tanto por la característica soltura técnica, como por tratarse de uno de los modelos infantiles que aparecen en el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena (fig. 3, en relación con la cual se conoce otro Retrato de Luis Martínez del Mazo conservado en la Dulwich Picture Gallery de Londres (fig. 1. La importancia de la obra es notable no sólo porque incrementa el catálogo de Martínez del Mazo con una obra indudable, sino también por contribuir a precisar la cronología de la pintura conservada en Viena...
Energy Technology Data Exchange (ETDEWEB)
Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)
2003-07-01
Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.
Francisco Ibarra Martínez: renovador de la pedagogía cubana
Directory of Open Access Journals (Sweden)
Lic. Osmar Oliva-Crespo
2015-10-01
Full Text Available The article entitled Francisco Ibarra Martínez: reformer of Cuban Pedagogy, is first of all a well deserved homage to one of the most important pedagogues of the republican period. His thought and his work are approached, from his initial stage of academic formation to his contributions to the educational cuban thought. Stands out his social dimension of his pedagogic work, his integration to the civic life of the city, his reforming vision of the practice of sports and study of the history of his country. Likewise, we refer to his contributions to the historiography as a science, the journalism and his concern for the social and political destination of the country. For this reason this work has among its contributions the treatment to the local history from the specific fild of pedagogy and education, modestly contributing to the rescue of historic memory.
Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica
Lobato, Filipa
2012-01-01
Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...
Chemins de traverse d’Ignacio Martínez de Pisón, roman de l’absence, roman de l’amour
Directory of Open Access Journals (Sweden)
André-Alain Morello
2012-08-01
Full Text Available Chemins de traverse d’Ignacio Martínez de Pisón se présente comme la pseudo autobiographie d’un adolescent, Felipe, qui, à la mort de sa mère, est condamné à vivre avec un père marginal. Le texte est aussi la conversion d’un récit de type picaresque en un roman qui débouche sur la découverte mutuelle d’un père et d’un fils. L’errance des deux personnages, chemin de fuite destiné à compenser la disparition de Cecilia, conduit à une sorte d’assomption de l’amour.Caminos secundarios, de Ignacio Martínez de Pisón, se presenta como la supuesta autobiografía de un adolescente, Felipe, quien, a la muerte de su madre, se ve forzado a vivir con un padre marginal. El texto es también la evolución de una narración de carácter picaresco hacia una novela que desemboca en el descubrimiento mutuo entre padre e hijo. El vagabundeo de ambos personajes, escape y consuelo por la desaparición de Cecilia, lleva a una forma de exaltación amorosa.
Directory of Open Access Journals (Sweden)
M.ª Belén Piqueras García
2013-12-01
Full Text Available The present study is centered in the analysis of the Inventory of valuable objects of Juan Martínez, Jerez de la Frontera notary public during the first half of 15th century; Persecuting to bring to light this document from notarial type, until now unpublished, that approached its content and diplomatic analysis.
Directory of Open Access Journals (Sweden)
Guadalupe Arbona Abascal
2017-01-01
Full Text Available This paper analyzes the writing process of José Jiménez Lozano’s Retorno de un cruzado (2013, his 24th novel. First, taking into account the author’s comments about the creation of the text, it presents the different versions and the literary reasons for his final choice. Second, literary intertextualities found in the novel are examined. Finally, the condition of the main character as storyteller is identified as the novel’s major source of originality.
Diiagnóstico económico y financiero de Electrónica Martínez de Cartagena
García García, Nuria
2015-01-01
Este Trabajo Fin de Máster está incluido en los estudios del Máster en Contabilidad y Finanzas Corporativas realizados en la Universidad Politécnica de Cartagena en el curso académico 2014-2015. El objetivo principal de este proyecto es realizar un análisis económico y financiero de la empresa Electrónica Martínez de Cartagena, S.L. en el periodo de 2008 a 2013, mediante la utilización de una serie de técnicas estudiadas a lo largo de la carrera y perfeccionadas durante el M...
(ReConstrução Mítica de Eva Perón no Romance Santa Evita (1996 – Tomás Eloy Martínez
Directory of Open Access Journals (Sweden)
Josiane Valcarenghi Ribeiro Nantes
2017-06-01
Full Text Available Eva Perón é um nome significativo na história política da Argentina, sua influência surtiu, e continua surtindo efeito, no povo desse país até os dias atuais. “Evita” foi odiada/amada em níveis extremos, tanto que foi considerada uma santa, um mito para muitas pessoas. Tomás Eloy Martínez escreveu o romance – Santa Evita (1995 – em que narra como viveu a esposa de Juan Domingo Perón. Nesta obra encontra-se muitos elementos que dão indícios da (remitificação de Eva, por isso tenta-se aqui, explorar como se deu a (reconstrução mitológica de Eva Perón, personagem histórica no romance Santa Evita (1996 de Tomás Eloy Martínez, e ainda, expor quais foram os procedimentos adotados pelo autor que (reconstruíram esse mito. Utiliza-se, como base teórica, Linda Hutcheon (1991 e Fleck (2007 no conceito de metaficção historiográfica, Mircea Eliade (1991 e Martín Cezar Feijó (1984 no que cabe à análise do Mito. Esta breve pesquisa se dará a partir da análise bibliográfica e de forma comparativa entre a história e a escrita ficcional do romance Santa Evita (1996 de Tomás Eloy Martínez, discute-se os elementos utilizados e o caminho percorrido para a (reconstrução do mito Eva Perón na obra citada.
The Literary Criticism and Memoirs of Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Allen W. Phillips
1983-01-01
Full Text Available Equally as demanding of others as he was of himself, Juan Ramón Jiménez conceived of literary criticism as a serious and exacting task. The critic and the poet, standing side by side, are devoted to complementary activities of mutual enrichment. However fragmentary and partial the critical opinions of Juan Ramón may be (also outspoken and polemical in nature, they are invaluable as a personal historical and aesthetic guide to about fifty or sixty years of Hispanic literary development (1900-1960. Not to take them into account is to fail to recognize a highly important aspect of his total artistic personality. These varied critical texts are a product of a first rate intelligence and the sensibility of a writer of consummate discrimination who was endowed not only with an excellent memory but also a very special talent for appreciating the authentic. Juan Ramón as a critic is quick to praise (San Juan, Bécquer, Dario, Unamuno and Machado and at the same time strong in his censure of certain contemporaries. Several recently collected volumes of miscellaneous critical materials have resolved the bibliographical muddle for the initial study of this fundamental aspect of the poet, but still particularly important are the expressionistic portraits of Españoles de tres mundos , longer tributes to Valle, Ortega and Villaespesa as well as the extensive lectures delivered in his latter years. Examination of these pages gives us an historical and creative overview of the period in which he lived and worked in addition to original considerations about the evolution of Hispanic poetry. Of course, one of the constant focal points of his literary criticism was the modernist epoch of his early days, a movement or attitude which he considered to be a modern twentieth century renaissance. Together with detailed study of these two areas of historical and aesthetic nature, in the ensuing pages some conclusions are pointed out as to the essence of poetry
Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835
Directory of Open Access Journals (Sweden)
María José Vilar García
2016-12-01
Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.
A prática de formação da câmara municipal de Setúbal: a perceção dos
Claré, Lúcia Sofia Balagueira
2013-01-01
Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...
A military officer in Rif: Jesús Jiménez Ortoneda (1911-1936
Directory of Open Access Journals (Sweden)
José Luis Villanova
2009-08-01
Full Text Available This paper uses original and for the most part unpublished documentation in order to examine the career of Jesús Jiménez Ortoneda, a highly successful career officer who served in the Spanish Protectorate of Morocco between 1907 and 1936. He occupied important positions in the political administration of the Protectorate (as director of the political section of Melilla’s Oficina Central de Intervenciones and a senior official in the Department of Indigenous Affairs; he was fluent in Arab and Tamazight, and gained a sound knowledge of the geography of the Rif mountains. His military career, in which he achieved the rank of lieutenant colonel, was characterized by his strictly professional attitude. He was one of the few career officers in Africa who were faithful to Spain’s republican government and who did not participate in the military uprising of 1936. This discussion of his career brings into question some well-established ideas concerning Spanish colonial policy in Morocco.
Directory of Open Access Journals (Sweden)
María Flores Rodríguez
2013-03-01
Full Text Available Cet article étudie les théories eugénistes du juriste et socialiste espagnol Luis Jiménez de Asúa, exposées dans son livre Libertad de amar y derecho a morir (1928, dont l’examen met en évidence l’importance des débats autour de la légalisation de l’eugénisme en Espagne. En démontrant sa viabilité juridique, fondée sur le respect du droit et des principes socialistes, Jiménez de Asúa ouvre de nouvelles perspectives au mouvement eugéniste espagnol, laissant entrevoir les contours d’un nouvel ordre, au détriment de la Dictature de Primo de Rivera, déjà sclérosée.
Donnay, Karsten
2015-03-01
The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].
Pujol i Gómez, Josep
1998-01-01
Obra ressenyada: L. A. SÈNECA; edició crítica de Tomàs MARTÍNEZ ROMERO, Tragèdies. Barcelona: Barcino, 1995. Tomàs Martínez fa una edició crítica de les traduccions catalanes medievals de les següents tragèdies de Sèneca: 'Hercules furens', 'Thyestes', 'Thebais (Phoenissiae)', 'Hippolytus (Phaedra)' 'Oedipus', 'Troades', 'Medea' i 'Agamemnon'. A banda de l'edició, tracta qüestions com la difusió tardomedieval de Sèneca a la corona d'Aragó, la bibliografia sobre la diversitat dels mètodes d...
Vargas Jiménez, Dolores: Picasso: iconografías del baile.
Directory of Open Access Journals (Sweden)
José Jiménez Guerrero
2016-01-01
Full Text Available Fue en el año 1967. Bajo el mecenazgo de una institución ya desaparecida, el Liceo de Málaga, se convocó la primera edición del «Premio Málaga de Investigación». Esta loable iniciativa tuvo una continuidad temporal ininterrumpida hasta 1999. Tras ocho años de silencio, y gracias al respaldo de la Real Academia de Bellas Artes de San Telmo y de la Academia Malagueña de Ciencias, y al patrocinio de la entidad Cajamar, este prestigioso premio fue de nuevo convocado. A ello se sumó en el año 2012 la decisión adoptada por la Diputación de Málaga de publicar los trabajos premia dos en las dos modalidades del referido premio: Humanidades y Ciencias. Los libros editados forman parte de la colección que lleva por título «Premios Málaga de Investigación». En la convocatoria del año 2013, el premio de la sección humanística recayó en el trabajo presentado por Dolores Vargas Jiménez, doctora en Historia del Arte, bajo el título de Picasso: iconografías del baile. Y siguiendo lo preestablecido, su obra fue editada por la entidad supramunicipal.
Directory of Open Access Journals (Sweden)
Juan Miguel Monterrubio Prieto
2013-11-01
Full Text Available This study examines verb modes and tenses as well as the predicate structure in «Libro decimosexto» of Bartolomé Jiménez Patón’s Comentarios de erudición in an effort to demonstrate how the text straddles the line between Medieval and Golden Age norms. Jiménez Patón, thus, combines traits already considered archaic at the time, due perhaps to his solid training in grammar and his linguistic awareness, with those modern solutions which, towards the end of the 1500’s, were forging the new Spanish language (that of the «plain style», which he championed, one that was gradually being refined in order to take its place as the language of culture.
Directory of Open Access Journals (Sweden)
Victor Rayon García
2015-01-01
Full Text Available Carlos Martínez Assad publicó Los rebeldes vencidos. Cedillo contra el Estado cardenista en 1990. En ese trabajo, el ahora investigador emérito por la Universidad Nacional Autónoma de México y el Sistema Nacional de Investigadores dio cuenta, mediante un meticuloso análisis de fuentes primarias, de la última rebelión que conmovió al México contemporáneo. La investigación de Martínez Assad tuvo muchos méritos, aunque tal vez el mayor de ellos fue el hecho de analizar el movimiento de Saturnino Cedillo en sus aspectos económicos, sociales, políticos e ideológicos. Con la seriedad académica que siempre lo caracteriza, el ahora también Premio Nacional de Ciencias y Artes 2013 examinó los momentos más importantes en la vida del cacique potosino: su incursión en el torbellino revolucionario (1912, su apoyo al Plan de Agua Prieta (1920, su alianza con los gobiernos de Álvaro Obregón (1920-1924 y Plutarco Elías Calles (1924-1928, y su enfrentamiento final con el gobierno de Lázaro Cárdenas (1934-1940. De esta manera, Martínez Assad demostró que Cedillo, al rechazar el socialismo, las huelgas y el ejido, fue expuesto por el Estado cardenista —empeñado en lograr una centralización política y administrativa— como aliado de las compañías petroleras expropiadas el 18 de marzo de 1938 y portavoz del fascismo alemán en México.
Directory of Open Access Journals (Sweden)
Ricardo Muñoz Solla
2016-12-01
Full Text Available
Halfway through the 16th century in Spain the reading and interpretation of the Bible based on its original languages involved a very real danger for humanists who were seeking a better understanding of the Scriptures. The exclusive authority of the Latin Vulgate version declared by the Council of Trent in 1546 hindered the intellectual work of many Biblicists and Theologians, who were subjected to tight ideological control. In this context it must be considered the case of the Hebraist and scholar from the University of Salamanca, Martín Martínez de Cantalapiedra (1518-1579, who was prosecuted by the Inquisition of Valladolid in 1572 along with his colleagues Fray Luis de León and Gaspar de Grajal. All of them were accused of deviating from the genuine sense of the Vulgate in their more literal interpretations of the Masoretic text. The purpose of this article is to provide new evidence for the intellectual biography of Master Martínez de Cantalapiedra as well a to analyze the hermeneutical principles exposed during his inquisitorial in which he defended the Hebrew knowledge as an essential means of interpreting the Old Testament.
Santa Efigenia / Ifigenia : hagiografía y mito en "San Mateo en Etiopía", de Felipe Godínez
Márquez, Esther
2017-01-01
Este artículo aborda el estudio de las fuentes de San Mateo en Etiopía, obra que lleva a las tablas la vida del apóstol San Mateo, centrándose en el episodio de la evangelización de Etiopía y la conversión al cristianismo de Santa Efigenia, la hija del rey Egipo. Mediante el examen de sus fuentes, tanto hagiográficas como mitológicas, se pretende demostrar la contaminación que lleva a cabo Godínez entre la historia de Santa Efigenia y el mito de Ifigenia, la hija de Agamenón. El estudio compa...
Directory of Open Access Journals (Sweden)
Isabel Montes Romero-Camacho
2014-06-01
Full Text Available A partir de la conquista de Sevilla, en 1248, fueron muchos los judíos, primero, y los conversos, después, que llegaron a ocupar una posición preeminente, tanto en la ciudad, como en la corte, desempeñando, casi siempre, importantes oficios, al servicio de la hacienda real castellana, en una secuencia prácticamente ininterrumpida que va desde Alfonso X (1252-1284 hasta la nueva dinastía Trastámara. Uno de estos importantes conversos fue Nicolás Martínez de Medina (o de Sevilla, cuya actuación pública se desarrolló durante los reinados y a la sombra de los primeros Trastámara, desde Enrique II (1369-1379 hasta Juan II (1406-1454 y que, tras una brillante carrera en Sevilla y en la corte, llegaría a ser contador mayor de Castilla y, por tanto, uno de los personajes más influyentes de su época.After the conquest of Seville in 1248, many Jews and later «Conversos» played a prominent role both in the city and in the Court. They occupied significant positions at the service of the Spanish royal treasury almost uninterruptedly from the reign of Alfonso X (1252-1284 to that of the new Trastámara dynasty. One of these important «Conversos» was Nicolás Martínez de Medina (or de Sevilla, who held public positions under the reigns of the first Trastámara kings, from Enrique II (1369-1379 to Juan II (1406-1454. After a brilliant career in Seville and in the Court, he would become chief accountant of Castile and, consequently, one of the most influential individuals of his time.
Directory of Open Access Journals (Sweden)
Silvia Bermúdez
2006-01-01
Full Text Available Exactly ten years after its traumatic defeat in the Spanish-American War of 1898, Spain appeared to find some compensation for the loss of its last colonies by undertaking the invasion of Morocco in 1908. The enterprise proved difficult when the forces of Abd-el-Krim defeated the Spanish army in the summer of 1921. This terrible loss was metaphorized as an "open wound" and entered the collective imagination by becoming a theme in novels such as José Díaz Fernández's El blocao (1928, Ramón Sender's Imán (1930, and Arturo Barea's series La forja de un rebelde (1941-1944. Known as the "Disaster of Annual," the defeat appeared to be almost forgotten until a series of narratives in the late twentieth and early twenty-first centuries obsessively returned to this particular moment of Spanish history. I focus on how one such narrative, Martínez de Pisón's Una guerra africana (2000, revisits this war as adolescent literature ("novelas juveniles" and within the literary genre of the "novels of the War in Africa," and by so doing, contributes to the articulation of a Spanish collective identity with the historical memory of the feared Moroccan Other.
Directory of Open Access Journals (Sweden)
Alberto Pérez Pérez
2014-02-01
Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.
De mitos y realidades (respuesta a Luciano Martínez
Directory of Open Access Journals (Sweden)
José Luis Coraggio
2009-10-01
Full Text Available Este artículo constituye la respuesta del autor al comentario crítico realizado, en esta misma sección, por Luciano Martínez, en la pasada edición. El autor sostiene que la economía social y solidaria como un ámbito en construcción, que alberga a diversas vertientes que intentan avanzar hacia otra economía. Este carácter si bien puede albergar dudas, no debe transformase en un fatalismo inmovilizador, que permite la actualización constante del libre mercado como institución hegemónica. Antes que una utopía a denunciar desde una visión “realista”, se trata de construir una economía que combine mecanismos de mercado regulados socio-políticamente y relaciones de reciprocidad y redistribución. El texto explora, en pos de la argumentación, algunos de los elementos que conforman la economía social y solidaria.This article represents the author's response to critical commentary made in this section in the last edition by Luciano Martinez. The author maintains that the social and solidarity economy is a sphere under construction, in which several strands can be found. All of these approaches aim to move towards a different type of economy. This character as a developing realm can prompt doubts; this, however, should not lead to a paralyzing fatalism which allows the constant updating of the free market as a hegemonic institution. Far from a utopia to be denounced from a “realistic” viewpoint of economy, its concerns the construction of an economy that combines socio-politically regulated market mechanisms as well as relations of reciprocity and redistribution. The text also explores some of the elements that make up the solidarity and social economy.
Bottai, Alessio
2016-01-01
Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...
Figueira, Maria Margarida Góis
2016-01-01
Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...
Towards a Poetry of Silence: Stéphane Mallarmé and Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Mervyn Coke-Enguídanos
1983-01-01
Full Text Available In an era of apparent dissolution, "la Obra" of Juan Ramón Jiménez, like "l'Oeuvre" of Stéphane Mallarmé, has for its goal the attainment of timelessness. In both poets, the concept of absolute Time—the timelessness of eternal Time—is yoked with the ideal of silence. But this is no ordinary silence, and certainly not the kind that results from inadequacy of expression. It is the silence of perfection, the expression of the ineffable: pure Poetry. Since the poetic language is the silent language of thought, both Mallarmé and Juan Ramón seek to convey the pure idea. In so doing, both must stringently eliminate whatever is not essential in their poetry. The astonishing paradox, central to Mallarmé and Juan Ramón alike, is the urge to create an "unwritten" poetry.
Zafra Anta, Miguel Ángel; Flores Martín, Carlos; Ponte Hernando, Fernando Julio; Gil García, Andrés; Gómez López, Ana; Fernández Durán, Carla
2016-01-01
On the centenary of the foundation of the Paediatrics Society of Madrid, a tribute is presented to rural medical practice of that time, although there are few documents on the history of rural medicine. The main objective is to describe the context of the rural medical practice in the late 19th and beginning 20th century, while presenting a historical biographical review of Manuel Martínez Saldise, who was medical specialist from Cazalegas (Toledo). He was appointed an Honorary Member by the Paediatrics Society of Madrid in 1927. A search was carried out in repositories of digitized media, web portals of history of medicine, PubMed, IME files of local councils and medical colleges. The family archives were reviewed with the collaboration of his descendants. The hiring of rural doctors was carried out by the municipalities, and the salary largely depended on private practice as well as "retainers". Specialist physicians took part in epidemics, legal medicine, and in hygiene measures. They also had disputes with mayors, chiefs, with colleagues and with protectionism. A summary of the biography and occupational activity of Manuel Martínez Saldise is presented. Rural doctors were subjected to the society of their time, with the issues that arose, denouncing the shortcomings of the local administrations, dedicated efforts to their family and the most disadvantaged. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.
International Nuclear Information System (INIS)
1988-01-01
As part of the process for siting the nation's first geologic repository for radioactive waste, the Department of Energy (DOE) is preparing a site characterization plan for the Hanford site in Benton County, Washington. As a step in the preparation of that plan, the DOE has provided, for information and review, a consultation draft of the plan to the State of Washington, the affected Indian Tribes - the Confederated Tribes of the Umatilla Indian Reservation, the Nez Perce Indian Tribe, and the Yakima Indian Nation - and the US Nuclear Regulatory Commission. The Hanford site is one of three sites that the DOE currently plans to characterize;the other sites are the Deaf Smith County site in Texas and the Yucca Mountain site in Nevada. After site characterization has been completed and its results evaluated, the DOE will identify from among the three characterized sites the site that is preferred for the repository. The overview presented here consists of brief summaries of important topics covered in the consulation draft of the site characterization plan;it is not a substitute for the site characterization plan. The arrangement of the overview is similar to that of the plan itself, with breif descriptions of the dispoal system - the site, the repository, and the waste package - preceding the discussion of the characterization program to be carried out at the Hanford site. It is intended primarily for the management staff of organizations involved in the DOE's repository program or other persons who might wish to understand the general scope of the site-characterization program, the activities to be conducted, and the facilities to be constructed rather than the technical details of site characterization
« Nez et langues électroniques » : bilan et perspectives pour les huiles alimentaires
Directory of Open Access Journals (Sweden)
Mielle Patrick
2003-07-01
Full Text Available Le « Nez électronique », et plus récemment la « Langue électronique » ont été fort médiatisés durant la dernière décennie. Aussi est-il nécessaire, avec le recul, de faire le point sur les bénéfices que ces technologies peuvent apporter dans le domaine des produits alimentaires, et en particulier pour huiles végétales. On trouve une littérature relativement abondante dans ce domaine, mais les applications qui ont réussi à franchir le cap de l’utilisation industrielle sont extrêmement restreintes. S’agit-il d’une frilosité des industriels pour des investissements de contrôle-qualité ou d’un manque de fiabilité des résultats de laboratoire ? Pourtant, la demande en outils rapides de contrôle-qualité (ou de contrôle d’origine n’a jamais été aussi pressante. Nous expliquerons ce point par la nature même du produit, principalement pour l’huile d’olive extra vierge. D’autres techniques faisant appel à l’enrichissement en composés volatils seront introduites, laissant espérer à l’avenir une amélioration de la fiabilité des analyses.
Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed, Technical Report 2003-2006.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn
2007-02-01
The Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed is a multi-phase project to enhance steelhead trout in the Lapwai Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District (District). Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period December 1, 2003 through February 28, 2004 include; seven grade stabilization structures, 0.67 acres of wetland plantings, ten acres tree planting, 500 linear feet streambank erosion control, two acres grass seeding, and 120 acres weed control.
Torres Corominas, Eduardo
2013-01-01
Como fruto maduro de una larga trayectoria docente e investigadora en la Universidad Autónoma de Madrid, José Martínez Millán y Carlos Javier de Carlos Morales ofrecen en Religión, política y tolerancia en la Europa Moderna una serena reflexión sobre la época del Antiguo Régimen que pretende superar, desde los estudios sobre la Corte, los límites y contradicciones de las escuelas y paradigmas precedentes, como la escuela de los Annales y el marxismo, por medio de un discurso renovador donde s...
Directory of Open Access Journals (Sweden)
Enrico Di Pastena
2012-12-01
Full Text Available Review of Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega, Homo Legens (Bibliotheca Homolegens, 63, Madrid, 2011, 334 pp. ISBN: 978-84-92518-72-2 y José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro, PPU, Barcelona, 2011, 783 pp. ISBN: 978-84-477-1114-7.
Directory of Open Access Journals (Sweden)
María Merino Bobillo
2011-11-01
Full Text Available Las enfermedades de la sociedad contemporánea son descritas, con lucidez y brillantez literaria, por el periodista y escritor José Jiménez Lozano, en las entregas periodísticas al Grupo Promecal. Los nacionalismos, la movida y el botellón, la violencia de género, el lenguaje sexista, etc. son retazos de la actualidad que su mirada atraviesa y dimensiona. Sus artículos traspasan la contingencia de lo periodístico para convertirse en propuestas culturales con tonalidad universal. No se quedan en la crítica de los sucesos concretos sino que, apoyándose en ellos, derivan en reflexiones de corte antropológico y ofrecen pensamientos válidos para los lectores de hoy y de mañana.
Castelo Blasco, Carmen
2015-01-01
Objetivos.- El presente trabajo analiza 300 columnas de opinión del periodista murciano José García Martínez publicadas en el periódico La Verdad entre los años 1975 y 2010. Para ello, se ha utilizado un análisis de contenido que ha permitido identificar las particularidades y características en cuanto a temas, enfoque, estructura y lenguaje que el autor utiliza. Se trata de un periodista singular por el hecho de haber desarrollado durante más de medio siglo su carrera profesional en un único...
Directory of Open Access Journals (Sweden)
Néstor Bórquez
2013-12-01
Full Text Available The following paper shall focus especially on the work of Carlos Giménez, a comic author from Madrid who attempts to represent there Spanish daily life from Civil War times up to the end of the Francoist regime –and his own life experience displays there an unavoidable reference point: 36-39 Malos tiempos, but mostly Paracuellos and Barrio are part of his own life story during the Civil War and the Francoist regime. In Argentina, authors such as Mariano Grassi or María Delia Lozupone and Rafael Cippolini try a similar intimist gaze upon the representation of dictatorship times in Argentina. This paper shall seek to establish a dialogue between these manifestations, attempting thereby to analyze the intimate plot of history and representation in these comic books.
Directory of Open Access Journals (Sweden)
Adolfo León Atehortúa Cruz
2012-08-01
Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?
Directory of Open Access Journals (Sweden)
Lúcia Macedo
2012-03-01
Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las
Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice
International Nuclear Information System (INIS)
Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.
2007-01-01
The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure
Indoor tetrachloroethylene levels and determinants in Paris dwellings.
Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle
2013-01-01
There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Stokowski, P.A.; Friedli, E.A.
1987-11-01
A series of BWIP Socioeconomic Profile Reports are being prepared. This report is one of the first set of five separate BWIP Profile Reports, which cover: economic/demographic conditions; fiscal conditions; housing characteristics; public services and facilities; and socioeconomic conditions in cultural communities. The BWIP Socioeconomic Profile Reports are designed to provide information about the characteristics of the communities in which socioeconomic impacts from BWIP may occur. The Profile Reports present a compilation of historical information about socioeconomic conditions in the affected communities. These reports are designed to provide a transition between the BWIP EA, published in 1986, the Monitoring Reports, and other technical reports associated with the BWIP SMMP and CSP. The principal objectives of the Profile Reports are to update the DOE BWIP socioeconomic database by compiling available secondary and primary data and to make this information available to both the DOE program and other interested parties. The initial Profile Reports will help identify the need for additional data. The database developed for the profiles will assemble socioeconomic data in a uniform, readily accessible format. 16 refs., 1 fig., 17 tabs
Cunha, Catarina Gradíssimo Dias da
2012-01-01
Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...
Riva Novoa, Ronal
2015-01-01
Es una investigación descriptiva correlacional, orientada a estudiar la relación entre toma de decisión y la actitud emprendedora estudiantes del 5° grado de secundaria de la Institución Educativa Pública José Jiménez Borja del Cercado de Lima, Se seleccionó una población de 80 estudiantes de ambos sexos del 5° año de educación secundaria. A dicha población se les aplicó Cuestionario para evaluar la aptitud en la Toma de Decisiones, el cuestionario fue elaborado por Jonifer Benitez (2011) ...
Pantelia, Anna
2014-01-01
17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.
Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno
2018-02-13
The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected
Directory of Open Access Journals (Sweden)
Eduardo Silva
2010-11-01
Full Text Available El artículo de Martínez, Silva y Hernández (en este número argumenta que los jóvenes chilenos se han distanciado de la participación sociopolítica convencional, porque perciben una falta de validación de las personas en el sistema sociopolítico actual, debido a la vulneración de derechos, inequidad social y falta de voz y poder de los ciudadanos. Esto choca con sus valores de fraternidad y desarrollo justo y digno de las personas. En este ensayo se examina si ese sentir tiene fundamentos reales en la estructura y lógica del modelo político-económico que ellos critican. Se aborda el tema desde el marco analítico de la economía política, que parte del supuesto de que las estructuras económicas y políticas determinan sujetos sociales, sus intereses y su poder relativo. Se encontró una asociación directa entre la lógica del modelo político-económico y los sentimientos de exclusión que expresaron los entrevistados.The article by Martínez, Silva, and Hernández (in this issue argues that Chilean youth have disengaged from participation in conventional socio-political institutions because they believe that the sociopolitical system does not validate the persons, violates their rights, is highly inequitable, and excludes them from having a real voice in public decision-making. This perception clashes with their values of fraternity and a just and dignified development for everyone. This essay examines if these beliefs have a real basis in the structure and logic of the economic and political model they criticize. This issue is analyzed from a political economy perspective, built on the assumption that economic and political structures determine social subjects, their interests, and their relative power. A direct association was found between the logic of Chile's political-economic model and the feelings of exclusion that the interviewees expressed.
Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing
Directory of Open Access Journals (Sweden)
Martha A. T. Lenio
2012-01-01
Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.
Improving couples' quality of life through a Web-based prostate cancer education intervention.
Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H
2015-03-01
To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.
Directory of Open Access Journals (Sweden)
J. Navarro-Martínez
2005-01-01
Full Text Available El presente trabajo contribuye al conocimiento de las características y propiedades tecnológicas de la madera de Palo morado (Peltogyne mexicana Martínez, mediante la caracterización anatómica, porcentaje de elementos y determinación de las propiedades físicas y tres mecánicas. Se colectaron dos árboles en Tierra Colorada Guerrero. El material se obtuvo de trozas a 1.30 m de altura. Para el estudio macroscópico se usaron muestras de 7 x 15 x 1 cm y para el microscópico se elaboraron preparaciones fijas de cortes y de material disociado. La madera presenta un color violeta intenso, porosidad difusa, parénquima en bandas y aliforme confluente con cristales, los elementos de vaso son cortos de diámetro medio, con inclusiones, rayos uniseriados, biseriados, triseriados y raramente multiseriados; las fibras son de tipo libriforme de longitud media, diámetro fino y pared gruesa, presenta densidad básica, contracciones y dureza alta.
Directory of Open Access Journals (Sweden)
Mederos Martín, Alfredo
2014-12-01
, Claudio Sanchez-Albornoz. Menghin was not permitted to give lectures until 1953, and only consolidated his position when his criminal trial was cancelled in December 1956. In 1957 at the age of 69, he obtained the position of Acting Professor of Prehistory at the National University of La Plata. In 1958, Menghin was appointed Professor in General and Old World Prehistory at the University of Buenos Aires, where he retired in 1968, aged 80.Oswald Menghin, Catedrático de Prehistoria del Hombre de la Universidad de Viena entre 1922-1945, fue partidario de la unidad de Austria con Alemania y simpatizante con ideas del NSDAP sobre la necesidad de evitar una mezcla racial entre arios y judíos. Durante su etapa como Catedrático-Residente en la Universidad de Fouad en El Cairo entre 1930-1933, por contacto con Hermann Junker, radicalizó sus puntos de vista y redactó su libro Espíritu y sangre. Principios básicos de raza, lengua, cultura y nación. Su etapa como Rector en el curso 1935-1936 le catapultó a la política como miembro del consejo directivo del partido fascista austriaco, Vaterländische Front, entre 1936-1937 y su posterior nombramiento como Ministro de Educación entre marzo y mayo de 1938, justo después de la invasión de Hitler de Austria. Siendo Ministro, solicitó su ingreso en el NSDAP, que no se aceptó hasta junio de 1940, por su pertenencia previa a organizaciones católicas secretas. Menghin entró en contacto con Martínez Santa-Olalla, después de la celebración del Jubileo del Instituto de Morfología Cultural de Frankfurt en junio y julio de 1938. A raíz de una estancia de investigación de Almagro Basch en Alemania y Austria en enero y febrero de 1942, y la posterior visita a Barcelona de Menghin en junio de 1942, optó por distanciarse de Martínez Santa-Olalla, no visitando Madrid, cortando la relación epistolar e informando negativamente sobre él a las SS-Ahnenerbe. Prisionero en dos campos de concentración norteamericanos entre mayo de
Pantelia, Anna
2014-01-01
1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.
A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos
Directory of Open Access Journals (Sweden)
Raquel V. Oliveira
2014-03-01
Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.
Energy Technology Data Exchange (ETDEWEB)
Kozusko, Shana
2003-12-01
The Nez Perce Tribe (NPT) currently manages a 15,325 acre parcel of land known as the Precious Lands Wildlife Management Area that was purchased as mitigation for losses incurred by construction of the four lower Snake River dams. The Management Area is located in northern Wallowa County, Oregon and southern Asotin County, Washington (Figure 1). It is divided into three management parcels--the Buford parcel is located on Buford Creek and straddles the WA-OR state line, and the Tamarack and Basin parcels are contiguous to each other and located between the Joseph Creek and Cottonwood Creek drainages in Wallowa County, OR. The project was developed under the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L. 96-501), with funding from the Bonneville Power Administration (BPA). The acreage protected under this contract will be credited to BPA as habitat permanently dedicated to wildlife and wildlife mitigation. A modeling strategy known as Habitat Evaluation Procedure (HEP) was developed by the U.S. Fish and Wildlife Service and adopted by BPA as a habitat equivalency accounting system. Nine wildlife species models were used to evaluate distinct cover type features and provide a measure of habitat quality. Models measure a wide range of life requisite variables for each species and monitor overall trends in vegetation community health and diversity. One product of HEP is an evaluation of habitat quality expressed in Habitat Units (HUs). This HU accounting system is used to determine the amount of credit BPA receives for mitigation lands. After construction of the four lower Snake River dams, a HEP loss assessment was conducted to determine how many Habitat Units were inundated behind the dams. Twelve target species were used in that evaluation: Canada goose, mallard, river otter, downy woodpecker, song sparrow, yellow warbler, marsh wren, western meadowlark, chukar, ring-necked pheasant, California quail, and mule deer. The U.S. Army Corp of
González-Pérez, José A.; Jiménez-Morillo, Nicasio T.; Jordán, Antonio; Zavala, Lorena M.; Granged, Arturo J. P.; González-Vila, Francisco J.
2016-04-01
Post-fire rehabilitation actions and recovery attempts of burned soils include a range of management practices (tillage, tree logging, reforestation …), in some cases producing an additional damage to that directly caused by fire. Among negative impacts derived from unappropriated rehab practices are the increase soil erosion, loss of soil fertility and alterations in the hydrological cycle. Analytical pyrolysis (Py-GC/MS) is an appropriate technique to study organic matter characteristics within complex matrices. Here this technique is used to study the alterations caused by burning and post-fire rehab plans to soil organic matter (SOM). Fire and post-fire rehab actions impact on SOM is studied in a sandy soil under pine (Pinus pinea) forest that was affected by a severe fire in August 2012 in Doñana National Park (SW Spain). Bulk samples as well as its sieved soil fractions (coarse, 1-2 mm, and fine, fire produced methoxyphenol de-functionalization, increasing the proportion of recalcitrant compounds. With respect to soil size fractions, in all cases, the coarse fraction showed a high content of carbohydrate-derived compounds and methoxyphenols followed by fatty acids, in line with inputs of new litter from stressed post-fire vegetation (Jiménez-Morillo et al., 2014). The BR soil coarse fraction showed the highest proportion of methoxyphenols whereas that from the UB soil showed the highest value for alkyl compounds. With respect to the fine soil fractions, although SOM composition varied largely from one area to another, it was found generally more altered than in the coarse fractions. SOM from the UB fine fraction shows a high proportion of alkyl compounds and comparatively lower amount of carbohydrate- and lignin-derived ones. The B soil fine fraction did not show a high contribution from alkyl compounds, which may indicate the occurrence of thermal cracking of alkane/alkene linear chains during the forest fire (González-Pérez et al., 2008). The SOM from
Columbia River system operation review. Final environmental impact statement
International Nuclear Information System (INIS)
1995-11-01
The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930's, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D'Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation
Columbia River System Operation Review : Final Environmental Impact Statement, Appendix D: Exhibits.
Energy Technology Data Exchange (ETDEWEB)
Columbia River System Operation Review (U.S.)
1995-11-01
The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930`s, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D`Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation.
Directory of Open Access Journals (Sweden)
Alexandra dos Anjos Cassado
Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.
Eulalia Hernández Ciro
2015-01-01
Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprens...
La conformación de la provincia jesuítica de Toledo en torno al generalato de Diego Laínez 1556-1565
Directory of Open Access Journals (Sweden)
Martín López, David
2014-12-01
Full Text Available The newest Jesuits soon began incardinated in the Iberian territory, home of its founder. As one of the most important territories of Catholic Christianity, soon saw the need to distribute what would soon become a large crown in a number of provinces for a more effective government and evangelization. After the first division, at the time of the Spanish general Lines were the final foundations of penta-provincialization between Portugal, Castile, Aragon, Andalusia and —novelty— Toledo.La novísima Compañía de Jesús empezó pronto a incardinarse en el territorio ibérico, patria de su fundador. Como uno de los territorios más importantes de la Cristiandad católica, pronto se vio la necesidad de distribuir lo que pronto sería una gran corona en una serie de provincias para unos más eficaces gobierno y evangelización. Después de una primera división, en la época del generalato del español Laínez se pusieron las bases de la pentaprovincialización definitiva entre Portugal, Castilla, Aragón, Bética y —la novedad— Toledo.
Directory of Open Access Journals (Sweden)
Raquel Batista de Oliveira
2017-12-01
Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental, tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi
Ball, James W.; McMleskey, R. Blaine; Nordstrom, D. Kirk
2010-01-01
Water analyses are reported for 104 samples collected from numerous thermal and non-thermal features in Yellowstone National Park (YNP) during 2006-2008. Water samples were collected and analyzed for major and trace constituents from 10 areas of YNP including Apollinaris Spring and Nymphy Creek along the Norris-Mammoth corridor, Beryl Spring in Gibbon Canyon, Norris Geyser Basin, Lower Geyser Basin, Crater Hills, the Geyser Springs Group, Nez Perce Creek, Rabbit Creek, the Mud Volcano area, and Washburn Hot Springs. These water samples were collected and analyzed as part of research investigations in YNP on arsenic, antimony, iron, nitrogen, and sulfur redox species in hot springs and overflow drainages, and the occurrence and distribution of dissolved mercury. Most samples were analyzed for major cations and anions, trace metals, redox species of antimony, arsenic, iron, nitrogen, and sulfur, and isotopes of hydrogen and oxygen. Analyses were performed at the sampling site, in an on-site mobile laboratory vehicle, or later in a U.S. Geological Survey laboratory, depending on stability of the constituent and whether it could be preserved effectively. Water samples were filtered and preserved on-site. Water temperature, specific conductance, pH, emf (electromotive force or electrical potential), and dissolved hydrogen sulfide were measured on-site at the time of sampling. Dissolved hydrogen sulfide was measured a few to several hours after sample collection by ion-specific electrode on samples preserved on-site. Acidity was determined by titration, usually within a few days of sample collection. Alkalinity was determined by titration within 1 to 2 weeks of sample collection. Concentrations of thiosulfate and polythionate were determined as soon as possible (generally a few to several hours after sample collection) by ion chromatography in an on-site mobile laboratory vehicle. Total dissolved iron and ferrous iron concentrations often were measured on-site in the
Yuan, Lu; LeBlanc, James
1998-01-01
This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.
Directory of Open Access Journals (Sweden)
Andreia Pinto de Sousa
2015-07-01
Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.
Directory of Open Access Journals (Sweden)
Córdoba, Joaquín Mª
2005-04-01
Full Text Available A comienzos del siglo XX, cuando el redescubrimiento de Oriente se había trocado en su colonización tras la I Guerra Mundial, la poesía del viaje y el reencuentro con gentes y paisajes parecían ya imposibles. De hecho, la literatura «clásica» del viaje a Oriente estaba ya más que acabada. Sin embargo, un accidente de la historia de la aviación española haría que el capitán Rafael Martínez Esteve, integrante de la patrulla que emprendió el viaje Madrid-Manila, viviera una trágica aventura en el desierto jordano- iraquí. Fruto de esa experiencia sería un libro que es, al mismo tiempo que emocionante relato, descripción poética del desierto y la vida de los beduinos, sarcástica mirada a los poderes coloniales, y un amable epígono en la historia de la literatura española de viajes a Oriente.…
INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.
Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...
Friar, John T.
Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…
2010-03-24
... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...
Digital Repository Service at National Institute of Oceanography (India)
Fernandes, V.; Ramaiah, N.
. Z., National Institute of Oceanography, Goa. (1976) pp. 21-27. 50 Raymont, J. E. C., Plankton and productivity in the oceans 2nd edition, Volume 2- Zooplankton, Pergamon Press, (1983) 1-824 pp. 51 Lavaniegos, B. E., Jiménez-Pérez, L. C...
English Textbooks in Parallel-Language Tertiary Education
Pecorari, D.; Shaw, P.; Irvine, Aileen; Malmstrom, H.
2011-01-01
Tertiary education in many countries is increasingly bilingual, with English used in parallel with the national language, particularly as a reading language. This article describes the results of a survey of student attitudes toward, and reading practices regarding, English language textbooks. Over 1,000 students at three Swedish universities responded to a questionnaire asking about their experiences with English textbooks. Textbooks written in English were generally unpopular, and the perce...
Directory of Open Access Journals (Sweden)
Juan José Martín García
2016-07-01
Full Text Available La aparición en un archivo particular de la localidad burgalesa de Pradoluengo, del libro de cuentas de Manuel Martínez Lerma, y su análisis desde los puntos de vista formal, conceptual y de contenidos, supone uno de los pocos casos sobre contabilidad privada, estudiados en el ámbito rural castellano de la primera mitad del siglo XIX. En su funcionamiento interno, este documento contable es deudor de la tradición castellana. Su fin es eminentemente práctico y su contexto cronológico le hace no estar sujeto a supervisiones de estamentos superiores, lo que le otorga una verosimilitud prácticamente absoluta. Sin lugar a dudas, supuso la piedra angular del trabajo de despacho de su redactor, quien, a pesar de declarar como actividad principal la de escribano, diversificó sus negocios en multitud de ámbitos: fabricación de tejidos, comercio al por menor, actividades financieras y de préstamo, compraventa de lanas, adquisición de tierras e inmuebles, etcétera. La versatilidad de nuestro personaje, se plasma en múltiples perspectivas que manan constantemente del libro de cuentas, cuyo análisis hemos apoyado con documentación notarial, parroquial y municipal. Manuel se situará progresivamente en lo más alto de la cúspide social, estableciendo relaciones clientelares con grandes comerciantes, convirtiéndose en un destacado fabricante local, accediendo a puestos de responsabilidad municipal, fijando alianzas matrimoniales ventajosas para sus hijos, o siendo pieza clave en el encumbramiento de uno de ellos como arzobispo de Manila.
International Nuclear Information System (INIS)
James, Jean-Baptiste
2001-11-01
Since 1965, the site of the Nez-de-Jobourg, in the Manche district and at the vicinity of the La Hague plant, has been a site of ornithological follow-up, notably because it harbours different population of nesting sea birds. Since 1990, it has been noticed that the population of European shags has been keeping on decreasing, with abnormally low birth rate, while the European herring gull has totally disappeared. If the relationship between this decline and the releases of the La Hague nuclear waste processing plant is easily and quickly suspected, other reasons are also plausible. The authors report a study of this decline and an investigation of its possible origins. After a presentation of the site, of its status regarding hunting and specie protection, and a presentation of other close sites (small islands, bay), the report addresses the case of the European shag. It gives information on its biology, characteristics, location and population, reproduction sites and nesting cycle. It presents the method adopted to test the various hypotheses of origin of the noticed decline: contamination by radioactive materials or by chemical substances, problems of disturbance by fishers, tourists or others, problems of predation, parasitism or lack of food resources. Samplings have been performed within the studied site and also within reference sites located some miles away. Based on data and observations, hypotheses are then discussed. An analytical report of measurement of artificial radio-elements performed by gamma spectrometry is provided
A la costa de Luis A. Martínez: ¿la defensa de un proyecto liberal para Ecuador?
Directory of Open Access Journals (Sweden)
1998-01-01
Full Text Available A LA COSTA DE LUIS A. MARTINEZ : LA DEFENSE DUN PROJET LIBERAL POUR LÉQUATEUR ? A la Costa est souvent analysé comme une peinture de moeurs, témoignage de la réalité sociale et politique de l´Équateur de la fin du XIX et du début du XX. En effet, ce roman prétend décrire le conflit traditionnel qui oppose socialement, économiquement et politiquement les Andes et la Côte. Mais il se présente aussi et surtout comme la défense d´un projet libéral pour l´Équateur et développe une démonstration idéologique systématique. En outre, il propose une lecture du sens de la vie et une réflexion sur le devenir de l´homme dont la portée dépasse largement l´argumentation idéologique. Ce sont sans aucun doute ces nuances, introduites tout au long de la narration, qui permettent à l´oeuvre d´échapper à son statut exemplaire, simple témoignage d´une époque, pour proposer une vision personnelle et créative. Muchos han visto en A la Costa una novela de tendencia costumbrista, testimonio de la realidad social y política del Ecuador a finales del siglo XIX y comienzos del XX. En efecto, la novela pretende describir el conflicto tradicional social, económico, político entre Sierra y Costa. Pero es también, y ante todo, la defensa de un proyecto liberal para Ecuador, desarrollando una sistemática demostración ideológica. Además, propone una lectura del sentido de la vida y una reflexión sobre el porvenir del hombre cuyo alcance va más allá de la defensa de un proyecto ideológico. Sin duda son estos matices, introducidos a lo largo de la narración, los que permiten que la obra escape del estatuto de novela ejemplar y testimonial para proponer una visión autónoma y creativa. THE NOVEL A LA COSTA OF LUIS A. MARTÍNEZ: THE DEFENSE OF A LIBERAL PROJECT FOR ECUADOR? The novel A la Costa has often been analyzed as a portrait of national costumes, a testimony to the social and political realities of Ecuador at the end of
Realities of Work Life Balance in Nigeria: Perceptions of Role Conflict and Coping Beliefs
Babatunde Akanji
2012-01-01
The purpose of this study is to explore the perceptions of Work-Life Balance (WLB) practices in a developing nation of Nigeria. Evidently, on the threshold of widened globalization propensities, work-life research is beginning to spread outside the western context. Thus, a qualitative approach was employed by conducting 61 in-depth interviews with Nigerian employees (41 women and 20 men) working in frontline employments in the banking, telecommunications and insurance sectors about their perc...
CARACTERIZACIÓN TECNOLÓGICA DE LA MADERA DE Juniperus flaccida VAR. POBLANA MARTÍNEZ
Directory of Open Access Journals (Sweden)
A. Borja de la Rosa
2010-01-01
Full Text Available El presente estudio se realizó con la finalidad de conocer las características y propiedades tecnológicas de la madera de Juniperus flaccida var. poblana Martínez, para lo cual se utilizó la metodología del Laboratorio de Anatomía y Tecnología de la Madera de la División de Ciencias Forestales de la Universidad Autónoma Chapingo. Las propiedades físicas se determinaron según la norma NOM-EE-167-83 y las mecánicas de acuerdo a las normas ASTM 143-83 en el Campo Experimental San Martinito, del Instituto de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP. Los resultados con relación a las características anatómicas fueron los siguientes: la madera presenta un color castaño claro en el duramen y amarillo pálido en la albura, brillo medio, veteado suave, textura fina, hilo recto, sabor característico y olor aromático. Las traqueidas son largas, de diámetro tangencial mediano y paredes delgadas; presentan una hilera de puntuaciones areoladas seriadas, las puntuaciones de los campos de cruzamiento son tipo cupresoide y el parénquima axial es escaso. Los rayos de tipo uniseriados numerosos, muy bajos y muy angostos; los rayos y las células parenquimatosas axiales presentan aceites. La proporción de elementos fue 92 % de traqueidas, 7.72 de parénquima de rayo y 0.18 % de parénquima axial. La densidad básica fue de 0.50 g·cm-3, las contracciones totales fueron: volumétrica de 8.42 %, tangencial de 4.26 % y radial de 3.02 %; y los hinchamientos totales: volumétrico de 9.17 %, tangencial de 4.45 % y radial de 3.12 %. El punto de saturación de la fibra fue de 33 %; el coeficiente de hinchamiento 0.278 %, y la relación de anisotropía de 1.41. Los valores promedio de las propiedades mecánicas al 12 % de contenido de humedad (CH y en condición verde, se clasificaron de medios a bajos en ambas condiciones de contenido de humedad. Considerando las características anatómicas y los valores de las propiedades f
Lifescience Database Archive (English)
Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =
Lifescience Database Archive (English)
Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste
Future Remains: Industrial Heritage at the Hanford Plutonium Works
Freer, Brian
This dissertation argues that U.S. environmental and historic preservation regulations, industrial heritage projects, history, and art only provide partial frameworks for successfully transmitting an informed story into the long range future about nuclear technology and its related environmental legacy. This argument is important because plutonium from nuclear weapons production is toxic to humans in very small amounts, threatens environmental health, has a half-life of 24, 110 years and because the industrial heritage project at Hanford is the first time an entire U.S. Department of Energy weapons production site has been designated a U.S. Historic District. This research is situated within anthropological interest in industrial heritage studies, environmental anthropology, applied visual anthropology, as well as wider discourses on nuclear studies. However, none of these disciplines is really designed or intended to be a completely satisfactory frame of reference for addressing this perplexing challenge of documenting and conveying an informed story about nuclear technology and its related environmental legacy into the long range future. Others have thought about this question and have made important contributions toward a potential solution. Examples here include: future generations movements concerning intergenerational equity as evidenced in scholarship, law, and amongst Native American groups; Nez Perce and Confederated Tribes of the Umatilla Indian Reservation responses to the Hanford End State Vision and Hanford's Canyon Disposition Initiative; as well as the findings of organizational scholars on the advantages realized by organizations that have a long term future perspective. While these ideas inform the main line inquiry of this dissertation, the principal approach put forth by the researcher of how to convey an informed story about nuclear technology and waste into the long range future is implementation of the proposed Future Remains clause, as
Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K
2006-01-01
Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r = 0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782
Restoring Anadromous Fish Habitat in Big Canyon Creek Watershed, 2004-2005 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn (Nez Perce Soil and Conservation District, Lewiston, ID)
2006-07-01
The ''Restoring Anadromous Fish Habitat in the Big Canyon Creek Watershed'' is a multi-phase project to enhance steelhead trout in the Big Canyon Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District. Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period September 1, 2004 through October 31, 2005 include; 2.7 riparian miles treated, 3.0 wetland acres treated, 5,263.3 upland acres treated, 106.5 riparian acres treated, 76,285 general public reached, 3,000 students reached, 40 teachers reached, 18 maintenance plans completed, temperature data collected at 6 sites, 8 landowner applications received and processed, 14 land inventories completed, 58 habitat improvement project designs completed, 5 newsletters published, 6 habitat plans completed, 34 projects installed, 2 educational workshops, 6 displays, 1 television segment, 2 public service announcements, a noxious weed GIS coverage, and completion of NEPA, ESA, and cultural resources requirements.
Santiago Martínez Delgado, pionero del diseño gráfico colombiano: una reseña de su vida y obra
Directory of Open Access Journals (Sweden)
Diego Giovanni Bermúdez Aguirre
2017-06-01
Full Text Available Hablar del diseño gráfico en Colombia como profesión autónoma es aproximarse a una historia todavía en construcción, dada la juventud de este espacio de conocimiento, el cual dio sus primeros pasos solo hasta principios del siglo XX, debido al desarrollo industrial que vino a definir un nuevo lenguaje de producción, estético y comunicativo que ahora se llama “diseño”. Este texto pretende acercarse a la vida de Santiago Martínez Delgado, uno de los primeros hombres que con su obra definió, en el contexto colombiano, los rumbos de una nueva forma de expresión y comunicación: el diseño gráfico. Se intenta comprender el carácter innovador presente en la vida y obra de este diseñador colombiano, desde la ciencia histórica a partir de la condición de lugar de producción, acercamiento al tiempo histórico como reconstrucción o representación de un presente por medio de un proceso de ficcionalización, el cual edifica y evidencia una ruptura temporal entre el pasado, asumido como espacio de experiencia, y el ahora (presente, constituido a partir de una visión prospectiva de la vida en el futuro, horizonte de expectativa.
Directory of Open Access Journals (Sweden)
García-Abad García, M. Teresa
2005-06-01
Full Text Available The cinema, his synthetic character, and the dialogue that it establishes from the origin with other arts as literature, has not stopped offering a wide space of synergies for the adaptation practice and for the study of confluence areas between image and word. New generations of writers and directors propiciate across their work an opening that, beside integrating the expressive resources of the literature and the screen, consider the text as a productive and plural activity, capable of being spread in a stereophony that postpones its meaning in every process of reading, making it coincide with a practice of writing and creation. Ignacio Martinez de Pisón's literature contains sugerent keys to advance in the dialogue between literature and cinema in current Spanish narrative.El cine, su carácter sintético, y el diálogo que desde el origen establece con otras artes como la literatura, no han dejado de ofrecer un espacio amplio de sinergias para la práctica adaptativa y para la reflexión acerca de los ámbitos de confluencia entre la imagen y la palabra. Las generaciones de escritores y de directores más jóvenes propician a través de su obra una apertura que, además de integrar los recursos expresivos de la literatura y la pantalla, considera al texto como una actividad productiva y plural capaz de diseminarse en una estereofonía que aplaza su significado en cada proceso de lectura haciéndolo coincidir con una práctica de escritura y de creación. La literatura de Martínez de Pisón contiene claves sugerentes para desentrañar este diálogo entre literatura y cine en la narrativa española actual.
22 August 2014 - H.E. Ms P. Hamamoto
Gadmer, Jean-Claude
2014-01-01
Ambassador Permanent Representative of the United States of America to the United Nations and other International Organizations in Geneva P. Hamamoto signing the Guest Book with Director-General R. Heuer and visiting the CMS cavern with CMS Collaboration Deputy Spokesperson K. Borras and visiting the LHC tunnel at point 5 with Technology Department Head J.M. Jiménez
A review of potential neurotoxic mechanisms among three chlorinated organic solvents
International Nuclear Information System (INIS)
Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.
2011-01-01
The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.
Voluntad de estilo en el muy joven José Martínez Ruiz: un aprendiz de crítico satírico (1893-1894
Directory of Open Access Journals (Sweden)
Miguel Ángel Martín-Hervás Jiménez
2017-02-01
Full Text Available Este artículo se enmarca dentro la etapa de producción juvenil de José Martínez Ruiz, Azorín (1873-1967 y en él se analizan con un doble objetivo las tres primeras obras de su carrera literaria: La crítica literaria en España (1893, Moratín (1893 y Buscapiés (1894. El primer y principal objetivo consiste en utilizar como fundamento metodológico la teoría de la voluntad de estilo desarrollada por Juan Marichal en su libro Teoría e historia del ensayismo hispánico (1984 para analizar el tipo de personalidad literaria que aspiró a construirse el autor en sus tres primeras obras. En segundo lugar, se comprobará si es cierto o no que bebió en ellas de las fuentes de la ideología anarquista para forjar su imagen pública de escritor. Se concluirá que el futuro Azorín se encontraba en el periodo de 1893-1894 en una fase de aprendizaje y de búsqueda de maestros en la que quiso proyectar de sí mismo la imagen de Crítico Discordante o Crítico Satírico. Asimismo, se aclarará que hasta el momento todavía no había encontrado en el anarquismo el sustrato ideológico-estético que impregnará obras posteriores.
Directory of Open Access Journals (Sweden)
Margarita Garrido
2016-07-01
Full Text Available El libro editado por Francisco Ortega Martínez y Yobenj Aucardo Chicangana-Bayona es, en buena parte, producto de una investigación colectiva sobre los lenguajes políticos del período de la Independencia neogranadina, iniciada ya hace más de siete años con un grupo de estudiantes de maestría de la Universidad Nacional que, al ampliar sus fronteras, ha involucrado a otros investigadores nacionales y extranjeros, con quienes discute su propuesta metodológica y de principios con respecto a la historia conceptual. Lo interesante es que el libro no es la respuesta a un llamado a enviar artículos que más o menos se acomoden a unos temas y problemas, sino el resultado de lecturas conjuntas, debates y reflexiones que le permitió compartir a los autores lo que en su momento entendían por historia conceptual y por cultura política. Así, decidieron formular preguntas que no solo dieran cuenta de la semántica histórica sino que además, como lo plantean en la introducción, indagan por las experiencias que alimentaron los sentidos dados a un concepto y las expectativas que despertaron entre quienes lo usaron. Los conceptos a trabajar fueron escogidos, entendiendo que tenían esa calidad precisamente por haber estado en el centro de los debates por el sentido y el significado de los acontecimientos; porque fue con esos conceptos que los contemporáneos reflexionaron y elaboraron las experiencias vividas.
Directory of Open Access Journals (Sweden)
Juana Irma Manzano Banda
2014-07-01
Full Text Available Se evaluó el efecto de la aplicación de estiércol bovino, yeso, ácido sulfúrico y lavado de suelos sobre la concentración de sales solubles y proporción de sodio en dos suelos salino-sódicos, provenientes del Distrito de Riego 086 de Jiménez, Tamaulipas, México. Se utilizaron macetas con 6 kg de suelo bajo condiciones de invernadero para ensayar dos niveles de salinidad-sodicidad (suelo Carretas con nivel moderado y suelo Macahuistle con nivel alto, dos mejoradores inorgánicos (yeso y ácido sulfúrico y un mejorador orgánico (estiércol. Se utilizó un diseño experimental completamente al azar con arreglo factorial 2 × 2 × 3. Las variables de respuesta fueron conductividad eléctrica (CE, porciento de sodio intercambiable (PSI y pH. La salinidad inicial en el suelo Carretas, con CE = 7.75 dS m-1 y Macahuistle con CE = 22.2 dS m-1, disminuyó a menos de 4 dS m-1. El PSI inicial del suelo Carretas fue 18.4 y el del suelo Macahuistle 34, valores que se abatieron a niveles menores de 8. El pH inicial de 7.8 en el suelo Carretas y 8 en el suelo Macahuistle, disminuyeron a un valor de 7.4 con la aplicación de estiércol y ácido sulfúrico. El lavado redujo la salinidad y sodicidad de ambos suelos hasta niveles satisfactorios para cultivos convencionales, con y sin de la aplicación de estiércol bovino, yeso y ácido sulfúrico.
Tracing the strength of the southwest monsoon using boron isotopes in the eastern Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Naik, S.S.; Naidu, P.D.; Foster, G.L.; Martínez-Boti, M.A.
. Foster and Miguel A. Martínez-Botí Ocean and Earth Science, National Oceanography Centre Southampton, University of Southampton, SO14 3ZH,UK Corresponding author: S. S. Naik, CSIR-National Institute of Oceanography, Goa 403004, India (sushant... of the foraminifers was determined at the University of Southampton on a Thermo Scientific Neptune MC-ICPMS [see Foster, 2008 and Henehan et al., 2013]. External reproducibility of the MC-ICPMS δ11B data is determined from a relationship between the reproducibility...
The Determinants of Household Poverty in South Africa
Ajuruchukwu Obi; Sanelise Tafa
2016-01-01
South Africa was privileged to be part of the MDGs agenda which was adopted in 2000. One of the aims of MDGs was to reduce extreme poverty by half in 2015. For that reason, South Africa integrated policies and strategies to rid poverty by half to that of United Nations (UN). Through all the combined policy approaches, South Africa has successfully achieved the target of halving the population living below PPP$1.25c per person per day. Whichever threshold used, the results showed that the perc...
Taylor, Jonathan G.; Johnson, S. Shea; Shelby, Lori B.
2005-01-01
Introduction Wolves of Grand Teton National Park and the Greater Yellowstone Area Gray wolves (Canis lupus) appeared in Grand Teton National Park (GRTE) in October of 1998, two years after being reintroduced to Yellowstone National Park (YNP). Since that time, five packs have been within the GRTE borders - Gros Ventre Pack, Nez Perce Pack, Yellowstone Delta Pack, Teton Pack, and Green River Pack (Table 1). Wolves in the Greater Yellowstone Area are increasing and spreading out geographically (USFWS and others, 2004). This dispersion was demonstrated recently by the death of a 2-year-old female wolf from the Swan Lake pack on I-70 in Colorado (June 7, 2004; http://mountain-prairie.USFWS.gov/pressrel /04-43.htm). The organization of wolf packs in the GYA is dynamic and highly structured. In 2003, for example, a wolf from the Teton Pack joined with the Green River Pack, and several young wolves left the Teton Pack and moved south (USFWS and others, 2004). Pack size (averaging five to ten members) is dependent on hunting efficiency, which depends on prey size, type, and density. Each pack defends home ranges of several hundred square miles. The social structure of the pack is based on a breeding pair (an alpha male and female). Other wolves in the pack can be categorized as betas (males and/or females second in rank to the alphas), subordinates, pups, and occasional omegas (outcasts). Because generally only the alpha pair breeds, subordinate wolves of reproductive age must disperse from their packs and form new associations in order to breed. (http://www.nps.gov/grte/wolf/biolo.htm). The reintroduced wolves are classified by the U.S. Fish and Wildlife Service (USFWS) as "nonessential experimental" under section 10(j) of the Endangered Species Act. The recovery criteria for the GYA wolves were met in 2002 for removing the wolves from the Endangered Species List (30 or more breeding pairs). Currently, the USFWS manages wolf populations in the GYA until delisting occurs
La Seguridad Integral: España 2020
Pardo Buendía, Mercedes
2009-01-01
Dirección y co-redacción principal: Óscar Jaime Jiménez, Antonio M. Díaz Fernández. Expertos que han participado en la elaboración: Rogelio Alonso Pascual, Félix Arteaga Martín, Pedro Arrojo Agudo, Rut Bermejo Casado, Julio Bordas Martínez, Lorenzo Castro Moral, Andrés García Gómez, Raúl C. Mainar-Jaime, Rafael Martínez Martínez, Miguel Ángel Muñoz Rodríguez, Mercedes Pardo Buendía, René Pita Pita, Gonzalo Sáenz de Miera, Fernando Soteras Escartín, Diego Torrente Robles, F...
Energy Technology Data Exchange (ETDEWEB)
Cleary, Peter; Kucera, Paul; Blenden, Michael
2003-12-01
This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303
Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez.
Directory of Open Access Journals (Sweden)
Francisco José Rodríguez Marín
2013-01-01
Full Text Available Revistas UMA Encabezado de página Usuaria/o Contraseña No cerrar sesión Notificaciones Vista Suscribirse Idioma Contenidos Examinar Por número Por autor/a Por título Otras revistas Información Para lectores/as Para autores/as Para bibliotecarios/as Open Journal Systems Inicio Acerca de Actual Archivos Avisos Inicio > Núm. 34 (2013 > Rodríguez Marín Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez. Francisco José Rodríguez Marín Resumen Ver Resumen El interés de Rosario Camacho por la multiplicidad de mensajes y la cultura simbólica de carácter funerario fue, inicialmente, una consecuencia natural de sus investigaciones sobre la arquitectura barroca. En uno de sus libros más reconocidos, Málaga barroca. Arquitectura religiosa de los siglos XVII y XVIII (1981 analizó el panteón de los condes de Buenavista en la iglesia del monasterio de la Victoria y su impresionante conjunto de relieves y esculturas en torno a la muerte, recogiendo algunas de las interpretaciones que hasta entonces se habían realizado, como las de Juan Temboury o Santiago Sebastián. El carácter excepcional del conjunto arquitectónico de la iglesia, el monasterio, y especialmente, de la rica y original superposición de espacios verticales integrado por el mencionado panteón, la sacristía y el camarín de la Virgen, justifican la atención pormenorizada que se le prestó en una de las carpetas que, incluyendo planimetría y dedicadas al Barroco, fueron publicadas por el Colegio de Arquitectos de Málaga. La titulada El Santuario de la Victoria de Málaga (1986 tuvo por autores a Rosario Camacho y al arquitecto José María Romero.
Directory of Open Access Journals (Sweden)
Rooel Campos-Rodríguez
2013-06-01
Full Text Available Los procesos productivos no son totalmente eficientes, lo cual contribuye a la generación de residuos. En Costa Rica, son las municipalidades las responsables del manejo integral de los residuos sólidos. Es por eso que la problemática de esta investigación se centra en el manejo de tales desechos, que se ha convertido en uno de los principales problemas ambientales que enfrentan los municipios del país. Es necesario hacerle frente desde la perspectiva del desarrollo sostenible, para lo cual se requiere una nueva visión y sensibilización de los gobiernos locales y de los habitantes ante esta problemática. Un ejemplo de cómo encarar la problemática ambiental es la labor que están desarrollando los municipios de Jiménez y Oreamuno. Estas dos instituciones han trabajado en aspectos de educación ambiental, desarrollo y sostenibilidad y han logrado resultados favorables en el tratamiento y disposición adecuada de los residuos sólidos. El municipio de Oreamuno cuenta con un plan de manejo integral de residuos sólidos, tanto orgánicos como inorgánicos. También tiene un centro de acopio y se está trabajando en la implementación de biorreactores que permitirán la producción de bioabonos, captación de gas metano, remoción de metales en los lixiviados, así como la recuperación, comercialización y transformación de los residuos reciclables y reutilizables. Por su parte, el municipio de Jiménez realiza un manejo adecuado de los residuos; los desechos inorgánicos reciclables son aprovechados por medio del centro de acopio del cantón y los residuos orgánicos son transformados en abono orgánico, el cual se utiliza en las fincas de la localidad. El objetivo de este artículo es analizar estos planteamientos, así como su relación con el desarrollo y la sostenibilidad.Currently, the production processes are not efficient, which contributes to the generation of waste. In Costa Rica the municipalities are responsible for
Directory of Open Access Journals (Sweden)
Navarrete Prieto, Benito
2005-09-01
Full Text Available Three drawings of altarpieces executed by the Sevillian sculptor Juan Martinez Montañés, preserved in the copy of Vignola's architectural treatise in the Colegio de Arquitectos de Valencia are analyzed here. The first drawing is a preliminary study for the altarpiece of the Immaculate Conception in the Parrochial Church of El Pedroso (Seville. The second drawing, also a preliminary idea, is for the lost altarpiece of the Dominican monastery of Portacelli in Seville, from which only the figure of St Dominic of Guzman flagellating himself has survived (Museo de Bellas Artes de Sevilla. The third is the model for the type of altarpiece-tabernacle used by Montañés in the Convent of Santa Clara (Seville. The author also points out the origin of certain elements of Montañés's designs in the prints of Vignola's treatise.
Presentamos un análisis de tres de los dibujos de retablos que se conservan en el ejemplar del Vignola del Colegio de Arquitectos de Valencia y que pertenecen al escultor sevillano Juan Martínez Montañés. El primero de ellos es preparatorio para el retablo de la Inmaculada de la iglesia parroquial del Pedroso (Sevilla, conservado in situ actualmente. El segundo es para el perdido Retablo de los dominicos de Portacoeli de Sevilla, del que se conserva el Santo Domingo de Guzman azotándose en el Museo de Bellas Artes de Sevilla, y el tercero es modelo para la tipología del Montañés del Retablo-Tabernáculo en la iglesia del convento de Santa Clara de Sevilla, estudiándose además el origen de algunos elementos de Montañés en los propios grabados del libro de Vignola.
Spatially correlated heterogeneous aspirations to enhance network reciprocity
Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki
2012-02-01
Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.
Revisiting mouse peritoneal macrophages: heterogeneity, development and function
Directory of Open Access Journals (Sweden)
Alexandra Dos Anjos Cassado
2015-05-01
Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex
Aportaciones a la flora Granatense, III
Martínez Parras, J.Mª.; Molero Mesa, J.
1983-01-01
Se comentan algunas especies nuevas o críticas para la provincia de Granada. Se establecen las nuevas combinaciones siguientes: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa y Cerastium alpinum subsp. nevadense (Pau) Martínez Parras & Molero Mesa. In this paper, some plants from Granada province are studied. The following new combinations are stablished: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa and Cerastium alpinum subsp. ...
Directory of Open Access Journals (Sweden)
Iván Pérez-Santos
2013-03-01
Full Text Available Con un microperfilador SCAMP (Self Contained Autonomous MicroProfile se detectó un proceso de Doble Difusión Convectiva (DDC, en los canales Martínez y Baker de la Patagonia central, Chile. Este perfilador midió temperatura y salinidad en la columna de agua con una resolución del orden de milímetros. El muestreo se efectuó en diciembre 2011, en 19 estaciones oceanográficas de ~55 m de profundidad. Los registros del microperfilador permitieron detectar la formación de escaleras termohalinas que caracterizan la formación de la DDC. Por medio del ángulo de Turner se confirmó que debajo de una capa superficial fuertemente estratificada (7-10 m se registraron eventos de DDC a profundidades entre 15 y 45 m. La DDC fue débil en la mayoría de los registros pero se evidenciaron eventos fuertes entre 15 y 40 m. En la capa subsuperficial, su origen se debió al intercalamiento de las masas aguas estuarinas (aguas frías y menos saladas encima de las oceánicas (aguas más cálidas y saladas, mientras que en la superficie la interacción océano-atmósfera favoreció su ocurrencia. La DDC en conjunto con el viento, las mareas y las ondas internas, puede constituir un mecanismo importante para la mezcla vertical, influenciando los flujos de calor, el hábitat de las especies marinas en estas profundidades y la exportación de carbono hacia los sedimentos.
Managing Danish pupils’ well-being
DEFF Research Database (Denmark)
Ratner, Helene Gad; Gad, Christopher
The concept of well-being has become a key category of social and political imagination, cultivating new understandings of 'what it means to be a capable person' (Corsín Jiménez, 2008, 2). In 2015, the Danish Ministry of Education began conducting national, annual measurements of Danish pupils...... national objectives for pupils' well-being; 2) the Danish newspaper A4's interactive, online mapping of pupils' well-being at all Danish schools, developed from the same numbers (accessed through their juridical right to access government files) but using different calculative techniques and aimed...
From event analysis to global lessons: disaster forensics for building resilience
Keating, Adriana; Venkateswaran, Kanmani; Szoenyi, Michael; MacClune, Karen; Mechler, Reinhard
2016-07-01
With unprecedented growth in disaster risk, there is an urgent need for enhanced learning and understanding of disasters, particularly in relation to the trends in drivers of increasing risk. Building on the disaster forensics field, we introduce the post-event review capability (PERC) methodology for systematically and holistically analysing disaster events, and identifying actionable recommendations. PERC responds to a need for learning about the successes and failures in disaster risk management and resilience, and uncovers the underlying drivers of increasing risk. We draw generalisable insights identified from seven applications of the methodology to date, where we find that across the globe policy makers and practitioners in disaster risk management face strikingly similar challenges despite variations in context, indicating encouraging potential for mutual learning. These lessons highlight the importance of integrated risk reduction strategies. We invite others to utilise the freely available PERC approach and contribute to building a repository of learning on disaster risk management and resilience.
A Novel Role for C5a in B-1 Cell Homeostasis
Directory of Open Access Journals (Sweden)
Katharina Bröker
2018-02-01
Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells
Lessons Learned from Creating the Public Earthquake Resource Center at CERI
Patterson, G. L.; Michelle, D.; Johnston, A.
2004-12-01
The Center for Earthquake Research and Information (CERI) at the University of Memphis opened the Public Earthquake Resource Center (PERC) in May 2004. The PERC is an interactive display area that was designed to increase awareness of seismology, Earth Science, earthquake hazards, and earthquake engineering among the general public and K-12 teachers and students. Funding for the PERC is provided by the US Geological Survey, The NSF-funded Mid America Earthquake Center, and the University of Memphis, with input from the Incorporated Research Institutions for Seismology. Additional space at the facility houses local offices of the US Geological Survey. PERC exhibits are housed in a remodeled residential structure at CERI that was donated by the University of Memphis and the State of Tennessee. Exhibits were designed and built by CERI and US Geological Survey staff and faculty with the help of experienced museum display subcontractors. The 600 square foot display area interactively introduces the basic concepts of seismology, real-time seismic information, seismic network operations, paleoseismology, building response, and historical earthquakes. Display components include three 22" flat screen monitors, a touch sensitive monitor, 3 helicorder elements, oscilloscope, AS-1 seismometer, life-sized liquefaction trench, liquefaction shake table, and building response shake table. All displays include custom graphics, text, and handouts. The PERC website at www.ceri.memphis.edu/perc also provides useful information such as tour scheduling, ask a geologist, links to other institutions, and will soon include a virtual tour of the facility. Special consideration was given to address State science standards for teaching and learning in the design of the displays and handouts. We feel this consideration is pivotal to the success of any grass roots Earth Science education and outreach program and represents a valuable lesson that has been learned at CERI over the last several
Directory of Open Access Journals (Sweden)
Marcelo BORRELLI
2016-07-01
Full Text Available This paper intends to critically analyze the editorial positions of the newspaper Clarín (Argentina against economic policy Economy Minister José Alfredo Martínez de Hoz (1976-1981, he was, along with state terrorism, one of the main axes which supported the attempt refounding of the last military dictatorship (1976-1983 of Argentina society and whose effects generated long-term regressive changes in the national economy.
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
Energy Technology Data Exchange (ETDEWEB)
Ninaber, Maarten K., E-mail: m.k.ninaber@lumc.nl [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Stolk, Jan; Smit, Jasper; Le Roy, Ernest J. [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Kroft, Lucia J.M. [Department of Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Els Bakker, M. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Vries Bouwstra, Jeska K. de; Schouffoer, Anne A. [Department of Rheumatology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Staring, Marius; Stoel, Berend C. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands)
2015-05-15
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
International Nuclear Information System (INIS)
Ninaber, Maarten K.; Stolk, Jan; Smit, Jasper; Le Roy, Ernest J.; Kroft, Lucia J.M.; Els Bakker, M.; Vries Bouwstra, Jeska K. de; Schouffoer, Anne A.; Staring, Marius; Stoel, Berend C.
2015-01-01
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Sanchez Lopez, N.; Hudak, A. T.; Boschetti, L.
2017-12-01
, and Elk Creek watersheds ( 54,000 ha) within the Nez Perce-Clearwater National Forest in Idaho, where airborne LiDAR and reference maps on TSD were available. Simulated GEDI footprints and waveforms were obtained from airborne LiDAR point clouds and the results were compared to similar analysis performed with airborne LiDAR.
BIG SKY CARBON SEQUESTRATION PARTNERSHIP
Energy Technology Data Exchange (ETDEWEB)
Susan M. Capalbo
2005-01-31
The Big Sky Carbon Sequestration Partnership, led by Montana State University, is comprised of research institutions, public entities and private sectors organizations, and the Confederated Salish and Kootenai Tribes and the Nez Perce Tribe. Efforts under this Partnership in Phase I fall into four areas: evaluation of sources and carbon sequestration sinks that will be used to determine the location of pilot demonstrations in Phase II; development of GIS-based reporting framework that links with national networks; designing an integrated suite of monitoring, measuring, and verification technologies and assessment frameworks; and initiating a comprehensive education and outreach program. The groundwork is in place to provide an assessment of storage capabilities for CO{sub 2} utilizing the resources found in the Partnership region (both geological and terrestrial sinks), that would complement the ongoing DOE research. Efforts are underway to showcase the architecture of the GIS framework and initial results for sources and sinks. The region has a diverse array of geological formations that could provide storage options for carbon in one or more of its three states. Likewise, initial estimates of terrestrial sinks indicate a vast potential for increasing and maintaining soil C on forested, agricultural, and reclaimed lands. Both options include the potential for offsetting economic benefits to industry and society. Steps have been taken to assure that the GIS-based framework is consistent among types of sinks within the Big Sky Partnership area and with the efforts of other western DOE partnerships. The Partnership recognizes the critical importance of measurement, monitoring, and verification technologies to support not only carbon trading but all policies and programs that DOE and other agencies may want to pursue in support of GHG mitigation. The efforts in developing and implementing MMV technologies for geological sequestration reflect this concern. Research is
Energy Technology Data Exchange (ETDEWEB)
Daniel, Mitch; Gebhards, John
2003-05-01
The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek through artificial propagation. Adult chinook salmon collection and spawning began in 1998. A total of 114 fish were collected from Johnson Creek and 54 fish (20 males and 34 females) were retained for Broodstock. All broodstock were transported to Lower Snake River Compensation Plan's South Fork Salmon River adult holding and spawning facility, operated by the Idaho Department of Fish and Game. The remaining 60 fish were released to spawn naturally. An estimated 155,870 eggs from Johnson Creek chinook spawned at the South Fork Salmon River facility were transported to the McCall Fish Hatchery for rearing. Average fecundity for Johnson Creek females was 4,871. Approximately 20,500 eggs from females with high levels of Bacterial Kidney Disease were culled. This, combined with green-egg to eyed-egg survival of 62%, resulted in about 84,000 eyed eggs produced in 1998. Resulting juveniles were reared indoors at the McCall Fish Hatchery in 1999. All of these fish were marked with Coded Wire Tags and Visual Implant Elastomer tags and 8,043 were also PIT tagged. A total of 78,950 smolts were transported from the McCall Fish Hatchery and released directly into Johnson Creek on March 27, 28, 29, and 30, 2000.
Evaluation of available MHD seed-regeneration processes on the basis of energy considerations
International Nuclear Information System (INIS)
Sheth, A.C.; Johnson, T.R.
1978-09-01
Of the several processes described in the literature that are capable of separating sulfur from alkali-metal sulfates, seven processes were selected as candidates for regenerating seed material for reuse in open-cycle MHD. After a brief assessment of each process, two were selected for a detailed analysis, namely, a process developed by the Pittsburgh Energy Research Center (PERC) and a modified version of the Tampella process. The processes were compared on the bases of energy requirements and the amount of research work needed to develop a seed-regeneration process for MHD systems. The energy requirements given should be considered as rough values, because factors such as heat losses and component efficiency were not included in the analysis. On the basis of energy consumption, the PERC process has a slight advantage over the Tampella process; on the basis of the present state of development of various components, the Tampella process has a clear advantage. Accordingly, it was recommended that developmental programs be carried out for both the PERC and Tampella processes
Romero-Franco, Natalia; Párraga-Montilla, Juan Antonio; Molina-Flores, Enrique M; Jiménez-Reyes, Pedro
2018-06-01
Romero-Franco, N, Párraga-Montilla, JA, Molina-Flores, EM, and Jiménez-Reyes, P. Effects of combining running and practical duration stretching on proprioceptive skills of national sprinters. J Strength Cond Res XX(X): 000-000, 2018-Practical duration stretching after aerobic activities is a recommended component of the first part of warm-up because of its effects on performance. However, its effects on proprioceptive skills are unknown. This study aimed to analyze the effects of running and practical duration static stretching (SS) and dynamic stretching (DS) on postural balance and the joint position sense (JPS) of national sprinters. Thirty-two national sprinters were randomly classified into a SS group (n = 11), DS group (n = 11), or control group (n = 10). Static stretching performed 5 minutes of running and short-duration (20 seconds) static stretches; DS performed 5 minutes of running and short-duration dynamic (20 seconds) stretches; and the control group performed 5 minutes of running. Before and after the intervention, unipedal static postural balance and knee JPS were evaluated. Static stretching exhibited a more centralized center of pressure in the medial-lateral plane for unipedal static postural balance in right-leg support after stretching (p = 0.005, d = 1.24), whereas DS showed values further from the center after stretching for the same unipedal support compared with baseline (p = 0.042, d = 0.49), and the control group remained stable (p > 0.05). Joint position sense did not show significant differences in any group (p > 0.05). In conclusion, combining running and practical duration SS may be beneficial for right-leg postural stabilization, whereas DS may be partly and slightly deleterious. Both SS and DS combined with running and running alone have neutral effects on knee JPS. Sports professionals should consider running and practical duration SS as part of the warm-up of sprinters to partly improve unipedal static postural balance.
PERCEÇÕES SOBRE AS ABORDAGENS À APRENDIZAGEM – ESTUDO DE VARIÁVEIS PSICOLÓGICAS
Lourenço, Abílio Afonso; Nogueira, Carla Maria Leite
2014-01-01
Esta investigação, realizada numa escola básica no norte de Portugal, tem como objetivo analisar as perceções que os alunos apresentam sobre algumas variáveis relativas à forma como desenvolvem a sua aprendizagem, nomeadamente: a autorregulação para a aprendizagem; os processos de estudo utilizados; o controlo volitivo; a planificação da gestão do tempo; e a procrastinação. Outra finalidade deste estudo éverificar se existe uma relação significativa entre estas variáveis e a perceção de autoe...
Fragoso, Nuno Miguel do Rosário Mendes
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...
Recordando y descubriendo a Gala, la última descendiente de Rosalía de Castro
García Vega, Lucía
2015-01-01
Recientemente, se ha cumplido medio siglo del fallecimiento de Gala Martínez de Castro (1871-1964), último miembro de la familia ilustre fundada por la escritora Rosalía de Castro (1837-1885) y el historiador Manuel Martínez Murguía (1833-1923). A tr
P1-11: Visual Function and Neurotoxic Symptoms Related to Exposure to Organic Solvents
Directory of Open Access Journals (Sweden)
Ingrid Jimenez Barbosa
2012-10-01
Full Text Available Aim: Exposure to Perchloroethylene (PERC, a solvent used in dry-cleaning, is associated with neurotoxicity and changes in colour vision (CV and contrast sensitivity (CS. However, PERCs' impact on other aspects of visual function (VF such as chromatic contrast sensitivity (CCS, glass pattern detection (GPP, visual search (VS, and global motion sensitivity (GMS remains unclear. This study compared VF and neurotoxicity in two populations at risk, dry-cleaners (cases from Colombia and Australia. Control groups of people with community levels of exposure to PERC were also assessed. Methods: A case-control study of VF in people who are working in the dry-cleaning industry for at least 1 year (n = 40 Colombia; n= 34 Australia with controls (n = 35 each site. VF measures assessed were CSF, CCS, the FM Hue 100 test, VS, GPP, and GMS. Neurotoxic symptoms were assessed using the Q16 modified version questionnaire. Results: Cases had poorer CCS, hue discrimination, GPP, GMS, and higher Q16 scores than controls (p < .05. There was no effect of country. CS function was poorer than controls (p < .05 for spatial frequencies≥0.50 cpd for Australian cases but for ≥1.0 cpd for Colombian cases. There were no significant differences between cases and controls for serial and parallel VS. Conclusion: Our CSF and CV findings indicate that the CS deficit extends to lower spatial frequencies. Furthermore we report a reduction in the detection of form, motion, and CCS. These deficits were associated with neurotoxic symptoms. Because VS was unaffected, it suggests that PERC affects lower order visual functions more severely than higher level cognition.
International Nuclear Information System (INIS)
Umezu, Toyoshi; Shibata, Yasuyuki
2014-01-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles
Energy Technology Data Exchange (ETDEWEB)
Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp
2014-09-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.
Effect of extrusion parameters on some properties of dietary fiber ...
African Journals Online (AJOL)
use
2011-11-21
Nov 21, 2011 ... Méndez-García, S.1, Martínez-Flores, H.E.2* and Morales-Sánchez, E.3. 1Student of ... product (Sánchez-Alonso et al., 2007), coconut fiber ..... Rodríguez R, Jiménez A, Fernández-Bolaños J, Guillén R, Heredia A. (2006).
Johnston, N. A. C.; Bundy, B. A.; Andrew, J. P.; Grimm, B. K.; Ketcherside, D.; Rivero-Zevallos, J. A.; Uhlorn, R. P.
2017-12-01
Lewiston, Idaho is a small city in the Snake River Valley bordering North-Central Idaho and Southeastern Washington, with a population of over 40,000 including the surrounding areas. One of the main industries and employers in the region is a kraft paper mill in North Lewiston, which results in odorous levels of sulfur air pollutants there. The Idaho Department of Environmental Quality has an air monitoring station in Lewiston but measures only air particulate matter (PM). Surprisingly, not much long-term data exists on this area for specific air constituents such as volatile organics, hazardous air pollutants, and sulfur compounds. One year-long study conducted in 2006-2007 by the Nez Perce Tribe found high formaldehyde levels in the area, and warranted further study in July of 2016-2017. Our ongoing study began in the fall of 2016 and investigates the seasonal air composition in the Lewiston area. Specifically, active air sampling via sorbent tubes and analysis by thermal desorption gas chromatography-mass spectrometry (TD-GC-MS). was utilized to measure over 50 volatile organic compounds, hazardous air pollutants, and sulfurous compounds in ambient air (adapted from EPA Method TO-17). Seasonal, diurnal, and spatial variations in air composition were explored with weekly to monthly grab sampling. Dimethyl sulfide (DMS) and dimethyl disulfide (DMDS) were the primary sulfur compounds detected, and these varied considerably depending on time of day, season, location and meteorology. DMS was more prevalent in the summer months, while DMDS was more prevalent in the spring. Elevated concentrations of benzene and chloroform were found in the region during 2017, with average values of short term grab samples over three times the acceptable ambient concentrations in Idaho. These levels did not persist during longer term sampling of 12-hours, however further monitoring is needed to assess a potential health concern.
2013-03-01
through the National Security Doctrine, the ALCA (Area de Libre Comercio de las Americas, The Free Trade Area of the Americas) is, the Plan Colombia...of books such as El Mossad and Las Armas Secretas de la Cía). Other sources like El Universal of Mexico (30-OCT- 03), have stated that Al Qaeda has...María Edith Bordón”, Sandra Quiñónez, prosecutor of the Counter Kidnapping Unit said in El Tiempo newspaper. Bordón was kidnapped on September 21
Wiegand, Susanna; Raile, Klemens; Reinehr, Thomas; Hofer, Sabine; Näke, Andrea; Rabl, Wolfgang; Holl, Reinhard W
2008-04-01
The purpose of this study was to generate insulin dose (ID) percentiles for children and adolescents with type 1 diabetes mellitus (DM1) having the opportunity to assess this important parameter in relation to age and sex. Daily IDs per weight (ID/kg) were recorded in 22,177 patients with DM1 (3-25 years of age, DM1 duration of more than 2 years, 48% female) and ID percentiles (ID-Perc) were created statistically. The ID-Perc were compared between male and female, and between multiple insulin injection therapy (MIT) and continuous s.c. insulin infusion (CSII). A multivariate regression analysis was performed for ID in the third year of DM1 with ID/kg, body weight, age, gender, and insulin delivery regimen as variables. The 50th ID-Perc (P50) varied among 0.67 IU/kg (age 3 years), 0.93 IU/kg (13 years), and 0.70 IU/kg (23 years) increasing from early childhood to adolescence and decreasing toward adulthood. Highest P50 ID was found at 12 years in females (0.94 IU/kg) and at 14 years in males (0.92 IU/kg). Using ICT, the ID was significantly higher compared with CSII (P50: 0.94 IU/kg versus 0.79 IU/kg at 13 years). In multivariate regression analysis, ID was significantly (P>0.001) associated with age, gender, and insulin delivery regime. The ID-Perc were significantly different during various periods of childhood and were influenced by gender, body weight, and insulin injection regimes. Therefore, the presented data 1) provide evidence to interpret individual ID in children and adolescents with DM1 and 2) more specifically identify children with unusually high (insulin resistance and non-compliance) or low (MODY and persistent remission) insulin requirement.
Los novatores como etapa histórica
Directory of Open Access Journals (Sweden)
Antonio MESTRE
2009-11-01
Full Text Available Los trabajos de Cenai sobre la historia de la filosofía española del siglo XVII y, en concreto, sobre la presencia de los filósofos modernos, encontraron una sorprendente constatación en el libro de O. V. Quiroz-Martínez. En 1949 aparecía La introducción de la filosofía moderna en España de la autora mexicana. Quiroz- Martínez estudiaba unos años muy complejos del pensamiento español: desde la aparición de la Philosofía libera de Isaac Cardoso (1673 hasta el Ocaso de las formas aristotélicas de Mateo Zapata (1745. Ahora bien, si el tema esencial era la filosofía, dada la implicación de la escolástica con la física aristotélica, la introducción de la filosofía moderna (Descartes o Gassendi provocaba las alusiones a cuestiones científicas. Así lo reconoce Quiroz-Martínez, cuando escribe: «Todas estas obras (de Tosca, Berní, Martín Martínez son favorables a la física moderna».
Um mundo em crise A world in crisis
Directory of Open Access Journals (Sweden)
Carlos Altamirano
2009-01-01
Full Text Available Este estudo tem por objeto analisar um segmento do pensamento argentino da década de 1930, representado no ensaísmo sobre a "alma", ou o caráter nacional. Esse ensaísmo produziu alguns textos que se transformaram, por meio da crítica, em clássicos da reflexão sobre o país - tais como Radiografía de la pampa, de Ezequiel Martínez Estrada, e Historia de una pasión argentina, de Eduardo Mallea -, e que se gestaram sobre a base de uma crise política - sua primeira exteriorização foi o golpe de Estado de 1930 - e de uma desordem mais ampla dos pontos intelectuais de referência, em consequência da falência do positivismo entre as elites culturais. O dissabor provocado pelo contexto político nacional se mesclou ao mal-estar oriundo do pensamento europeu sobre a crise - crise do espírito, da ordem liberal e do capitalismo -, e esse amálgama alimentou um estado de descontentamento intelectual que ganhou forma na reflexão ensaística. De modo cada vez mais amplo, esse gênero dá início a uma rigorosa revisão da Argentina liberal, no âmbito de cuja produção destacam-se os referidos ensaios de Martínez Estrada e de Mallea, que serão analisados na parte final do presente estudo.This study analyzes a sector of Argentine thought from the 1930s, represented in the essays on the national 'soul' or character. This essay writing produced a number of texts that were transformed, through critical appraisal, into classics on the country itself - such as Radiografía de la pampa by Ezequiel Martínez Estrada, and Historia de una pasión argentina by Eduardo Mallea - and which emerged out of a political crisis - whose first notable effect was the 1930 coup d'état - and a more widespread disruption of the intellectual points of reference caused by the exhaustion of positivism as a paradigm among the cultural elites. The unease provoked by the national political context merged with the unease stemming from European thought concerning the
Directory of Open Access Journals (Sweden)
Eulalia Hernández Ciro
2015-07-01
Full Text Available Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprensión de la historia de nuestro país, no solo porque muestran el lado sensible y cotidiano de la vida de un hombre que ocupa un lugar privilegiado en la historia de Colombia, sino porque dejan entrever los discursos, las representaciones y las prácticas de la clase dirigente del país. Acercarse a esta correspondencia posibilita conocer asuntos concernientes a los roles femeninos y masculinos, a la educación de los hijos, a las relaciones sociales y públicas, a la vida doméstica, es decir, tanto las ideas y los sentimientos, como la geografía y la cultura material de una época.
Haschke, Jan; Seif, Johannes P.; Riesen, Yannick; Tomasi, Andrea; Cattin, Jean; Tous, Loï c; Choulat, Patrick; Aleman, Monica; Cornagliotti, Emanuele; Uruena, Angel; Russell, Richard; Duerinckx, Filip; Champliaud, Jonathan; Levrat, Jacques; Abdallah, Amir A.; Aï ssa, Brahim; Tabet, Nouar; Wyrsch, Nicolas; Despeisse, Matthieu; Szlufcik, Jozef; De Wolf, Stefaan; Ballif, Christophe
2017-01-01
architectures, including so-called Aluminum back-surface-field (BSF), passivated emitter and rear cell (PERC), passivated emitter rear totally diffused (PERT), and silicon heterojunction (SHJ) solar cells. We compare measured temperature coefficients (TC
Directory of Open Access Journals (Sweden)
José Antonio Martínez
2017-07-01
Full Text Available This research overcomes some of the drawbacks of the study of Martínez & Caudill (2013 regarding midseason coaching change in the National Basketball Association (NBA, adding new cases and achieving a disparate methodology. Changing a coach is an important managerial decision which does not guarantee improvement in the short term. Only about 12% of new coaches outperformed in a significantly way their predecessors. In order to maximize the probability of success, highly experienced coaches, with a long career as former professional players should be signed. In addition, change should be made before season advances, although it depends of the winning percentage of teams. Resumen Esta investigación supera varias de las limitaciones del estudio de Martínez y Caudill (2013 sobre el cambio de entrenador durante la temporada en la National Basketball Association (NBA, incluyendo nuevos casos y empleando una metodología diferente. La decisión de cambiar un entrenador es una importante cuestión para los gestores deportivos que no garantiza la mejora del rendimiento del equipo en el corto plazo. Sólo un 12% de los nuevos entrenadores mejoraron de manera significativa el rendimiento de sus predecesores. Con el fin de maximizar la probabilidad de éxito, entrenadores con gran experiencia y con una carrera previa y larga como jugadores profesionales deberían ser contratados. Además, el cambio debería hacerse antes de que avanzara demasiado la competición, aunque ello depende del porcentaje de victorias de los equipos.
Comparison of biophysical factors influencing on emphysema quantification with low-dose CT
Heo, Chang Yong; Kim, Jong Hyo
2014-03-01
Emphysema Index(EI) measurements in MDCT is known to be influenced by various biophysical factors such as total lung volume, and body size. We investigated the association of the four biophysical factors with emphysema index in low-dose MDCT. In particular, we attempted to identify a potentially stronger biophysical factor than total lung volume. A total of 400 low-dose MDCT volumes taken at 120kVp, 40mAs, 1mm thickness, and B30f reconstruction kernel were used. The lungs, airways, and pulmonary vessels were automatically segmented, and two Emphysema Indices, relative area below -950HU(RA950) and 15th percentile(Perc15), were extracted from the segmented lungs. The biophysical factors such as total lung volume(TLV), mode of lung attenuation(ModLA), effective body diameter(EBD), and the water equivalent body diameter(WBD) were estimated from the segmented lung and body area. The association of biophysical factors with emphysema indices were evaluated by correlation coefficients. The mean emphysema indices were 8.3±5.5(%) in RA950, and -930±18(HU) in Perc15. The estimates of biophysical factors were 4.7±1.0(L) in TLV, -901±21(HU) in ModLA, 26.9±2.2(cm) in EBD, and 25.9±2.6(cm) in WBD. The correlation coefficients of biophysical factors with RA950 were 0.73 in TLV, 0.94 in ModLA, 0.31 in EBD, and 0.18 WBD, the ones with Perc15 were 0.74 in TLV, 0.98 in ModLA, 0.29 in EBD, and 0.15 WBD. Study results revealed that two biophysical factors, TLV and ModLA, mostly affects the emphysema indices. In particular, the ModLA exhibited strongest correlation of 0.98 with Perc15, which indicating the ModLA is the most significant confounding biophysical factor in emphysema indices measurement.
Typhus, yellow fever and Medicine in Mexico during the French intervention
Gerardo-Ramírez, Monserrat; Zavaleta-Castro, Jesús; Gómez-Quiroz, Luis Enrique
2018-01-01
French intervention in Mexico (1861-1867) is particularly full of episodes of patriotic heroism in terms of military, politic and, even, religious affairs, however this history is also rich in episodes related to diseases and the evolution of Mexican scientific medicine practice, epidemics such as typhus (nowadays knows as rickettsiosis), yellow fever, or cholera. Principally, this context outlined the Mexican history and influenced the course of the nation. The epidemics served as fertile land for the development of medicine science leading by prominent physicians, particularly by doctor Miguel Francisco Jiménez. Copyright: © 2018 SecretarÍa de Salud.
Directory of Open Access Journals (Sweden)
Kamal Moufid
2013-01-01
Conclusions: In our series, Perc-URS is a safe and efficient treatment option for proximal ureteral stone, especially when the stone size is superior to 15 mm with the presence of moderate or severe hydronephrosis.
Portfolio as a tool to evaluate clinical competences of traumatology in medical students
Santonja-Medina, Fernando; Garc?a-Sanz, M Paz; Mart?nez-Mart?nez, Francisco; B?, David; Garc?a-Esta?, Joaqu?n
2016-01-01
Fernando Santonja-Medina,1,2 M Paz García-Sanz,3 Francisco Martínez-Martínez,1,2 David Bó,1,2,4 Joaquín García-Estañ,5 1Faculty of Medicine, Department of Traumatology, 2Faculty of Medicine, University Hospital Virgen de la Arrixaca, 3Faculty of Medicine, Department of Education, 4Faculty of Medicine, University Hospital Morales Meseguer, 5Faculty of Medicine, Department of Physiology, University of Murcia, Murcia, S...
Contribution à étymologie de l' oronyme slovène Nanos
Directory of Open Access Journals (Sweden)
Anton Grad
1982-12-01
Full Text Available Pour ll' origine de l' oronyme slovène Nanos (a l' est de Trieste, obscure jusqu'ici, l' auteur propose, en se basant sur le nom italien de la montagne, à savoir Naso (= nez df M.onte Re, la base romane Nason (= gros nez, désignation populaire - supposée par l' auteur - de la montagne, d' où par metathèse s - n > n - s, en slovène Nanos.
Nitrogen-doped carbon nanotubes as a metal catalyst support
CSIR Research Space (South Africa)
Mabena, LF
2011-05-01
Full Text Available ., which are among the most commonly used heterogeneous catalyst supports (Mart??nez-Me?ndez et al. 2006). Catalyst activity depends on the particle size and appropriate dis- tance between each particle. These catalysts deposited on a support... supported Pt electrodes. Appl Catal B Environ 80:286?295 Maldonado S, Morin S, Stevenson KJ (2006) Structure, composition, and chemical reactivity of carbon nanotubes by selective nitrogen doping. Carbon 44:1429?1437 Mart??nez-Me?ndez S, Henr??quez Y...
Lifescience Database Archive (English)
Full Text Available entage concerning shoot regeneration 2 ME10-141 ... Chr07 19.51 6.84 ... 10.1186/1471-2229-11-140 22014149 ... QT73653 Solanum lycopersicum Solanaceae SpRg-7 In vitro plant regeneraion bud perc
Energy Technology Data Exchange (ETDEWEB)
Lenio, Martha A.T. [REC Technology US, Inc., 1159 Triton Dr., Foster City, CA 94301 (United States); Lennon, A.J.; Ho-Baillie, A.; Wenham, S.R. [ARC Photovoltaics Centre of Excellence, University of NSW, Sydney, NSW 2052 (Australia)
2010-12-15
Many existing and emerging solar cell technologies rely on plated metal to form the front surface contacts, and aluminium to form the rear contact. Interactions between the metal plating solutions and the aluminium rear can have a significant impact on cell performance. This paper describes non-uniform nickel deposition on the sintered aluminium rear surface of passivated emitter and rear contacted (PERC) cells patterned using an inkjet printing technique. Rather than being plated homogeneously over the entire rear surface as is observed on an alloyed aluminium rear, the nickel is plated only in the vicinity of the point openings in the rear surface silicon dioxide dielectric layer. Furthermore, this non-uniform nickel deposition was shown to increase the contact resistance of the rear point contacts by an order of magnitude, resulting in higher series resistance values for these fabricated PERC cells. (author)
Driver response to the TetraStar Navigation Assistance System by age and sex
1997-07-01
This study is part of the evaluation of the FAST-TRAC operational test of an Intelligent Transportation System (ITS) in Michigan and is concerned with user perceptions and behaviors with Advanced Traveler Information Systems (ATIS). The use and perce...
Conflicto de identidad : indefinición sexual en tres poetas de la Edad de Plata
Gómez Garrido, Marta
2013-01-01
Artículo sobre la presencia de un conflicto identitario relacionado con el género en la obra de tres poetas de la llamada Edad de Plata Española: Lucía Sánchez Saornil, Ana María Martínez Sagi y Carmen Conde. Article about the existence of a gender-related identity conflict in three female poets of the Silver Age of Spanish Literature: Lucía Sánchez Saornil, Ana María Martínez Sagi and Carmen Conde.
El acortamiento de los isquiosurales
Miguel Vidal Barbier; Tania Vidal Almiñana; Mercedes Almela Zamorano; Miguel Vidal Almiñana
2011-01-01
El acortamiento de los isquiosurales, según varios autores (Bado, 1977; Jordà, 1971; Lambrinudi, 1934; Latorre & Hernández, 2003; López, Ferragut, Alacid, Yuste, & García, 2008; Santonja, Andújar, & Martínez, 1994; Santonja, Ferrer, & Martínez, 1995), puede producir alteraciones en la estática del raquis que pueden desencadenar anomalías en su estructura y procesos álgidos. Estos hechos hacen que la detección temprana de un acortamiento en estos músculos sea importante para prevenir posibles ...
Conflicting discourses of church youths on masculinity and sexuality ...
African Journals Online (AJOL)
However, a small number of participants challenged current gender norms and ... sexuality, young churchgoers, HIV prevention, gender equality, DR Congo ... Les garc¸ons ont e´te´ perc¸us comme des personnes qui ont des rapports sexuels ...
Directory of Open Access Journals (Sweden)
Juan Pedro Rojas Pichardo
2011-04-01
Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Se trata de reseña de Casas Gómez, M. e I. Penadés Martínez (Coords., M. T. Díaz Hormigo (ed. (1998, Estudios sobre el Diccionario de uso del español de María Moliner, Cádiz, Universidad de Cádiz.
International Nuclear Information System (INIS)
Blenden, M.L.; Osborne, R.S.; Kucera, P.A.
1996-01-01
For the second consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 6 to June 20, 1995. We PIT tagged and released 421 wild chinook salmon smolts, 747 hatchery chinook salmon smolts (445 HxW and 302 HxH), 227 wild steelhead trout smolts and 1,296 hatchery steelhead trout smolts. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 78.4% for wild chinook salmon, 58.9% for hatchery chinook salmon (HxW), 56.6% for hatchery chinook salmon (HxH), 76.2% for wild steelhead trout, and 69.2% for hatchery steelhead trout. Peak outmigration of NPT tagged wild Imnaha River chinook salmon smolts occurred from early to mid-May at Lower Granite, Little Goose, and Lower Monumental Dams. Median and 90% passage dates for wild chinook salmon smolts at Lower Granite Dam were May 1 and May 11, respectively. Continuous spill at Lower Granite Dam was initiated on May 3 and lasted for 51 days. The 90% passage date of wild chinook salmon smolts at Lower Granite Dam (May 11) preceded peak Snake River and Lower Granite (June 6) flows by 26 days. Although hatchery chinook salmon exhibited a shorter outmigration period through the Snake River than their wild counterparts, peak arrival for both groups occurred at approximately the same time. Median and 90% passage dates at Lower Granite Dam for other PIT tagged groups were: hatchery chinook salmon (NPT-HxW) - May 2 and May 13; hatchery chinook salmon (FPC-HxH) - May 8 and May 15; wild steelhead trout - May 2 and May 9; and hatchery steelhead trout (NPT and FPC) - May 31 and June 16. Hatchery steelhead trout displayed small peaks in arrival timing at Lower Granite and Little Goose Dams in mid-May to mid-June
Directory of Open Access Journals (Sweden)
Gonzalo Cerda Brintrup
1988-06-01
Full Text Available El Hotel Luxor, era un edificio de madera construido por Don Luis Jiménez, de varios pisos: el más alto de Castro. Situado entre la plaza y calle Serrano, acogía a los viajeros y junto a él, en la planta baja, la antigua casa donde funcionaba el único estudio fotográfico del pueblo: Foto Provoste. Don Gilberto Provoste había aprendido el arte de la imagen de su amigo Don Lucho Jiménez, a su llegada a Castro en 1934.
Feldman, Jonathan
2016-01-01
Fil: Feldman, Jonathan. Universidad Nacional de las Artes. Área Transdepartamental de Crítica de Artes. Instituto de Investigación y Experimentación en Arte y Crítica; Argentina Fil: Feldman, Jonathan. Universidad Nacional de Tres de Febrero. Instituto de Investigación en Arte y Cultura “Dr. Norberto Griffa”; Argentina Fil: Dámaso Martínez, Carlos. Universidad de Buenos Aires. Facultad de Filosofía y Letras; Argentina Fil: Dámaso Martínez, Carlos. Universidad Nacional de las Artes. Á...
Ana Merino
2010-01-01
Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: Mafalda de Quino, Paracuellos de Carlos Jiménez y Socorro de Miguel Rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrando una dimensión comprometida que interpela al lector. This article analyzes the representation of childhood in several Latin American comics: Mafalda by Quino, Paracuellos by Carlos Jiménez, and Socorro by Miguel Rep. In these comics, infancy...
Merino, Ana
2010-01-01
Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: mafalda de quino, paracuellos de carlos jiménez y socorro de miguel rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrand This article analyzes the representation of childhood in several latin american comics: mafalda by quino, paracuellos by carlos jiménez, and socorro by miguel rep. In these comics, infancy is articulated from an adult angle critical with ...
Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato
García Giménez, María; Martínez Llácer, Azahara
2011-01-01
Este proyecto pretende establecer un sistema de comunicación que permita difundir los valores, productos e imagen de la empresa Marangoni Cioccolato, enmarcada en la región italiana Le Marche dónde destaca por su tradición artesanal pero aún no es todo lo conocida que pretende ser. García Giménez, M.; Martínez Llácer, A. (2011). Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato. http://hdl.handle.net/10251/13399. Archivo delegad...
Comparative pharmacology of a new recombinant FSH expressed by a human cell line
DEFF Research Database (Denmark)
Koechling, Wolfgang; Plaksin, Daniel; Croston, Glenn E.
2017-01-01
Recombinant FSH proteins are important therapeutic agents for the treatment of infertility, including follitropin alfa expressed in Chinese Hamster Ovary (CHO) cells and, more recently, follitropin delta expressed in the human cell line PER.C6. These recombinant FSH proteins have distinct glycosy...
DEFF Research Database (Denmark)
Sonnichsen, André; Gad, Ulrik Pram
2008-01-01
Is nationality the only way of organizing political community? Given the ubiquity of the national principle, one might think so. But, in practice, the national principle is constantly challenged by what can be termed non-national identities. This article looks at manners in which such deviating...... identities can be conceptualized, how contemporary European states have attempted to deal with them when they arise and to what extent non-national modes of organizing political community can point towards a challenge to the national principle itself. In its capacity as an introduction to the special issue......, this article seeks to frame the subsequent articles within the overarching theme of the tension between national and non-national communities in contemporary Europe....
Intuitive Understanding of Base Rates
DEFF Research Database (Denmark)
Austin, Laurel
Purpose: This study examines whether physicians and other adults intuitively understand that the probability a positive test result is a true positive (positive predictive value, PPV) depends on the base rate of disease in the population tested. In particular, this research seeks to examine perce...
Sensitivity analysis of bridge health index to element failure and element conditions.
2009-11-01
Bridge Health Index (BHI) is a bridge performance measure based on the condition of the bridge elements. It : is computed as the ratio of remaining value of the bridge structure to the initial value of the structure. Since it : is expressed as a perc...
DEFF Research Database (Denmark)
Liversage, Anika; Jakobsen, Vibeke
2010-01-01
While considerable research exists on U.S. immigrant groups living in extended households, little is available on such households in Europe. This article therefore analyzes extended household living among Turkish immigrants in Denmark. From register and survey data, the article finds that 77 perc...
Self-perceived lactose intolerance may result in adverse dietary modifications; thus, more studies are needed to understand the prevalence of self-perceived lactose intolerance and how it relates to calcium intake and selected health conditions. The objective was to examine the effects of self-perce...
Veiga, Feliciano; Marques, Paulo
2001-01-01
A falta de instrumentos de avaliação da perceção dos professores acerca dos alunos sobredotados justificou o desenvolvimento da denominada "Escala de Representações dos Professores acerca dos Alunos Sobredotados" (ERPAS). Esta escala revelou adequadas qualidades psicométricas.
International Nuclear Information System (INIS)
Alter, U.; Mielke, H.G.; Wehner, G.
1983-01-01
According to the Atomic Act, article 9a, paragraph 1, the licensees of nuclear power plants in the Federal Republic of Germany are obliged to provide for the management of radioactive wastes resulting from the operation of these plants. Concerning the provisions to be made for the management of such wastes, two concepts are discussed: nuclear reprocessing and final waste disposal center (Nukleares Entsorgungszentrum, NEZ); and the integrated spent fuel and waste management concept (Integriertes Entsorgungskonzept, IEK). Unlike the NEZ, the IEK-concept may have different sites for the following fuel cycle facilities: intermediate spent fuel storage, reprocessing, waste conditioning and final disposal, and uranium and plutonium fuel element fabrication facilities. The fundamental differences of the pertinent transports are presented. Transport scenarios expected under the two alternatives NEZ and IEK have been elaborated for the purpose of a data collection covering the following aspects: materials to be shipped, number of packages shipped, number of packages shipped per transport, transport by rail or by road, transport routes and distances, and duration of transports
Spanish Minister of Science and Technology visits the LHC magnet test facility
Patrice Loïez
2002-01-01
H.E. Mr Josep Piqué i Camps, Minister of Science and Technology, Spain, toured the test facility for LHC magnets in building SM18 during his visit to CERN in November. In this series of photos Felix Rodriguez Mateo explains the operation of the test facilty to the ministerial party. Photo 01: (left to right) Felix Rodriguez Mateo; the Minister; Francisco Giménez-Reyna, Spanish delegate to the CERN Finance Committee; M. Aguilar Benitez, Spanish delegate to the CERN Council; G. Babé and G. Léon. Photo 02: (left to right) Felix Rodriguez Mateos; César Dopazo, Director-General of CIEMAT (Spanish Research Centre for Energy, Environment and Technology); the Minister; G. Babé; M. Aguilar Benitez; and G. Léon. Photo 03: Francisco Giménez-Reyna; Felix Rodriguez Mateos; César Dopazo; the Minister; Juan Antonio Rubio, leader of the Education and Technology Transfer division at CERN; G. Babé behind M. Aguilar Benitez. Photo 04: Francisco Giménez-Reyna, partially hidden behind Felix Rodriguez Mateos; César Dop...
Directory of Open Access Journals (Sweden)
Adriana Patricia Gallego Torres
2016-06-01
Full Text Available Este escrito presenta una reseña del libro escrito por los investigadores: Jaime Carrascosa Alís, Josep Lluís Domenech, Joaquín Martínez Torregrosa, Luis Osuna García y Rafaela Verdú Carbonell y con ISBN: 978-84-616-9964-3. Basic course teaching science secondary education science teachers in training and active This paper presents a book review written by researchers: Jaime Carrascosa Alis, Josep Lluis Domenech, Joaquín Martínez Torregrosa, Luis Osuna García and Verdú Carbonell and Rafaela ISBN: 978-84-616-9964-3 Básico ciências curso de ensino ensino secundário professores de ciências em formação e active Este trabalho apresenta uma resenha do livro escrito por pesquisadores: Jaime Carrascosa Alis, Josep Lluis Domenech, Joaquín Martínez Torregrosa, Luis Osuna García e Verdú Carbonell e Rafaela ISBN: 978-84-616-9964-3
Directory of Open Access Journals (Sweden)
Cámara, Leandro
2010-12-01
breve revisión de la teoría de estados límite y su aplicación a las estructuras de fábrica y a la iglesia de Santa Eulalia de Marquínez en particular; en paralelo se presenta el resultado del estudio histórico de su evolución constructiva; y se conjugan las conclusiones de ambos análisis en una secuencia temporal de la evolución estructural, una revisión de su seguridad y una propuesta de intervención
Directory of Open Access Journals (Sweden)
Tiziana Palmiero
2011-12-01
Full Text Available A lo largo de la Colonia se va construyendo una memoria de la historia de los pueblos andinos que considera al Imperio incaico como su principal referente y a la figura del Inca1 como su símbolo natural. La narración de los hechos de la historia incaica, en especial aquellos relativos a la conquista española, generaron el mito de la muerte del Inca2, a la cual habrán contribuido colonizados y colonizadores. Durante el siglo XVIII serán numerosas las representaciones teatral-musicales de estos hechos. El códice Martínez Compañón (1782-85 consta de nueve tomos con alrededor de 1.500 láminas en colores que ilustran los diferentes aspectos de la vida social y natural de la zona de Trujillo, Perú. Treinta y ocho láminas, incluidas en el tomo II, se refieren directa o indirectamente a la música de tradición oral de la época, las láminas numeradas -foliación original, E. está por "Estampa"- desde la E.176 hasta la E.193 contienen un total de veinte partituras. A primera vista el título de las dos tonadas: "E.188: Allegro tonada El tupamaro, Caxamarca" y "E.191 (b: Adagio tonada el Tuppamaro de caxa-marca" sugiere que el contenido de las mismas podría tener relación con los sucesos de Cajamarca, es decir, con la captura y muerte del Inca Atahualpa3. En el mismo tomo II se encuentran además dos láminas que representan la decapitación del Inca: "Danza de la degollación del Ynga E.172; E.173.". De ser así las dos tonadas podrían ser dos fragmentos musicales únicos de las representaciones teatrales antes mencionadas4. Durante el análisis de las dos partituras encontramos que éstas tendrían relación con otras partituras del mismo códice: "E. 191, Magestuoso Cachua la Despedida de Guamachuco"; "E. 190 Allegro tonada la brugita para cantar de Guamachuco" y "E.187, Andantino Tonada El Diamante, para baylar de Chachapoyas". Se trató de analogías musicales o textuales que permitieron crear un hilo conductor con los tr
A recepção crítica das obras: A menina do Narizinho arrebitado (1920) e Narizinho arrebitado (1921)
Brero, Caroline Elizabeth [UNESP
2003-01-01
Cette recherche a pour but l organisation chronologique et l analyse critique des articles, des assais et des références consacrés aux oeuvres La fillette au petit nez pointu (1920) et Petit nez pointu (1921), de Monteiro Lobato, publiées en livres et en périodiques entre 1920 et 2001. Ce travail a eu encore le but d évaluer les études critiques scindés, finalment, en deux catégories: les études qui ont contribués à des analyses éclaircissantes et inovatrices sur les deux oeuvres et ceux ...
Mapas conceptuales y aprendizaje cooperativo. Experiencias en la enseñanza del Derecho
Cobas Cobiella, María Elena; Montes Rodríguez, María Pilar; Alventosa del Río, Josefina; Guillén Catalán, Raquel; Ortega Giménez, Alfonso; Meco Tébar, Fabiola; Chaparro Matamoros, Pedro; Valero Llorca, Javier; Company Alcañiz, Mireia; Cano Donate, Asunción
2014-01-01
En la elaboración de este libro también participaron los siguientes estudiantes: Carlota Ramírez Pérez / Jose Gil García / Jose Manuel Aznar Cerdán / Teresa Pérez Huertas / Jorge Alarcón Fernández / Rodrigo Climent Pedrosa / Clara Beltrán Segarra / José Luis Mayordomo Lledó / Carlos Mingote Hernández / Miguel Castillo Ortega / Juan Martínez Leal / Daniel Martínez Rojano / Rocío Grondona Vives / Rubén Pons Solanes / Álvar Garay Pingarrón / Ioana Alexandra Neacsu / Carlos Lerma Poveda / Begoña ...
Hacia una república conservadora : el programa político del Partido Agrario Español
Directory of Open Access Journals (Sweden)
Luis Teófilo Gil Cuadrado
2005-01-01
Full Text Available El Partido Agrario Español (PAE, fundado en enero de 1934 y presidido por José Martínez de Velasco, representó, dentro de la II República española, una alternativa conservadora y, al tiempo, leal al régimen. El programa político del PAE aceptaba la República —a diferencia de otros partidos derechistas del momento, como la CEDA y los monárquicos— y defendía la unidad nacional, el establecimiento de una segunda Cámara legislativa, la protección de la agricultura y la industria mediante aranceles, el libre comercio dentro de las fronteras nacionales y la revisión de algunas leyes del primer bienio como la Reforma Agraria de 1932. El objetivo era la configuración de una República conservadora distinta, en aspectos fundamentales, a la diseñada por la Constitución de 1931 y la legislación del bienio social-republicano.The Spanish Agrarian Party (Partido Agrario Español, PAE, founded in january of 1934 and presided by José Martínez de Velasco, was, in the political life of the Spanish Second Republic, a conservative and republican option. The agrarian program accepted the republican regime —in opposition to other conservative parties, like the CEDA or the monarchists— and defended the national union, the establishment of a Senate, the protection of the national agriculture and industry trough tariffs, the free trade in the Spanish market and the revision of some laws voted in the first biennium like the Agrarian Reform, promulgated in 1932. The idea was to establish a conservative Republic, different, in some fundamental aspects, of the regime designed by the Constitution of 1931 and the legislation approved during the socialist-republican biennium.
Moufid, Kamal; Abbaka, Najib; Touiti, Driss; Adermouch, Latifa; Amine, Mohamed; Lezrek, Mohammed
2013-07-01
The treatment for patients with large impacted proximal ureteral stone remains controversial, especially at institutions with limited resources. The aim of this study is to compare and to evaluate the outcome and complications of two main treatment procedures for impacted proximal ureteral calculi, retrograde ureterolithotripsy (URS), and percutaneous antegrade ureterolithotripsy (Perc-URS). Our inclusion criteria were solitary, radiopaque calculi, >15 mm in size in a functioning renal unit. Only those patients in whom the attempt at passing a guidewire or catheter beyond the calculus failed were included in this study. Between January 2007 and July 2011, a total of 52 patients (13 women and 39 men) with large impacted upper-ureteral calculi >15 mm and meeting the inclusion criteria were selected. Of these, Perc-URS was done in 22 patients (group 1) while retrograde ureteroscopy was performed in 30 patients (group 2). We analyzed operative time, incidence of complications during and after surgery, the number of postoperative recovery days, median total costs associated per patient per procedure, and the stone-free rate immediately after 5 days and after 1 month. Bivariate analysis used the Student t-test and the Mann-Whitney test to compare two means and Chi-square and Fisher's exact tests to compare two percentages. The significance level was set at 0.05. The mean age was 42.3 years (range 22-69). The mean stone sizes (mm) were 34 ± 1.2 and 29.3 ± 1.8 mm in group 1 and 2, respectively. In the Perc-URS group, 21 patients (95.45%) had complete calculus clearance through a single tract in one session of percutaneous surgery, whereas in the URS group, only 20 patients (66.7%) had complete stone clearance (P = 0.007). The mean operative time was higher in the Perc-URS group compared to group 2 (66.5 ± 21.7 vs. 52.13 ± 17.3 min, respectively; P = 0.013). Complications encountered in group 1 included transient postoperative fever (2 pts) and simple urine outflow (2
Nationalism in Stateless Nations
DEFF Research Database (Denmark)
Thomsen, Robert Chr.
"Nationalism in Stateless Nations" explores national identities and nationalist movements since 1967, using the examples of Scotland and Newfoundland. Adding to the debate about globalisation and the future of the nation-state, the book argues that ethnically rooted nationalism in modern liberal ...... - intellectuals, political parties and the media - the book combines historical, sociological, political and media studies analyses in an interdisciplinary investigation, providing a comprehensive account of the waxing and waning of nationalism....
Pärt, Arvo: De profundis / Barry Witherden
Witherden, Barry
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)". Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)
Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio / Marc Rochester
Rochester, Marc
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass). Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)"
Is intercultural mediation necessary? An approach from a communications perspective
Directory of Open Access Journals (Sweden)
Susana Ridao Rodrigo
2014-10-01
Full Text Available Institutionalized intercultural mediation is expanding as a result of the increase in the number of immigrants in our country. Institutionalized intercultural mediation, which started in the early Nineties in Spain, is understood to mean activities carried out by ONGs and by the social services of the host nation. In line with Giménez (1997: 127, we understand intercultural mediation as a modality within the broader field of mediation. Because of its recent expansion, there is not at present a unique methodology accepted by experts in this field. In this paper, our aims are focused on describing various mediation techniques and the possibility of their application within intercultural contexts
Industrially relevant Al2O3 deposition techniques for the surface passivation of Si solar cells
Schmidt, J.; Werner, F.; Veith, B.; Zielke, D.; Bock, R.; Tiba, M.V.; Poodt, P.; Roozeboom, F.; Li, A.; Cuevas, A.; Brendel, R.
2010-01-01
We present independently confirmed efficiencies of 21.4% for PERC cells with plasma-assisted atom-ic-layer-deposited (plasma ALD) Al2O3 rear passivation and 20.7% for cells with thermal ALD-Al2O3. Additionally, we evaluate three different industrially relevant techniques for the deposition of
increases in cross-sectional samples
African Journals Online (AJOL)
1971-03-27
Mar 27, 1971 ... TABLE Ill. PERCE 'TAGE INCREASES IN BODY M EASU REM ENTS .... population means (polynomials) for calculating total per- ... with age in males, except for very small increases in Bantu. ..... this applies at high levels of energy expenditure is another .... available for adults of all 4 populations studied.
Alternativas. Cuadernos de Trabajo Social
2013-01-01
Contiene: Título: Vivienda y exclusión residencial, Autor: Manuel Hernández Pedreño (coord.), Edita: Editum. Murcia. 2013. 317 pp., ISBN: 978-84-15463-72-6 / María Teresa Martínez Fuentes; Título: Trabajo Social, Concepto y Metodología, Autora: María José Aguilar Idañez, Edita: Ediciones Paraninfo y Consejo General del Trabajo Social, Madrid, 2013, 435 p., ISBN: 978-84-283-3485-3 / María Asunción Martínez Román; Título: Presente y futuro de la formación en Trabajo Social. III Congreso Andaluz...
Martínez-Torregrosa, Joaquín; Alonso Sánchez, Manuel; Carbonell Gisbert, Francisco; Carrascosa Alís, Jaime; Domenech Blanco, Josep Lluís; Domenech Pastor, Ángeles; Domínguez Blay, Álvaro; Osuna García, Luis; Verdú Carbonell, Rafaela
1998-01-01
Último tema del curso "El movimiento de todas las cosas" (para alumnos de 15-16 años). ¿Existen límites, restricciones, en los cambios mecánicos que permitan predecir qué va a ocurrir antes de que ocurra?. Introducción al principio de conservación de la energía. Continúa con los temas sobre trabajo, calor, principio general de la energía, del libro de Física y Química de primer curso de Bachillerato (16-17 años) de Editorial Santillana (Carrascosa, Martínez y Martínez Torregrosa, 2001) La ...
Examining the Need for a Code of Conduct in New Jersey Teacher Union Contracts
Guarneri, Cristina M.
2009-01-01
The purpose of this cross-sectional, comparison study attempted to investigate if a code of conduct existed in New Jersey teacher union contracts to nursing/hospital union contracts. Archived data of public school district and nursing/hospital union contracts held with the New Jersey Public Employment Relations Committee (NJ PERC) and Health…
Static Thrust and Power Characteristics of Six Full-Scale Propellers
1940-01-01
8217 v’arri’a’t aaINt Ilio- adasigns tip) speed’a by 1ii1) ,i vinag .10 perce’ant aI’a’aita’n Itiliil tha’ thar’ist a’auaflia’i’iit o’’~af n faictaoi
Kostense, Stefan; Moore, Susan; Companjen, Arjen; Bakker, Alexander B. H.; Marissen, Wilfred E.; von Eyben, Rie; Weverling, Gerrit Jan; Hanlon, Cathleen; Goudsmit, Jaap
2012-01-01
Monoclonal antibodies are successful biologics in treating a variety of diseases, including the prevention or treatment of viral infections. CL184 is a 1:1 combination of two human monoclonal IgG1 antibodies (CR57 and CR4098) against rabies virus, produced in the PER.C6 human cell line. The two
Based on a study done by Thoma et al. (2010) the energy used in fluid milk processing in the United States of America is responsible for approximately 2 million metric tons of greenhouse gas (GHG) emissions within the total life cycle of milk. These emissions come from electricity use (about 75 perc...
Pärt, Arvo: De profundis. Missa Sillabica / Patric Wiklacz
Wiklacz, Patric
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. 7 Antiennes du Magnificat. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)" Harmonia Mundi HMU907 182 F (CD:165F). 1996. TT:1h 16'06"
Hartley, Ruth A; Barker, Bethan L; Newby, Chris; Pakkal, Mini; Baldi, Simonetta; Kajekar, Radhika; Kay, Richard; Laurencin, Marie; Marshall, Richard P; Sousa, Ana R; Parmar, Harsukh; Siddiqui, Salman; Gupta, Sumit; Brightling, Chris E
2016-05-01
There is a paucity of studies comparing asthma and chronic obstructive pulmonary disease (COPD) based on thoracic quantitative computed tomographic (QCT) parameters. We sought to compare QCT parameters of airway remodeling, air trapping, and emphysema between asthmatic patients and patients with COPD and explore their relationship with airflow limitation. Asthmatic patients (n = 171), patients with COPD (n = 81), and healthy subjects (n = 49) recruited from a single center underwent QCT and clinical characterization. Proximal airway percentage wall area (%WA) was significantly increased in asthmatic patients (62.5% [SD, 2.2]) and patients with COPD (62.7% [SD, 2.3]) compared with that in healthy control subjects (60.3% [SD, 2.2], P Emphysema assessed based on lung density measured by using Hounsfield units below which 15% of the voxels lie (Perc15) was a feature of COPD only (patients with COPD: mean, -964 [SD, 19.62] vs asthmatic patients: mean, -937 [SD, 22.7] and healthy subjects: mean, -937 [SD, 17.1], P < .001). Multiple regression analyses showed that the strongest predictor of lung function impairment in asthmatic patients was %WA, whereas in the COPD and asthma subgrouped with postbronchodilator FEV1 percent predicted value of less than 80%, it was air trapping. Factor analysis of QCT parameters in asthmatic patients and patients with COPD combined determined 3 components, with %WA, air trapping, and Perc15 values being the highest loading factors. Cluster analysis identified 3 clusters with mild, moderate, or severe lung function impairment with corresponding decreased lung density (Perc15 values) and increased air trapping. In asthmatic patients and patients with COPD, lung function impairment is strongly associated with air trapping, with a contribution from proximal airway narrowing in asthmatic patients. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Relationships between water table and model simulated ET
Prem B. Parajuli; Gretchen F. Sassenrath; Ying Ouyang
2013-01-01
This research was conducted to develop relationships among evapotranspiration (ET), percolation (PERC), groundwater discharge to the stream (GWQ), and water table fluctuations through a modeling approach. The Soil and Water Assessment Tool (SWAT) hydrologic and crop models were applied in the Big Sunflower River watershed (BSRW; 7660 km2) within the Yazoo River Basin...
Are groups working in the Information Technology class? | Mentz ...
African Journals Online (AJOL)
We discuss teache rs' perce ption of the use of group work in the Information Technology (IT) classroom. We describe the current situation regarding the implementation of group work in IT classrooms in South Africa as well as the challenges that IT teachers face when implementing group work. This information will be used ...
Directory of Open Access Journals (Sweden)
Matías Emiliano Casas
2014-11-01
Full Text Available The semantic of the word "gaucho" has been attributed with many meanings in different fields of study and artistic productions. The word's new signification and etymology and the gaucho participation in the economic development of Argentina, among other questions, have been the subject of dispute since the first studies about Independence until today. The play The Gaucho Black of Claudio Martínez Payva, premiered in 1927 at the National Theatre in Buenos Aires, revealed a series of problems, such as: the link with foreign settlers, the construction of identity through the gaucho figure and the relationship with black people. This study provides new tools to analyze the Rioplatense society and culture in the early Twentieth Century.
Directory of Open Access Journals (Sweden)
M.L. Neira
1995-01-01
Full Text Available RESEÑA 1 de : Blázquez, J.M.; Martínez Pinna, J.; Montero, S. Historia de ias Religiones antiguas. Oriente, Grecia y Roma. Madrid : Cátedra, 1993. RESEÑA 2 de : Blázquez, J.M. Fenicios, Griegos y Cartagineses en Occidente. Madrid : Cátedra. RESEÑA 3 de : Alvar, J.; Blázquez, J.M.; Fernández, S.; López, G.; Monteagudo, A.(y otros. Cristianismo primitivo y religiones mistéricas. Madrid : Cátedra, 1995. RESEÑA 4 de : Blázquez, J.M.; Martínez Pinna, J.; Montero, S.; (y otros. Historia de las Religiones de la Europa Antigua. Madrid : Cátedra, 1994
Directory of Open Access Journals (Sweden)
Ana Merino
2010-01-01
Full Text Available Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: Mafalda de Quino, Paracuellos de Carlos Jiménez y Socorro de Miguel Rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrando una dimensión comprometida que interpela al lector. This article analyzes the representation of childhood in several Latin American comics: Mafalda by Quino, Paracuellos by Carlos Jiménez, and Socorro by Miguel Rep. In these comics, infancy is articulated from an adult angle critical with society, showing a dimension of commitment appealing to their readership.
India | Page 121 | IDRC - International Development Research Centre
International Development Research Centre (IDRC) Digital Library (Canada)
Read more about Environmental pollution. Language English. Dans le monde arabe, on assiste à des percées historiques alors que tombent les obstacles au plein exercice, par les femmes, de leurs droits de citoyennes dans leur propre pays. Depuis quelques années, en Algérie, en Égypte et au Maroc, des femmes ...
Editores Biblios
2012-01-01
Interview with Filiberto Felipe Martínez Arellano (Mexico) researcher of the Centro Universitario de Investigaciones Bibliotecologicas (CUIB) in the context of the thirtieth anniversary of this academic center.
Salmonid Gamete Preservation in the Snake River Basin, 2001 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Armstrong, Robyn; Kucera, Paul
2002-06-01
Steelhead (Oncorhynchus mykiss) and chinook salmon (Oncorhynchus tshawytscha) populations in the Northwest are decreasing. Genetic diversity is being lost at an alarming rate. Along with reduced population and genetic variability, the loss of biodiversity means a diminished environmental adaptability. The Nez Perce Tribe (Tribe) strives to ensure availability of genetic samples of the existing male salmonid population by establishing and maintaining a germplasm repository. The sampling strategy, initiated in 1992, has been to collect and preserve male salmon and steelhead genetic diversity across the geographic landscape by sampling within the major river subbasins in the Snake River basin, assuming a metapopulation structure existed historically. Gamete cryopreservation conserves genetic diversity in a germplasm repository, but is not a recovery action for listed fish species. The Tribe was funded in 2001 by the Bonneville Power Administration (BPA) and the U.S. Fish and Wildlife Service Lower Snake River Compensation Plan (LSRCP) to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin. In 2001, a total of 398 viable chinook salmon semen samples from the Lostine River, Catherine Creek, upper Grande Ronde River, Lookingglass Hatchery (Imnaha River stock), Lake Creek, the South Fork Salmon River weir, Johnson Creek, Big Creek, Capehorn Creek, Marsh Creek, Pahsimeroi Hatchery, and Sawtooth Hatchery (upper Salmon River stock) were cryopreserved. Also, 295 samples of male steelhead gametes from Dworshak Hatchery, Fish Creek, Grande Ronde River, Little Sheep Creek, Pahsimeroi Hatchery and Oxbow Hatchery were also cryopreserved. The Grande Ronde chinook salmon captive broodstock program stores 680 cryopreserved samples at the University of Idaho as a long-term archive, half of the total samples. A total of 3,206 cryopreserved samples from Snake River basin steelhead and
Salmonid Gamete Preservation in the Snake River Basin, Annual Report 2002.
Energy Technology Data Exchange (ETDEWEB)
Young, William; Kucera, Paul
2003-07-01
In spite of an intensive management effort, chinook salmon (Oncorhynchus tshawytscha) and steelhead (Oncorhynchus mykiss) populations in the Northwest have not recovered and are currently listed as threatened species under the Endangered Species Act. In addition to the loss of diversity from stocks that have already gone extinct, decreased genetic diversity resulting from genetic drift and inbreeding is a major concern. Reduced population and genetic variability diminishes the environmental adaptability of individual species and entire ecological communities. The Nez Perce Tribe (NPT), in cooperation with Washington State University and the University of Idaho, established a germplasm repository in 1992 in order to preserve the remaining salmonid diversity in the region. The germplasm repository provides long-term storage for cryopreserved gametes. Although only male gametes can be cryopreserved, conserving the male component of genetic diversity will maintain future management options for species recovery. NPT efforts have focused on preserving salmon and steelhead gametes from the major river subbasins in the Snake River basin. However, the repository is available for all management agencies to contribute gamete samples from other regions and species. In 2002 a total of 570 viable semen samples were added to the germplasm repository. This included the gametes of 287 chinook salmon from the Lostine River, Catherine Creek, upper Grande Ronde River, Imnaha River (Lookingglass Hatchery), Lake Creek, South Fork Salmon River, Johnson Creek, Big Creek, Capehorn Creek, Marsh Creek, Pahsimeroi River (Pahsimeroi Hatchery), and upper Salmon River (Sawtooth Hatchery) and the gametes of 280 steelhead from the North Fork Clearwater River (Dworshak Hatchery), Fish Creek, Little Sheep Creek, Pahsimeroi River (Pahsimeroi Hatchery) and Snake River (Oxbow Hatchery). In addition, gametes from 60 Yakima River spring chinook and 34 Wenatchee River coho salmon were added to the
Energy Technology Data Exchange (ETDEWEB)
Hoefs, Nancy (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)
2004-02-01
During 1997 the first phase of the Nez Perce Tribe White Sturgeon Project was completed and the second phase was initiated. During Phase I the ''Upper Snake River White Sturgeon Biological Assessment'' was completed, successfully: (1) compiling regional white sturgeon management objectives, and (2) identifying potential mitigation actions needed to rebuild the white sturgeon population in the Snake River between Hells Canyon and Lower Granite dams. Risks and uncertainties associated with implementation of these potential mitigative actions could not be fully assessed because critical information concerning the status of the population and their habitat requirements were unknown. The biological risk assessment identified the fundamental information concerning the white sturgeon population that is needed to fully evaluate the effectiveness of alternative mitigative strategies. Accordingly, a multi-year research plan was developed to collect specific biological and environmental data needed to assess the health and status of the population and characterize habitat used for spawning and rearing. In addition, in 1997 Phase II of the project was initiated. White sturgeon were captured, marked, and population data were collected between Lower Granite Dam and the mouth of the Salmon River. During 1997, 316 white sturgeon were captured in the Snake River. Of these, 298 were marked. Differences in the fork length frequency distributions of the white sturgeon were not affected by collection method. No significant differences in length frequency distributions of sturgeon captured in Lower Granite Reservoir and the mid- and upper free-flowing reaches of the Snake River were detected. The length frequency distribution indicated that white sturgeon between 92 and 183 cm are prevalent in the reaches of the Snake River that were sampled. However, white sturgeon >183 have not changed markedly since 1970. I would speculate that some factor other than past over
Brand personality traits: the Chilean Pension Fund Administrators case
Directory of Open Access Journals (Sweden)
Manuel Escobar Farfán
2017-12-01
Full Text Available Chilean pension fund industry is largely questioned by public; therefore it becomes essential to work on a strategy to enhance brand’s credibility and positioning. This study objective is to analyze and build a brand personality scale to identify consumer’s perception. An exploratory study aided by qualitative tools was carried out to track those brand’s personality traits not considered in Latorre, Martínez and Sotelo (2016. As a result, 38 personality traits have been evidenced in the pension fund administrators industry, some of which are specific to this industrial sector, such as transparency and ambition. This study findings come to complement the five dimensions identified by Aaker (1997 and subsequently validated by Latorre, Martínez y Sotelo (2016.
Directory of Open Access Journals (Sweden)
A. Rameshkumar
2015-06-01
Results and conclusions. A total of 961 specimens were collected, from which 883 COI sequences were obtained. The sequences generated corresponded to 289 barcoding species and 30 identified genera. The most speciose genera were Heterospilus Haliday (170 spp., Ecphylus Förster (19 spp., Allorhogas Gahan (15 spp. and Callihormius Ashmead (14 spp.. Addition of previously collected material increased the diversity of the subfamily in the region to 34 genera and 290 species. Paraphyly of Heterospilus with respect to Neoheterospilus and Heterospathius was again recovered. Twenty new species and two new genera (Sabinita Belokobylskij, Zaldívar-Riverón et Martínez, Ficobolus Martínez, Belokobylskij et Zaldívar-Riverón have been described so far from the material collected in this work.
Nation branding and sustainable competitiveness of nations
Lee, Kyung Mi
2009-01-01
Considering the importance of explaining how a nation brand is effectively managed and how nation branding aligns the nation's brand with country management so as to gain competitiveness, this research aims to assess the role of nation branding and to create a strategic management tool for nation
National Intelligence and National Prosperity
Hunt, Earl; Wittmann, Werner
2008-01-01
What is the relation between the cognitive competence of a national population that nation's economic prosperity? Lynn and Vanhanen [Lynn, R. & Vanhanen, T. (2002). "IQ and the wealth of nations." Westport, CT: Praeger.] presented data pointing to an exceptionally strong relationship between IQ scores and Gross Domestic Product per…
Sud du Sahara | Page 6 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Langue French. Read more about Journal supplement features 10 years of West African health systems research. Langue English. Un virologiste canadien a réalisé une percée : il a créé un vaccin unique contre cinq maladies du bétail qui pourrait transformer la vie de millions de gens en Afrique et ailleurs dans le monde.
Effects of Moist Heat and Dry Heat on the Nutritional Value of Velvet ...
African Journals Online (AJOL)
constitute lOand 20 perc~nt of the experimental diets andfed to laying hens. The results revealed an over- ... was ci better method of heat treatment than roasting, for velvet bfans fed to the laying hens. Keywords: Heat .... 'Vegetable oil was added to make up the required amount of energy in the diets. bProvide per kg diet: Vit ...
India : Maternal and Reproductive Health at a Glance
Sameh El-Saharty; Naoko Ohno; Intissar Sarker; Federica Secci; Vikram Rajan
2014-01-01
India is the third largest economy and has the second largest population in the world. It achieved millennium development goal (MDG) on poverty reduction; however, gender inequality still persists. Maternal mortality rate is 190 deaths per 100,000 live births, representing a 65 percent decline from 1990. Fertility fell to 2.5, while contraceptive prevalence rate increased to nearly 55 perc...
Arhitektuuriuudised / Urmas Oja
Oja, Urmas, 1981-2012
2009-01-01
Silotorni otsas asuvast eramust USAs Alabama osariigis Hale'i maakonnas, Artechic Architects'i Ovaalsest majast Jaapanis, Boeri Studio korterelamust Itaalias Seregnos ja arhitekt Antonio Jiménez Torrecillas'i sotsiaalmajast Andaluusias
Directory of Open Access Journals (Sweden)
Editores Biblios
2012-08-01
Full Text Available Interview with Filiberto Felipe Martínez Arellano (Mexico researcher of the Centro Universitario de Investigaciones Bibliotecologicas (CUIB in the context of the thirtieth anniversary of this academic center.
Directory of Open Access Journals (Sweden)
José Antonio Martínez García
2009-04-01
Full Text Available ResumenEsta investigación presenta un nuevo método para el estudio de la invarianza de escala que complementa otros métodos existentes, lo que contribuye a realizar un análisis ecléctico y multifocal de un problema importante en la investigación de marketing, y en particular en la investigación de servicios deportivos. Este método está basado en la utilización del cálculo integral y tiene una sencilla interpretación geométrica. Se describen y comparan varios procedimientos para testar la invarianza de escala, y se realiza un re-análisis de la investigación de Martínez y Martínez (2008b sobre la percepción de calidad del consumidor de servicios deportivos. Los resultados muestran cómo existen diferencias sobre las conclusiones originales de estos autores. De este modo, las escalas de siete opciones de respuesta sí son invariantes, mientras que la de cinco opciones no lo son. Finalmente, se discuten las bondades y las limitaciones del método integral, abogando por la triangulación estadística para dar robustez a los resultados empíricos.AbstractThis research introduces a new method to analyse scale invariance, which overcomes some shortcomings of other procedures. Under an eclectic perspective, this method must help to provide insights in the marketing research discipline, and specifically in the sports service management. The method is grounded on the use of definite integrals to compute the area between two functions. In addition, several procedures for testing scale invariance are depicted and compared. An empirical application is achieved by re-analysing the study of Martínez & Martínez (2008b on perceived quality in sports services. Results shows that misleading conclusions were derived from the original study of those authors. Finally, advantages and shortcomings of the new method are discussed.
Upwelling intensity modulates N2O concentrations over the western Indian shelf
Digital Repository Service at National Institute of Oceanography (India)
Sudheesh, V.; Gupta, G.V.M.; Sudharma, K.V.; Naik, H.; Shenoy, D.M.; Sudhakar, M.; Naqvi, S.W.A.
Pacific Ocean (off central Chile and Peru) have been identified as ‘‘hot spots’’ of N2O production with N2O saturations up to 8250% and 2426–12,244%, respectively [Naqvi et al., 2005; Cornejo et al., 2007; Ar�evalo-Mart�ınez et al., 2015]. The N2O flux per... Peru. (ETSP) 7.6–986 27–1825 Ar�evalo-Mart�ınez et al. [2015] Off central Chile (ETSP) 6.7–59 245 (30 m) 29.8–195 Cornejo et al. [2007] 5.1–30.1 206 (40 m) 27.7–42.9 Farias et al. [2009] Oman shelf 9.7–24.7 48.8 (50 m) N.G. Naqvi et al. [2010] Eastern...
Entrevista a Mª Carmen Giménez Morte
Vernia Carrasco, Ana M.
2013-01-01
Profesora del Conservatorio Superior de Danza de Valencia, Mamen, así es conocida entre los que la conocen bien, es Licenciada en Historia del Arte y Doctora en Filosofía. Titulada en Danza Contemporánea y en Danza Clásica. Ha publicado numerosos libros y artículos sobre teoría, análisis, pedagogía e historia de la danza.
Malaysia Economic Monitor, December 2014 : Towards a Middle-Class Society
World Bank Group
2014-01-01
Malaysia has in many ways become a success story in shared prosperity. Shared prosperity means that all households experience income growth, but growth is higher for those households at the bottom of the distribution, a pattern that leads to lower inequality. In the past 40 years, Malaysia drew on its natural resources to nearly eradicate absolute poverty, from 49 percent in 1970 to 1 perc...
2013-04-01
http://www.itrcweb.org/Documents/PERC-1.pdf • ITRC Perchlorate Team. 2008. Remediation Technologies for Perchlorate Contamination in Water and Soil ...pdf • Solutions EIS. 2006. Protocol for Enhanced In Situ Bioremediation Using Emulsified Vegetable Oil . Prepared for ESTCP. May 2006. • http...Air Force. 2007. Protocol for In Situ Bioremediation of Chlorinated Solvents Using Edible Oil . Prepared for AFCEC - Environmental Science Division
Chen, Haidong; Sadeque, Saalem
2007-01-01
The study empirically investigated the effects of consumer price perception dimension and reputation dimension on attitude toward private label brands among young Swedish consumers. Consumer price perception dimension includes value consciousness, price consciousness, and price-quality association factors. Reputation dimension includes retailer’s reputation, existence of word-of-mouth (WOM), positive WOM, and negative WOM. Previous studies have found that factors under the consumer price perc...
España, Alemania y Las Islas Chafarinas. En vísperas del replanteamiento de la cuestión marroquí
Directory of Open Access Journals (Sweden)
María José VILAR
2009-08-01
Full Text Available RESUMEN: En 1885 Saturnino Giménez, periodista, viajero y hombre de negocios menorquín, antiguo militante republicano-federal comprometido en la revolución cantonal de Cartagena del verano de 1873 y refugiado luego en Argelia, en donde desde el 84 fue corresponsal del berlinés Deutsche Kolonial Zeitung, propuso la cesión a Alemania de una estación naval y depósito de carbón en las Islas Chafarinas, pertenecientes a España, situadas frente a la frontera argelino-marroquí en el Mediterráneo. Tan pronto fue conocido el proyecto, Francia se opuso, ya que era contraria a la presencia alemana en Marruecos, incidente que supuso el empeoramiento de las relaciones franco-españolas ya de por sí tensas y difíciles. Aunque Giménez adquirió terrenos en Cabo del Agua, frente a Chafarinas, y llegó a acuerdos con las tribus de la zona, su proyecto no pudo salir adelante. Años más tarde (1902-1903 proyectó una segunda factoría mercantil en Chafarinas, ahora bajo bandera española y como empresa privada por él dirigida, al objeto de capturar el comercio que franceses y británicos hacían con la región marroquí del Rif y de suprimir los privilegios de que disfrutaba el Majzén marroquí en el tráfico con Melilla Aunque Giménez logró apoyos importantes, tampoco en esta ocasión pudo sacar adelante su proyecto. El gobierno español no lo autorizó, deseando evitar problemas con Francia en momentos en que eran mantenidos en París discretos contactos hispano-franceses para decidir el futuro de Marruecos.ABSTRACT: In 1885 Saturnino Giménez, a Minorcan journalist, traveller and business man, federal republican committed to Cartagena’s cantonal revolution in the summer of 1873 and correspondent of the Berlin Deutsche Kolonial Zeitung in Algeria since 1884, proposed the cession of a naval base in the Chafarinas Islands to Germany. These Islands belonged to Spain and were located opposite the Moroccan-Algerian frontier in the Mediterranean
determination of perce rmination of percentage of caffeine content
African Journals Online (AJOL)
userpc
ABSTRACT. Two methods were employed for the deter brands of analgesic tablets which are;. Extraction using both water and chlorofor weighing apparatus and the percentage of. The percentage of caffeine using only water. Boska, and Panadol Extra were 7.40%, 5.60 caffeine using both water and chloroform i.
Hipertrofia mamaria virginal en una adolescente Virginal mammary hypertrophy in an adolescent
Directory of Open Access Journals (Sweden)
José Raúl Zaldívar Ochoa
2011-09-01
Full Text Available Se presenta el caso clínico de una adolescente de 13 años de edad con antecedentes de buena salud, que acudió a la consulta de endocrinología pediátrica del Hospital Infantil Norte Docente "Dr. Juan de la Cruz Martínez Maceira" de Santiago de Cuba por experimentar un aumento exagerado de ambas mamas, de aparición brusca en una semana y acompañado de enrojecimiento en los senos, elevación de su temperatura, dolor punzante y sensibilidad incrementada, sobre todo en los pezones. Estaba muy afectada psicológicamente; pero se le indicó un tratamiento con antiinflamatorio y diurético antes de ser remitida al Instituto Nacional de Neurología y Neurocirugía para la realización de otra tomografía axial computarizada contrastada, donde no se observaron alteraciones en los hemisferios cerebrales, silla turca, ventrículos y fosa posterior.The case of a 13 year-old adolescent with a history of good health is reported, who attended the Pediatric Endocrinology Department from "Dr Juan de la Cruz Martínez Maceira" Northern Teaching Children Hospital of Santiago de Cuba due to an excessive increase of the breasts, which onset was abrupt in a week and accompanied by breast redness, elevated temperature, piercing pain and increased sensitivity, especially in the nipples. She was so psychologically affected, but she was on anti-inflammatory and diuretic before being referred to the National Institute of Neurology and Neurosurgery to perform another contrast CAT scan, where no changes were observed in the cerebral hemispheres, sella, ventricles and posterior fossa.
Spanish Minister of Science and Technology visits the LHC magnet test facility
Patrice Loïez
2002-01-01
H.E. Mr Josep Piqué i Camps, Minister for Science and Technology, Spain, toured the test facility for LHC magnets in building SM18 during his visit to CERN in November. Photos 01, 02: (left to right) M. Cerrada, CERN; Francisco Giménez-Reyna, Spanish delegate to the CERN Finance Committee; G. Léon; Juan Antonio Rubio, leader of the Education and Technology Transfer division at CERN; M. Aguilar-Benitez, Spanish delegate to CERN Council; (behind) H.E. Mr Joaquin Pérez-Villanueva y Tovar, Ambassador and Permanent Representative of Spain to the United Nations in Geneva; the Minister; Manuel Delfino, leader of the Information Technology division at CERN; bodyguard; Matteo Cavalli-Sforza, ATLAS national contact physicist for Spain; Felix Rodriguez Mateos, CERN; G. Babé. Visible in the left background is one of the test benches where magnets are prepared for installation in String 2: the full-scale model of an LHC cell of the regular part of the arc. The extremity of String 2, which measures 120 m and runs the ...
Directory of Open Access Journals (Sweden)
Geisell Martínez Torres
2012-10-01
Full Text Available Introducción: el virus de la inmunodeficiencia humana es el causante del sida, debilita el sistema inmunológico destruyéndolo lentamente y ataca a las células que actúan como coordinadores del sistema inmunológico, provocando una respuesta de defensa inmunológica. Objetivo: determinar el nivel de conocimientos de los adolescentes que estudian en el preuniversitario acerca del Virus de la Inmunodeficiencia Humana. Material y método: se realizó una investigación de tipo observacional, descriptiva, transversal en el área urbana del municipio San Juan y Martínez en el período comprendido de enero hasta mayo de 2012, a los adolescentes que estudian en el preuniversitario. Resultados: se comprobó que existe un predominio del sexo femenino que conoce que el VIH/sida es una infección de transmisión sexual, señalan al semen como la vía que más conocen por la cual se transmite el VIH/sida, y la abstinencia sexual como la más efectiva para evitar el contagio; no usan el condón siempre en las relaciones sexuales, y la mayoría se dirige a sus padres para conversar sobre temas de sexualidad y VIH/sida. Conclusiones: la mayor parte de los estudiantes refiere conocer que el VIH/sida es una enfermedad que se transmite sexualmente, y que es necesario ejecutar programas de educación sexual para adquirir mejores conocimientos sobre esta enfermedad venérea.Introduction: Human Immunodeficiency Virus (HIV causes Acquired Immunodeficiency Syndrome (AIDS and weakens the immune system destroying it progressively and attacking cells that act of coordinators of the immunological system, provoking a response of the immunological defence. Objective: to determine knowledge of Human Immunodeficiency Virus in adolescents studying in an urban pre-university institute. Material and Method: a type of observational, descriptive, cross-sectional research was conducted in an urban area of San Juan y Martinez municipality during January-May 2012 in adolescents
National Security and National Development: A Critique
African Journals Online (AJOL)
DR Nneka
There has been the tendency right from independence to view national ... the nation's economic underdevelopment, which has led to social injustice, ... For a nation, security connotes conditions of peace, stability, order ... They are very important for the ... According to Mathew (1989), Global development now suggests.
Un nuevo ejemplar de tortuga gigante del Mioceno de Arévalo (Ávila)
Jiménez Fuentes, Emiliano; Acosta, Pilar; Fincias San Martín, Benito
1986-01-01
RESUMEN: Se describe un nuevo ejemplar de tortuga gigante, encontrado en el Mioceno (Vallesiense-Inferior) de Arévalo (Ávila), clasificado como un macho adulto de Cheirogaster (s.l.) richardi (Bergounioux 1938; emend. Jiménez 1984).
Are sustainable companies less risky and more profitable?
Tânia Cristina Silva Nunes; Silvia Casa Nova; Edgard Cornacchione; Solange Garcia
2012-01-01
The purpose of this study was to determine whether there were significant differences in accounting indicators when comparing sustainable enterprises to other similar companies that are not considered as sustainable. The Corporate Sustainability Index of BM (São Paulo Stock, Commodities and Futures Exchange) was the criterion selected to break down the samples into sustainable and non-sustainable enterprises. The accounting indicators were separated into two kinds: risk (dividend payout, perc...
Rebelo, Marta Figueiredo
2017-01-01
The purpose of this thesis is to understand the perception Instagram users, in other words consumers, have of influencers they follow on Instagram. Consumer perceived credibility of influencers, and its impact on the purchase intention, is therefore studied. This dissertation aims to highlight which credibility dimensions better explain the purchase intention. Gender is also explored to verify behavior differences between female and male consumers. To better analyze the perc...
Web-Based and Mobile Stress Management Intervention for Employees: A Randomized Controlled Trial
Heber, Elena; Lehr, Dirk; Ebert, David Daniel; Berking, Matthias; Riper, Heleen
2016-01-01
Background: Work-related stress is highly prevalent among employees and is associated with adverse mental health consequences. Web-based interventions offer the opportunity to deliver effective solutions on a large scale; however, the evidence is limited and the results conflicting. Objective: This randomized controlled trial evaluated the efficacy of guided Web-and mobile-based stress management training for employees. Methods: A total of 264 employees with elevated symptoms of stress (Perce...
Prediction of life stress on athletes’ burnout: the dual role of perceived stress
Chyi, Theresa; Lu, Frank Jing-Horng; Wang, Erica T.W.; Hsu, Ya-Wen; Chang, Ko-Hsin
2018-01-01
Although many studies adopted Smith’s (1986) cognitive–affective model of athletic burnout in examining stress–burnout relationship, very few studies examined the mediating/moderating role of perceived stress on the stress–burnout relationship. We sampled 195 college student-athletes and assessed their life stress, perceived stress, and burnout. Correlation analyses found all study variables correlated. Two separate hierarchical regression analyses found that the “distress” component of perce...
The effects of luxury conceptualization on counterfeit purchase an empirical study
Simona Romani; Stefano Pace; Giacomo Gistri
2011-01-01
The extant literature on luxury counterfeiting examines a wide range of antecedents of counterfeit purchase (such as product attributes, socio-demographic factors, and various consumer attitudes). However, less attention has been devoted to the luxury conceptualization held by consumers. This study argues that luxury value perception can be a multidimensional antecedent of counterfeit purchase, and therefore investigates whether 1) consumers of counterfeits and originals differ in their perce...
Directory of Open Access Journals (Sweden)
José Raúl Zaldívar Ochoa
Full Text Available Se presenta el caso clínico de una infante de 2 años de edad que nació con genitales ambiguos y fue diagnosticada precozmente en el Hospital Infantil Norte Docente "Juan de la Cruz Martínez Maceira", gracias al Programa de Hiperplasia Adrenal Congénita. Se le realizó una exitosa reconstrucción quirúrgica hacia el sexo femenino y se brindó apoyo psicológico a la familia.The case report of a 2 year-old infant girl is presented who was born with ambiguous genitals and she was early diagnosed at "Juan de la Cruz Martínez Maceira" Teaching Nothern Pediatric Hospital, thanks to the Congenital Adrenal Hyperplasia Program. She had a successful surgical reconstruction to the female sex and her family received psychological support.
Directory of Open Access Journals (Sweden)
González de Zárate, Jesús María
2015-06-01
Full Text Available Very few representations of the Anthropomorphic Trinity exist. This commentary focuses on two 15th Century examples: a wood carving in the collegiate church of Valpuesta (Burgos, the oldest episcopal see in Castile, and a painting by Miguel Ximénez in the Prado Museum. The análisis focuses on the graphic source used as a model by both sculptor and painter.Pocas representaciones nos han llegado sobre la Trinidad antropomorfa. El presente comentario repara en dos ejemplos del siglo XV: una talla en la colegiata de Valpuesta (Burgos, sede episcopal más antigua de Castilla y una pintura de Miguel Ximénez custodiada en el Museo del Prado. En el análisis reparamos en la fuente gráfica como invención y modelo que interpretaron tanto el imaginero como el artista pintor.
Ferguson, Priscilla Parkhurst
2010-01-01
Culinary consciousness raisers, cooking texts often serve as vehicles of national identification. From Pampille (Marthe Allard Daudet) and her cookbook, Les Bons Plats de France, in 1913 to the international culinary competitions of today such as the Bocuse d'or, culinary distinction promotes national interests. In contrast to the strident nationalism of the early twentieth century, culinary nationalism today operates in an increasingly globalized world. National culinary distinction defines the nation and sells its products in a highly competitive international arena. A recent culinary text, the South Korean film Le Grand Chef [Sik Gaek ] (2007), illustrates the phenomenon, subsuming national culinary promotion in a mega culinary competition, all in the service of Korean culinary achievement.
African Journals Online (AJOL)
AKOTEYON
Several incidents have been reported indicating that the quality of .... The drainage system is characterized by a maze of ..... Remote Sensing and GIS Techniques for. Evaluation of ... Performance Analysis Report for 2nd Quarter. Martı´nez,. D.
Directory of Open Access Journals (Sweden)
Elia Ledesma Márquez
2009-12-01
Full Text Available Tras la creación del INDER el deporte cubano único en América Latina que se caracteriza por más hondo sentido humano ha encaminado todos sus esfuerzos para llevar la E:Física ,el deporte y la Recreación a los mas recónditos lugares. .La planificación y programación de estas actividades depende en gran medida de aspectos tan importantes como la edad de los participantes, los gustos e intereses, así como la cultura requerida para su realización. A partir de la aplicación de las técnicas y métodos de investigación nos percatamos que las ofertas recreativas para la ocupación del tiempo libre son limitadas en la zona 54 del consejo popular urbano de San Juan y Martínez, según los resultados se notaron un alto grado de alcoholismo, riñas callejeras, la tendencia a un grado de deserción de los estudios por parte de los jóvenes comprendidos entre la edad de 17 a 19 anos tanto del sexo femenino como masculino, se destaco la maternidad precos,poco desarrollo de las Actividades físicas recreativas para la ocupación del tiempo libre. A través de la puesta en práctica de la propuesta de actividades físicas recreativas para la ocupación del tiempo libre de los jóvenes de la zona 54 se ha podido disminuir costumbres negativas. La zona desde el punto de vista social tiene una población de 156 jóvenes .Esperamos que dichos integrantes desarrollen sus potencialidades durante su tiempo libre, a través de actividades físicas – recreativas y formulen el habito en un ambiente sano que contrarreste las tendencias crecientes .Todo esto estará proporcionando la transformación en una comunidad mas fortalecida y unida
Non-Replicating Adenovirus-Vectored Anthrax Vaccine
International Nuclear Information System (INIS)
Van Kampen, K. R.; Zhang, J.; Jex, E.; Tang, D. C.
2007-01-01
As bioterrorism is emerging as a national threat, it is urgent to develop a new generation of anthrax vaccines that can be rapidly produced and mass administered in an emergency setting. We have demonstrated that protective immunity against anthrax spores could be elicited in mice by intranasal administration of a non-replicating human adenovirus serotype 5 (Ad5)-derived vector encoding Bacillus anthracis protective antigen (PA) in a single-dose regimen. The potency of an Ad5 vector encoding PA was remarkably enhanced by codon optimization of the PA gene to match the tRNA pool found in human cells. This nasal vaccine can be mass-administered by non-medical personnel during a bioterrorist attack. In addition, replication-competent adenovirus (RCA)-free Ad5-vectored anthrax vaccines can be mass produced in PER.C6 cells in serum-free wave bioreactors and purified by column chromatography to meet a surge in demand. The non-replicating nature of this new generation of anthrax vaccine ensures an excellent safety profile for vaccines and the environment.(author)
Examining gender differences on FCI performance in algebra and calculus based physics courses
Kreutzer, Kimberley; Boudreaux, Andrew
2009-05-01
The Force Concept Inventory (FCI) has been widely used to asses student understanding of Newtonian principles. Studies have shown a marked difference in the performance of men and women on both pre- and post-tests [1,2] and also indicate that experiential based instruction may lead to a reduction in this gender gap [1,3]. This poster presents FCI data collected at Western Washington University. Initial analysis of gender differences are consistent with those reported nationally. We also discuss factors that may contribute to the differences in performance and propose instructional strategies that are designed to address the gender gap. [4pt] [1] M. Lorenzo, et. al., ``Reducing the gender gap in the physics classroom,'' AJP 74(2), 118-122 (2006) [0pt] [2] J. Docktor and K. Heller, ``Gender Differences in Both Force Concept Inventory and Introductory Physics Performance,'' Proceedings at the 2008 PERC [0pt] [3] S. Pollack, et. al., ``Reducing the gender gap in the physics classroom: How sufficient is interactive engagement?'' PRST-PER 3 (2007)
Strengthening National Identity through National Symbols and ...
African Journals Online (AJOL)
South Africans vacillate in their national identity and remain largely attached to their racial and ethnic group identities. The aim of this article is to illustrate the manner in which a sense of understanding, familiarity and pride with regard to national symbols and thus to national identity can be attained. The objective is that the ...
Effects of wall materials and lyophilization on the viability of ...
African Journals Online (AJOL)
SAM
2014-06-16
Jun 16, 2014 ... The protective effect of wall materials was ... successfully used in the preservation and protection of ... functional nutrient in drinks and ice cream (Martínez- ..... isolated from skin juice, gel juice and flower of Aloe vera Miller. J.
The effect of quercetin on fertility of frozen-thawed ram epididymal ...
African Journals Online (AJOL)
mz
2017-03-13
Mar 13, 2017 ... The mean number of zygote, morula, and blastocyst stage embryos ... rabbits, bulls and human beings (Silva et al., 2013; Martínez-Páramo et al., 2012; Akalin et ..... pathway in buffalo (Bubalus bubalis) embryonic stem cells.
Status and implementation of reproductive technologies in goats in ...
African Journals Online (AJOL)
Mené
2015-02-19
Feb 19, 2015 ... In modern cattle breeding, assisted reproductive technologies in small ruminants have been used even ..... comparison to sponges that cause stress in the animals ... well as the use of females in heat (Rodríguez-Martínez et.
PREFACE: 4th National Meeting in Chaos, Complex System and Time Series
Raúl Hernández Montoya, Alejandro; Hernández Lemus, Enrique; Rubén Luévano Enríquez, José; Rodríguez Achach, Manuel Enrique; Vargas Madrazo, Carlos Ernesto
2013-12-01
The fourth edition of the National Meeting on Chaos, Complex Systems and Time Series (NMCCSTS4), or in Spanish 4a. Reunión Nacional de Caos, Sistemas Complejos y Series de Tiempo, was held from 29 November to 2 December 2011 in the University of Veracruz (Universidad Veracruzana), Campus Xalapa, at Xalapa Veracruz, México, in the beautiful House of the Lake (Casa del Lago), a late XIX century former textile factory situated in the edge of an also ancient former dam, currently a park containing three small lakes, very emblematic of Xalapa, City, the capital of the state of Veracruz, México. The previous editions of this meeting, were held in Mérida (2006), Pachuca (2008) and Puebla (2009). A clear uptrend is observed in the number of participants in this academic event from all Universities of México and abroad, going from about 15 participants in the first meeting to more than 90 in the last one. On this occasion, about 90 participants from three countries attended our event, where 29 papers (10 master lectures from top recognized national and international leaders in the fields of complexity, and 19 invited papers), one course for students and 42 posters were presented. A look at the scientific program of the NMCCSTS4, allows us to appreciate the wide range of topics and recent advances that were covered during our event; topics and recent results in the areas of biology, econophysics, sociophysics, genomics and bioinformatics, complex networks, thermodynamics, etc, were presented and discussed rigorously in a friendly, dynamical and informal atmosphere. Also, on this occasion, we celebrated Professor Miguel Angel Jiménez Montaño, for his very distinguished academic career throughout more that 50 years and as a founding member of the Faculty of Physics and AI of University of Veracruz. Prizes were awarded for the best poster presentations. The winner was Porfirio Toledo, from Faculty of Mathematics, University of Veracruz (Game theory to characterize
Nations need national land administration infrastructures
Bennett, Rohan; Rajabifard, Abbas; Williamson, Ian; Wallace, Jude
2012-01-01
Many nations lack a coherent national approach to land administration. Instead, land information and processes are frequently disaggregated across states, provinces, cantons, counties, and municipalities. This is particularly the case in federated countries. The growing body of land administration
Directory of Open Access Journals (Sweden)
Ana Luisa Velandia Mora
2008-03-01
Full Text Available En primer lugar se explora el significado de la periodización en historia. Seguidamente, se hace un examen de la periodización de los libros sobre historia de la enfermería más conocidos en el medio, analizando las obras de: Molina (1961; Frank y Elizondo (1961; Jamieson, Sewall y Suhrie (1968; Verderese (1980; Eseverri Chaverri (1984; Martínez y otros (1985; Ávila (1986; Donahue (1985-1993; Collière (1982-1993; Velandia (1994, 1995 y 2005; Hernández Conesa (1995; Aramayo (1997; Pérez González (1997; Siles (1999; García y Martínez (2001; Sánchez Puñales (2002; Benavent, Ferrer y Francisco del Rey (2003, Ancheta Niebla (2004. La intención es desvelar los enfoques externalistas e internalistas que subyacen al establecimiento o utilización de una periodización determinada y, específicamente, en la historia mundial o nacional de enfermería. Un objetivo complementario de este trabajo es dar a conocer, o "redescubrir", autores de publicaciones sobre historia de la enfermería que no son suficientemente conocidos.The first part of this article assesses the importance of periodization in History; followed by an analysis of the different types of periodization as defined by the most popular publications within the field: Molina (1961; Frank and Elizondo (1961; Jamieson, Sewall y Suhrie (1968; Verderese (1980; Eseverri Chaverri (1984; Martínez et al. (1985; Ávila (1986; Donahue (1985-1993; Collière (1993; Velandia (1994, 1995 y 2005; Hernández Conesa (1995; Aramayo (1997; Pérez González (1997; Siles (1999; García y Martínez (2001; Sánchez Puñales (2002; Benavent, Ferrer y Francisco del Rey (2003, Ancheta Niebla (2004. The main objective of this article is to discover both the externalist and internalist approaches underlying an author’s decision to create or use a particular type of periodization. The secondary objective is to introduce or rediscover publications about history of nursing, from unknown authors.
Field, Tiffany; Deeds, Osvelia; Diego, Miguel; Hernandez-Reif, Maria; Gauler, Andy; Sullivan, Susan; Wilson, Donna; Nearing, Graciela
2009-01-01
One hundred twelve pregnant women who were diagnosed depressed were randomly assigned to a group who received group Interpersonal Psychotherapy or to a group who received both group Interpersonal Psychotherapy and massage therapy. The group Interpersonal Psychotherapy (one hour sessions) and massage therapy (30 minute sessions) were held once per week for six weeks. The data suggested that the group who received psychotherapy plus massage attended more sessions on average, and a greater perce...
Neural correlates associated with superior tactile symmetry perception in the early blind
Bauer, Corinna; Yazzolino, Lindsay; Hirsch, Gabriella; Cattaneo, Zaira; Vecchi, Tomaso; Merabet, Lotfi B.
2014-01-01
Symmetry is an organizational principle that is ubiquitous throughout the visual world. However, this property can also be detected through non-visual modalities such as touch. The role of prior visual experience on detecting tactile patterns containing symmetry remains unclear. We compared the behavioral performance of early blind and sighted (blindfolded) controls on a tactile symmetry detection task. The tactile patterns used were similar in design and complexity as in previous visual perc...
Nurizah Salleh; Ahmad Fauzi Mohd Ayub; Norhasni Zainal Abidin
2011-01-01
The used of computers is increasingly becoming important in Malaysian education system. This occurs due to the rapid development of information technology in the world. Every educational policy that is planned involves the integration of information and communication technology. This computer usage is related to the computer laboratory. Hence, the computer laboratory should be well designed so that it will create a conducive learning environment. This study is to identify students’ perc...
Beltrán Carrillo, Vicente J.; Tortosa Martínez, Juan; Jennings, George; Sánchez, Elena S.
2013-01-01
Numerous quantitative studies have illustrated the potential usefulness of exercise programs for women with fibromyalgia. However, a deeper understanding of the physical and especially psychosocial benefits of exercise therapy from the subjective perspective of this population is still needed. This study was conducted with 25 women who had fibromyalgia and were participating in a nine-month, group-based exercise program. The aim was to provide an in-depth description and analysis of the perce...
Physical and enzymatic conditioning of oenological wastes to improve biogas production
Bracchitta, Mirko
2012-01-01
A fundamental assumption for by-product from winery industy waste-management is their economic and commercial increase in value. High energetic value recovery from winery industry is an attractive economic solution to stimulate new sustainable process. Approach of this work is based about physic and biological treatment with grape stalks and grape marc to increase polysaccharides components of cell wall and energetic availability of this by-products. Grape stalks for example have a high perce...
Review of Fatigue Management Technologies for Enhanced Military Vehicle Safety and Performance
2013-09-01
computer) No No No Pulsar Informatics, Inc. are at elevated risk for fatigue alone. w.wt.pulsarinformatics.oom "Quantify effects of schedule...imposed limitations of time upon recovery sleep return lo home time zone 1 (t dependent on software version purchased) Does not predict fatigue...driver turns the head or looks awaw from the Percentage of eyelid closure ’Dash-mounted Yes No No Computer Processor road ( PERC LOS ’) or eye visibility
The effect of music tempo on perceived crowding in retailing
Fiksdal, Taisiya; Hua, Wen
2016-01-01
Masteroppgave(MSc) in Master of Science in Strategic Marketing Management - Handelshøyskolen BI, 2016 In the marketing field the influence of in-store atmospherics on consumers’ shopping behavior is widely accepted. We seek to understand the effects of instore music tempo on perceived crowding and how music tempo can affect emotions, arousal and perceived control occurring in retail stores. Hence, our research questions are the following: Does music tempo influence the perce...
Super-Memorizers Are Not Super-Recognizers
Ramon, M.; Miellet, S.; Dzieciol, A.M.; Konrad, B.N; Dresler, M.; Caldara, R.
2016-01-01
Humans have a natural expertise in recognizing faces. However, the nature of the interaction between this critical visual biological skill and memory is yet unclear. Here, we had the unique opportunity to test two individuals who have had exceptional success in the World Memory Championships, including several world records in face-name association memory. We designed a range of face processing tasks to determine whether superior/expert face memory skills are associated with distinctive perce...
The Renewal Center: Time, Experience, Memory
Tennant, Mark
2005-01-01
Time, Experience, Memory Through experience we are conscious of time. Through time, our experiences become memories, influencing both conscious and unconscious thought. It is through our five senses; touch, sight, hearing, smell and taste, that these experiences are gathered. Humans are also born with inherent knowledge that our species has collected from generation to generation. This inherent knowledge, also called the collective unconscious, has a direct effect on the way we perce...
Numerical value biases sound localization
Golob, Edward J.; Lewald, Jörg; Getzmann, Stephan; Mock, Jeffrey R.
2017-01-01
Speech recognition starts with representations of basic acoustic perceptual features and ends by categorizing the sound based on long-term memory for word meaning. However, little is known about whether the reverse pattern of lexical influences on basic perception can occur. We tested for a lexical influence on auditory spatial perception by having subjects make spatial judgments of number stimuli. Four experiments used pointing or left/right 2-alternative forced choice tasks to examine perce...
Pavithra Cheluvaraj; Mangesh Balu Nanaware; Surya Prakasa Rao
2016-01-01
Background Old age is associated with increased occurrence of a wide array of Psychological impairments or losses, which might contribute to physical disabilities. As Depression has been identified as the most common aberration its rapid assessment would be able to identify the quality of individual and family life of the elderly. Aims To assess psychological health status with respect to depression among geriatric urban community, and the relationship of depression with health perce...
Cues for localization in the horizontal plane
DEFF Research Database (Denmark)
Jeppesen, Jakob; Møller, Henrik
2005-01-01
Spatial localization of sound is often described as unconscious evaluation of cues given by the interaural time difference (ITD) and the spectral information of the sound that reaches the two ears. Our present knowledge suggests the hypothesis that the ITD roughly determines the cone of the perce...... independently in HRTFs used for binaural synthesis. The ITD seems to be dominant for localization in the horizontal plane even when the spectral information is severely degraded....
Is the foreign language class really a more threatening place than the virtual enviroment?
Patricia Arnaiz
2012-01-01
[EN] Computer technology has the potential to provide rich resources for language teaching and learning. As computer access increases, so do new learning technologies in education. This paper is specifically interesed in the case of English language instruction in a Teacher Training Faculty, and blended e-learning components as tools for supporting English language acquisition. Through the analysis of a researcher-developed survey, this study examines and compares students¿ feelings and perc...
Nuevos genes reguladores de la tolerancia a estrés abiótico en Arabidopsis.
MARTÍNEZ MACÍAS, FÉLIX
2015-01-01
Martínez Macías, F. (2015). Nuevos genes reguladores de la tolerancia a estrés abiótico en Arabidopsis [Tesis doctoral no publicada]. Universitat Politècnica de València. doi:10.4995/Thesis/10251/48560. TESIS
Création d'outils pour la mesure de l'intégration des technologies de ...
International Development Research Centre (IDRC) Digital Library (Canada)
... dont les technologies de l'information et de la communication (TIC) sont intégrées en classe. ... Colombia, Mexico, Peru, Uruguay. Project Leader. Susana Martínez Restrepo. Institution. Fundación para la Educación Superior y el Desarrollo.
ARÁNDIGA MARTÍNEZ, ADRIÁN LUIS
2016-01-01
Arándiga Martínez, AL. (2016). Prototipo de dispositivo de medida de rendimiento en deportes de contacto basado en un acelerómetro triaxial y comunicación a dispositivo móvil. http://hdl.handle.net/10251/75671. TFGM
Müüdid ja mälestused mõttelennu meelevallas / Aita Kivi
Kivi, Aita, 1954-
2000-01-01
Sisu : Maimu Berg. Ära; Liam O'Flaherty. Must org; Victoria Holt. Menfreya; Tomás Eloy MartÍnez. Püha Evita; Ervin Õunapuu. Teie mälestuseks, kes iganes te olete ja kus asute; Anne Kahro. Viie kella tee
Directory of Open Access Journals (Sweden)
Antonio José Gil
2012-12-01
Full Text Available On April 26, 2012, Elena Giménez de Ory defend-ed her Ph.D. thesis at University of Jaén, entitled: “Robust methodologies applied to quality control of the positioning services offered by the Red Andaluza de Posicionamiento (RAP network”. Elena Giménez de Ory defended her dissertation in a publicly open presentation held in the Higher Polytechnic School at the University of Jaén, and was able to comment on every question raised by her thesis committee and the audience. The thesis was supervised by her advisor, Prof. Antonio J. Gil Cruz, and the rest of his thesis committee, Prof. Manuel Sánchez de la Orden, Dr. Antonio Miguel Ruiz Armenteros and Dr. Gracia Rodríguez Caderot. The thesis has been read and approved by his thesis committee, receiving the highest rating. All of them were present at the presentation.
Revista de tesis de la Facultad de Medicina de Bogotá
Directory of Open Access Journals (Sweden)
Facultad de Medicina Revista
1943-07-01
Full Text Available Excitación de la contractilidad uterina por el bicarbonato de sodio. Tesis de grado declarada meritoria. 1942. - Por Álvaro Combariza Vargas. Conclusiones / Contribución al estudio y tratamiento de los epiteliomas del labio. Tesis de grado, declarada meritoria. 1942. - Por Aurelio Pabón Rodríguez / Modificaciones de las proteinas totales del suero sanguineo y de la gravedad especifica de la sangre en el acto quirúrgico. Tesis de grado, declarada meritoria. 1942. - Por Leonidas Albornoz Medina / Venografia central y periferica. Tesis de grado. 1942. - Por Guillermo Sierra E. / Tratamiento del chancro blando y del linfogranuloma venereo. Tesis de grado. 1942. - Por Ernesto Martínez Capella / Computo diferencial leucocitario de Schilling, y eritrosedimentación en la enfermedad de Hansen. Tesis de grado, 1942. - Por Jorge Jiménez Gandica
El desarrollo de los cibermedios venezolanos
Directory of Open Access Journals (Sweden)
Elías Said Hung
2012-01-01
Full Text Available En esta investigación se analizan 68 medios digitales en Venezuela, a partir de los resultados obtenidos entre octubre y noviembre de 2010, en el marco del proyecto "Los Cibermedios en Colombia y América Latina", realizado desde la Universidad del Norte, con el apoyo de la Universidad de los Andes (Venezuela, con el fin de determinar el grado de adopción del ciberperiodismo y de las web 2.0 en este país. El estudio parte del modelo de análisis propuesto por Rodríguez-Martínez, Codina y Pedraza-Jiménez (2010. Los resultados apuntan a un bajo desarrollo de los cibermedios en Venezuela y la necesidad de un profundo debate y acciones orientadas al aprovechamiento de las potencialidades de las TIC desde los medios digitales en dicho país.
The Application of a WEPP Technology to a Complex Watershed Analysis
Elliot, William; Miller, Ina Sue; Dobre, Mariana
2017-04-01
Forest restoration activities are essential in many forest stands, where previous management and fire suppression has resulted in stands with high density, diseased trees and excessive fuel loads. Trying to balance the watershed impacts of restoration activities such as thinning, selective harvesting, and prescribed fire against the significant impact of wildfire is challenging. The process is further aggravated by the necessity of a road network if management activities include timber removal. We propose to present an approach to a watershed analysis for a 3400-ha of fuel reduction project within an 18,0000-ha sensitive watershed in the Nez Perce National Forest in Northern Idaho, USA. The FlamMap fire spread model was first used to predict the distribution of potential fire severity on the landscape for the current fuel load, and for a landscape that had been treated by thinning and/or prescribed fire. FlamMap predicts the flame length by 30-m pixel as a function of fuel load and water content, wind speed, and slope steepness and aspect. The flame length distribution was then classified so that the distribution of burn severity (unburned, low, moderate and high severity) was similar to the distributions observed on recent wildfires in the Forest. The flame length classes determined for the current fuel loads were also used for the treated condition flame lengths, where predominantly unburned or low severity fire severities were predicted. The burn severity maps were uploaded to a web site that was developed to provide soil and management files reflecting burn severity and soil texture, formatted for the Geospatial interface to the Water Erosion Prediction Project (GeoWEPP). The study area was divided into 40 sub watersheds under 2.5 km2 each for GeoWEPP analysis. GeoWEPP was run for an undisturbed forest; for the burn severity following wildfire for the current and treated fuel loads; for prescribed fire, either broadcast or jack pot burn; and for thinning either
Directory of Open Access Journals (Sweden)
Jesús Hernández García
2012-06-01
Full Text Available Se realizó una investigación longitudinal-descriptiva y prospectiva en los acueductos "Hoyo de Mena y Hermanos Saíz" de San Juan y Martínez en el período comprendido de enero de 2009 a diciembre de 2010, donde se caracterizó la calidad del agua a través de exámenes de laboratorio en las redes de distribución. El objetivo de esta investigación estuvo dirigido a evaluar la calidad sanitaria del agua suministrada por ambos sistemas en los Consejos Populares estudiados a través de exámenes bacteriológicos y físico químico. Quedó demostrado en la investigación realizada la mala calidad del agua suministrada por los acueductos "Hoyo de Mena con el 81% y Hermanos Saíz" , con un 78% de potabilidad respectivamente durante el año 2009, por la inestabilidad en el suministro de hipoclorito de sodio y roturas de los equipos de cloración, siendo más significativo en "Hermanos Saíz" por las deficiencias descritas con anterioridad durante el año 2010; se reportó el 81,9% de potabilidad y el 90.6 % en el Consejo Popular Urbano y evaluó el agua suministrada por estos sistemas de mala calidad en este período. Con todos los resultados obtenidos en el período analizado fueron confeccionadas tablas; se realizó el cálculo estadístico de X², con un nivel del significación del 95 %.A longitudinal-descriptive, prospective research was conducted at “Hoyo de Mena and Hermanos Saiz” aqueducts in San Juan y Martinez during January 2009 to December 2010, where the quality of water was characterized following laboratory examinations in water-supply networks. By means of this research the hygienic quality of water was assessed through bacterial and physical-chemical examinations; which water is supplied by both systems in the Popular Councils under studies. The quality of water supplied by “Hoyo de Mena (81% and Hermanos Saiz (78%” presented a poor quality during 2009 respectively, due to the unstable availability of chlorine and ruptures
Multigenerational effects of maternal undernutrition
Einstein, Francine H.
2014-01-01
Intrauterine exposure to reduced nutrient availability can have major effects in determining susceptibility to chronic disease later in life. Martínez et al. (2014) demonstrate multigenerational effects of poor maternal nutrition and evidence of germ-line transmission through alterations in DNA methylation. PMID:24896533
Vallejo, B.; Martinez Martinez, Adriana; Jorge, Carrillo Viveros
2017-01-01
En este libro, coordinado por Adriana Martínez y Jorge Carrillo, se presentan nueve capítulos en los que diversos especialistas analizan las transformaciones recientes de la industria automotriz desde una perspectiva regional, pero que obedece a los cambios y tendencias internacionales. Dichas
Chitosan application in maize (Zea mays) to counteract the effects of ...
African Journals Online (AJOL)
Jane
2011-07-11
Jul 11, 2011 ... Jiménez Cantú s/n, Cuautitlán Izcalli, Estado de México, México, CP. 54740. Accepted 20 ... stores water for several days without renewing, creating pollution ... nostic parameter in the evaluation of soil and water. For example ...
Néstor Tobón Botero
1986-01-01
La arquitectura de la vivienda rural en Colombia, volumen 11: Minifundio cafetero en Antioquia, Caldas, Quindío y Risaralda. Lorenzo Fonseca Martínez y Alberto Saldarriaga Roa. Litocencoa Ltda., Cali, 1984, 204 págs., mapas, planos arquitectónicos, fotografías.
Pentocin KCA1: a novel circular bacteriocin gene encoded in the ...
African Journals Online (AJOL)
C termini (Maqueda, et al., 2008; Heng & Tagg,. 2006). The circular structure appears to enhance the ... pentosus KCA1 (Anukam et al., 2013) isolated from the vagina of a ..... Montalba ́n-Lo ́pez M, Valdivia E, Mart ́ınez-Bueno. M (2008).
Padilla Martín-Caro, Víctor
2016-01-01
Tesis Doctoral leída en la Universidad Rey Juan Carlos de Madrid en 2012. Directores de la Tesis: Antonio Palmer Aparicio y Agustín Martínez Peláez CC. de la Educación, el Lenguaje, la Cultura y las Artes
Valencia Quiroz, Israel
2012-01-01
tesis que para obtener el grado de Doctorado en Ciencias Químicas, presenta Israel Valencia Quiroz ; asesor Miguel Castro Martínez149 páginas : ilustracionesDoctorado en Ciencias Químicas UNAM, Facultad de Química, 2012
Fragments of Nations and Nationalisms: Towards a Typology of the 21st Century Nationalisms
Directory of Open Access Journals (Sweden)
Şahan Savaş KARATAŞLI
2012-01-01
Full Text Available This paper attempts to provide a typology of state-seeking nationalisms of the 21stcentury. We collected data using James Minahan's (2002 Encyclopedia ofStateless Nations and from the major newspaper sources with internationalcoverage using Proquest newspaper database from 2000-2010. Based on thesedata we identified over 300 nations, which demand a state for their own, whichhave a well-defined territory,has a flag of their own and an organization whichdemand independence and/or autonomy. This paper examines 174 of these nationswhich have populations over 1 million. These nations are highly different fromeach other in terms of their level of mobilization level of militancy, organizationalcapacity, demands and grievances. Taking these differences into consideration, weestablished a typology of 21st century state-seeking nationalisms. Our typology,which is inspired by Miroslav Hroch's three phases, is not only descriptive incharacter but also suggests how nationalist movements evolve and transform intime.
CERN welcomes the Spanish Vice-President
Anaïs Schaeffer
2015-01-01
On 29 September, CERN had the pleasure of welcoming the Vice-President of the Government of Spain, Soraya Sáenz de Santamaría, for a visit of the Laboratory. From left to right: Lluis Miralles (Head of the General Infrastructure Services department), Soraya Sáenz de Santamaría (Vice-President of the Government of Spain) and José Miguel Jiménez (Head of the Technology department). The Vice-President was accompanied by Carmen Vela, Spanish Secretary of State for Research, Development and Innovation, Bernardo de Sicart Escoda, Ambassador of Spain to Switzerland, and Ana Menéndez Pérez, Permanent Representative of Spain to the United Nations and International Organizations in Geneva. Their tour started at LHC Point 1, where CERN Director-General Rolf Heuer welcomed them and gave them an introduction to CERN's activities. Jos&ea...
Brood Year 2004: Johnson Creek Chinook Salmon Supplementation Report, June 2004 through March 2006.
Energy Technology Data Exchange (ETDEWEB)
Gebhards, John S.; Hill, Robert; Daniel, Mitch [Nez Perce Tribe
2009-02-19
The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River spring/summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek to spawn through artificial propagation. This was the sixth season of adult chinook broodstock collection in Johnson Creek following collections in 1998, 2000, 2001, 2002, and 2003. Weir installation was completed on June 21, 2004 with the first chinook captured on June 22, 2004 and the last fish captured on September 6, 2004. The weir was removed on September 18, 2004. A total of 338 adult chinook, including jacks, were captured during the season. Of these, 211 were of natural origin, 111 were hatchery origin Johnson Creek supplementation fish, and 16 were adipose fin clipped fish from other hatchery operations and therefore strays into Johnson Creek. Over the course of the run, 57 natural origin Johnson Creek adult chinook were retained for broodstock, transported to the South Fork Salmon River adult holding and spawning facility and held until spawned. The remaining natural origin Johnson Creek fish along with all the Johnson Creek supplementation fish were released upstream of the weir to spawn naturally. Twenty-seven Johnson Creek females were artificially spawned with 25 Johnson Creek males. Four females were diagnosed with high bacterial kidney disease levels resulting in their eggs being culled. The 27 females produced 116,598 green eggs, 16,531 green eggs were culled, with an average eye-up rate of 90.6% resulting in 90,647 eyed eggs. Juvenile fish were reared indoors at the McCall Fish Hatchery until November 2005 and then transferred to the outdoor rearing facilities during the Visual Implant Elastomer tagging operation
Milton Argüello Jiménez (1935-1994
Directory of Open Access Journals (Sweden)
Jaime A. de la Hoz
1994-04-01
Full Text Available Conocí a Milton Argüello en los años de residencia. Desde entonces surgió una entrañable amistad que duró hasta su desaparición. Más que por la dimensión de su obra, Milton sobresale en la medicina nacional por su consagración, profundidad y obsesión por adquirir, cada vez más, los conocimientos y adelantos técnicos que fueron surgiendo en su especialidad –la gastroenterología-, una de las ramas medicas que mas avances ha logrado en los últimos decenios. Pocos médicos como él, trabajaron en esta materia con tanto denuedo y convicción, con tanta pasión y entrega, con tanto arte y lustre. Su devoción por la profesión y educación médica lo condujo al establecimiento de un elevado nivel y una senda imborrable, no solo en el entorno de su querido Hospital San Juan de Dios y Facultad de Medicina de la Universidad Nacional, sino también en la Escuela Colombiana de Medicina y en el ámbito nacional.
Childhood in National Consciousness and National Consciousness in Childhood.
Koester, David
1997-01-01
Examines the place of national imagery and the experience of the nation in childhood. Draws a comparison between such experiences in Iceland and Kamchatka, Russia. Describes ways in which these experiences become resources for expressing a distinct national identity. (EV)
Los Alamos National Laboratory SAVY-4000 Field Surveillance Plan Update for 2016
International Nuclear Information System (INIS)
Kelly, Elizabeth J.; Stone, Timothy Amos; Smith, Paul Herrick; Prochnow, David Adrian; Weis, Eric M.
2016-01-01
The Packaging Surveillance Program section of the Department of Energy (DOE) Manual 441.1-1, Nuclear Material Packaging Manual (DOE 2008), requires DOE contractors to ''ensure that a surveillance program is established and implemented to ensure the nuclear material storage package continues to meet its design criteria.'' The Los Alamos National Laboratory (LANL) SAVY-4000 Field Surveillance Plan was first issued in FY 2013 (Kelly et al. 2013). The surveillance plan is reviewed annually and updated as necessary based on SAVY-4000 surveillance and other surveillance findings, as well as results of the lifetime extension studies (Blair et al. 2012, Weis et al. 2015a). The LANL SAVY-4000 Field Surveillance Plan Update was issued in 2014 (Kelly et al. 2014). This 2016 update reflects changes to the surveillance plan resulting from restrictions on handling residue materials greater than 500 g, the addition of specific engineering judgment containers, and 2015 surveillance findings. The SAVY-4000 container has a design life of five years, which was chosen as a conservative estimate of the functional properties of the materials used in the construction of the SAVY 4000 when exposed to the potential insults including temperature, corrosive materials and gases, and radiation. The SAVY-4000 container design basis is described in a safety analysis report (Anderson et al. 2013). In the National Nuclear Security Administration's (NNSA's) approval of the safety analysis report, it was recommended that the design life clock begin on March 2014 (Nez et al. 2014). However, it is expected that a technical basis can be developed to extend the design life of the SAVY-4000 containers to approximately 40 years (Blair et al. 2012, Weis et al. 2015a). This surveillance plan update covers five years (2015-2019) and is developed to ensure SAVY-4000 containers meet their design criteria over the current five-year design life and to gather data that can be used in
Who is More Responsible? Preparatory Class Students’ Perceptions of Responsibility
Cesur, Kürşat; Ertaş, Abdullah
2014-01-01
The main aim of this study is to explore learners’ perceptions of their own responsibility in learning English. The question of whether our learners in Canakkale Onsekiz Mart University (hereafter COMU) Compulsory and Voluntary English Language Prep Classes are responsible enough for their own learning or not is the main focus of this study. Whether some variables like gender, the type of the prep class education (compulsory or voluntary) and the students’ departments will affect their perce...
How message framing affects consumer attitudes in food crises
Mitchell, V-W.; Bakewell, C.; Jackson, P. R.; Heslin, C.
2015-01-01
Purpose - The purpose of this paper is to explore the relationship between consumer risk perceptions and behaviour when information about food risks is framed in a positive or negative way.\\ud \\ud Design/methodology/approach - Using food consumption scenarios in an on-line experiment consumers perceived risk and risk tolerance is examined when messages are framed in three different news-type stories.\\ud \\ud Findings - As anticipated, message framing emerged as a significant predictor of perce...
Positive Psychology in Turkey: A Review Study of Postgraduate Theses
Bülent Baki Telef
2017-01-01
The aim of this study was to examine the trends of postgraduate theses in psychology, psychiatry, and education related to positive psychology in Turkey. The sample consisted of 204 masters’ and doctoral theses written in the fields of psychology, psychiatry, and education in relation to positive psychology between 2005 and 2015 for which access was permitted. The “Thesis Classification Form” prepared by the researchers was used as a data collection tool. The findings are presented with perce...
Insights of School Head About Marketing Education Services Through Digital Media
Samer Iqbal
2016-01-01
This study mainly focuses on the insights of a private school’s head pertaining to the use of digital media in educational marketing. The qualitative research paradigm was chosen for this study and in depth phenomenological interview was conducted from a head of a private school. Two themes were extracted from the data: Marketing educational services through digital media and its challenges, and digital media tool for marketing education services. The study revealed that the school head perce...
Stig Arve Sæther; Ingar Mehus
2016-01-01
Generally in sports, there is a strong assumption of a connection between skill level in young age and adulthood. Studies have mainly focused on the coaches’ understanding and role in identifying and developing talent. In this article we turn our attention towards the athletes’ perspectives, interviewing talented young football players (five boys and five girls) about their perceptions of their own talent and development. The objective of the article is to investigate how boys and girls perce...
Dirceu Tornavoi de Carvalho; Luciana Brandão Ferreira; Flávio Notomi Kanazawa; Priscilla Mendes Machado; Janaina de Moura Engracia Giraldi
2016-01-01
The research aims to verify if the experience with country brands website influences the image and attractiveness of a touristic destination in the consumers’ minds as also in their intention to visit the destination. A pre-test/post-test pre-experimental study with a 30 undergraduate students sample in a university of São Paulo was conducted. The treatment consisted of exposing the subjects to the Iceland official touristic site. The dependent variables were the touristic attractiveness perc...
CORDUNEANU-HUCI, Cristina
2014-01-01
Are autocratic leaders accountable to any constituencies? Does fiscal transparency play a role in relation to accountability? Simply put, do authoritarian executives have to “show the bill” of taxes raised and expenditure allocated to their political coalition of support in order to stay in power? What are the dimensions of transparency that matter? The main hypothesis is that the impact of transparency on autocratic accountability depends on the costs and benefits of the fiscal contract perc...
The National Security Strategy and National Interests: Quantity or Quality?
National Research Council Canada - National Science Library
Mercado, Leo
2001-01-01
The national security strategy (NSS), National Security Strategy for a New Century, published in December 1999, categorizes national interests as vital, important, and humanitarian and other interests...
Detector Engineer Victor Aguirre Electronic Technician Guillermo Dubó Electronic Technician Manuel MartÃnez Electronic Manager Pedro Vergara Instrument Maker VÃctor Pinto Instrument Maker Jaime Cruz Observer Juan Andrade Mechanic Assistant Manuel Hernández Observer Support Claudio Aguilera Assistant
Directory of Open Access Journals (Sweden)
Jorge Orlando Melo
2001-01-01
Full Text Available El nacionalismo cosmopolita. La referencia europea en la construcción nacional en Colombia, 1845-1900. Frédéric Martínez. Banco de la República, Instituto Francés de Estudios Andinos, Bogotá, 2001, 580 págs.
Why Has Peace Not Been Achieved in Colombia?
2012-03-15
Catalina Turbay Jiménez, El Estatuto de Seguridad: un Estudio de Caso , congresocienciapolitica.uniandes.edu.co (Accessed November 28, 2011). 23...2010 (Washington, DC: Centro de Estudios Hemisféricos de Defensa, Universidad Nacional de Defensa, 2010), 10. 25 Ibid, 11. 26 Richard D. Lewis
Instalación eléctrica para una industria de procesado de alimentos IV Gama
MARTÍNEZ FLOR, ALEJANDRO
2017-01-01
[EN] Electrical installation LV for food industry. [ES] Instalación eléctrica en BT para industria alimentaria. Martínez Flor, A. (2017). Instalación eléctrica para una industria de procesado de alimentos IV Gama. http://hdl.handle.net/10251/88215. TFGM
Enabling Openness: The future of the information society in Latin ...
International Development Research Centre (IDRC) Digital Library (Canada)
2013-11-20
Nov 20, 2013 ... ... Sandro Jiménez Ocampo, Hubert Linders, Gustavo Macedo Diniz, Ronaldo Lemos, Joana Veron, Georgia Gibson-Henlin, Carolina Botero, Cosette Castro, Claudio Ruiz, Carlos Gregorio, Katitza Rodriguez, Ramiro Álvarez Ugarte, Beatriz Busaniche, and Manuel Acevedo. Edición español: Descargar ...
Thermal and pH stabilities of partially purified polyphenol oxidase ...
African Journals Online (AJOL)
Dr. Paul Chidoka Chikezie
2012-07-30
Jul 30, 2012 ... indices of the two PPO extracts is summarized in Table. 1. At the end of the .... activity near neutral pH values (Jime´nez-Atie´nzar et al.,. 2004; Dogan and Dogan, 2004). ..... oxidase from white cherry fruit (Starks gold). GIDA.
Research Article Special Issue
African Journals Online (AJOL)
2017-08-08
Aug 8, 2017 ... ... Cosme R W, Jiménez Y C J A, Ramírez G J A. Coconut water, fetal bovine serum, Aloe vera and its combinations for ovine semen freezing. ... hen egg yolk by an easy method: Cryoprotective effect on frozen-thawed bull.
A new building for testing magnets
Corinne Pralavorio
2016-01-01
A ceremony to mark the laying of the foundation stone of Building 311, which will house a magnetic measurement laboratory, took place on 22 September. Olaf Dunkel, head of the Building 311 project, José Miguel Jiménez, head of the Technology Department, and Lluis Miralles, head of the Site Management and Buildings Department, during the ceremony for the laying of the foundation stone of Building 311. Lluis Miralles, head of the Site Management and Buildings Department, José Miguel Jiménez, head of the Technology Department, Roberto Losito, head of the Engineering Department, and Simon Baird, head of the Occupational Health and Safety and Environmental Protection Unit, officially laid the foundation stone of Building 311 during a ceremony on Thursday, 22 September. Situated beside the water tower, the building will house a magnetic measurement laboratory for the Technology Department. With a floor space of around 1400 square metres, it will comprise a...
Zachariáš, Michal
2011-01-01
Tato diplomová práce se zabývá vývojem indie game - tedy nezávislé vyvinuté hry. Popisuje důležité momenty v historii počítačových her. Objasňuje pojmy jako zlatý věk videoher a krach herního průmyslu roku 1983. Dále vysvětluje historii a vznik fenoménu indie game . Stručně popisuje některé rozdíly při vývoji nezávislé a komerční hry. V další části uvádí hlavní rysy některých z herních enginů a nástrojů, které lze použít pro tvorbu indie games . Nakonec popisuje návrh a implementaci jednoduch...
Directory of Open Access Journals (Sweden)
Federico C. Ocampo
2007-12-01
Full Text Available The taxonomy of the genus Anomiopsoides Blackwelder is revised. The species A. catamarcae Martínez and A. aurita (Burmeister are placed in synonymy with A. heteroclyta (Blanchard. Anomiopsoides fedemariai sp. nov. is described from Argentina. The genus Anomiopsoides now consists of four species: A. biloba (Burmeister, A. cavifrons (Burmeister, A. fedemariai sp. nov. and A. heteroclyta (Blanchard. A key is presented for the identification of the species of Anomiopsoides.Se hace una revisión de la taxonomía del género Anomiopsoides Blackwelder. Las especies A. catamarcae Martínez y A. aurita (Burmeister son consideradas como sinónimos de A. heteroclyta (Blanchard. Se describe una especie nueva, A. fedemariai sp. nov., especie nueva de Argentina. El género Anomioposoides consiste ahora en cuatro especies, A. biloba (Burmeister, A. cavifrons (Burmeister, A. fedemariai sp. nov. y A. heteroclyta (Blanchard. Se presenta una clave para la identificación de las especies de Anomiopsoides.
Su, Zhiguo; Dai, Tianjiao; Tang, Yushi; Tao, Yile; Huang, Bei; Mu, Qinglin; Wen, Donghui
2018-06-01
Coastal ecosystem structures and functions are changing under natural and anthropogenic influences. In this study, surface sediment samples were collected from disturbed zone (DZ), near estuary zone (NEZ), and far estuary zone (FEZ) of Hangzhou Bay, one of the most seriously polluted bays in China. The bacterial community structures and predicted functions varied significantly in different zones. Firmicutes were found most abundantly in DZ, highlighting the impacts of anthropogenic activities. Sediment total phosphorus was most influential on the bacterial community structures. Predicted by PICRUSt analysis, DZ significantly exceeded FEZ and NEZ in the subcategory of Xenobiotics Biodegradation and Metabolism; and DZ enriched all the nitrate reduction related genes, except nrfA gene. Seawater salinity and inorganic nitrogen, respectively as the representative natural and anthropogenic factor, performed exact-oppositely in nitrogen metabolism functions. The changes of bacterial community compositions and predicted functions provide a new insight into human-induced pollution impacts on coastal ecosystem. Copyright © 2018 Elsevier Ltd. All rights reserved.
The successful completion of LS1, consolidation and preparations for the future
Antonella Del Rosso
2014-01-01
For CERN’s Technology (TE) Department, success in LS1 is more important than finishing. In other words, the aim is to reach the finish line having maintained the highest standards of safety, quality and performance. Other challenges need to be faced too, before, during and after LS1, and the Department always approaches them with optimism. The new Department Head tells us how his 750 colleagues work to keep the Laboratory at the cutting edge of high-energy physics technology. José Miguel Jiménez. “We can only grow once we’ve stabilised our base.” The message presented by José Miguel Jiménez, who stepped into the role of TE Department Head in January 2014, is clear, as are his priorities going forward: “The Technology Department needs to be consolidated in terms of both its personnel and its assembly and test infrastructures, some of which are unique.” The TE Department is tasked with pr...
Su Santidad el Papa Pío IX, y la semana santa romana de 1866, visto por un ilustre valenciano
Directory of Open Access Journals (Sweden)
Del Río Hijas Ximenez, María Elena
2007-12-01
Full Text Available Francisco de Paula Ximénez and Marco made a trip to Italy in 1866. He left a chronicle unpublished. The story of his stay in Rome is published, during the Easter of this year. The chronicle of the celebrations reveals the fascination that exerted Pío IX on the travelling ones and it informs to us on the organization into which it was left of the Pontifical States.Francisco de Paula Ximénez y Marco hizo un viaje a Italia en 1866. Dejó una crónica inédita. Se publica el relato de su estancia en Roma, durante la semana santa de este año. La crónica de las celebraciones revela la fascinación que ejercía Pío IX sobre los peregrinos y nos informa sobre la organización de lo que quedaba de loa Estados Pontificios.
Directory of Open Access Journals (Sweden)
Meheddin İSPİR
2013-03-01
Full Text Available Aruz is a type of rhtyhm emerged from Arabic literature. It hasbeen transferred from Arabic literature to Farsi literature and also fromFarsi literature to Turkish literature. Aruz is a rhythm which isdesigned according to the sounds in syllable and open and closedletters that characterize syllables. Parts are derived from section andspecific Aruz rhythm are created in each section. The meter in Aruz isthe couplet. Aruz is consisted mainly of sections. Aruz in Turkishliterature dates back to acceptance of Islam. For the next centuries, thisrhythm has begun to be associated with Turkish language and led tothe emergence of Turkish Aruz. There has occurred some difficulties inthe application of Aruz in Turkish poetry. The lack of vowel sound inTurkish played an important role. Thus, long stressed vowels werefrequently used. This type of rhythm has played an important role inthe formation of literary works. It is a concept of sound rhythm in Aruzpoetry.There is a necessity of source use in the examination of Aruz.Compilations from similar poems in Divan poetry can be countedamong the sources. It eases the examination of Aruz through orderingsimilar poems in the specific parts. There are plenty of Aruz forms inthese compilations. The frequency of defects in the application of Aruzcan be traced in these works. A comparison among the poems of thepoets who lived in the same era can be made. Further, the developmentand improvement process of Aruz can be inspected. This paperexamined the following samples poem compilations from Turkishliterature: Ömer b. Mezîd’in Mecmû’atü’n-nezâir’i, Edirneli Nazmi’ninMecma‘u’n-Nezâ’ir’i, Pervane b. Abdullah’ın Mecmū‘atü’n-nezāir’i,Hisâlî’nin Metâliü’n-nezâir. Also, the need to use of these sources in theexamination of Aruz was highlighted. Aruz, Arap edebiyatında ortaya çıkmış ve sistemleştirilmiş bir ölçüdür. Arap edebiyatından Fars edebiyatına, Fars edebiyat
DEFF Research Database (Denmark)
Jensen, Lars
The ebbs and flows, which typically influences not just rhetoric around, but also how we think through nationalism, suggest nationalism is somehow at the core the same ‘thing’. But is it really? What connects the rise of nationalism in Australia in the 1880s, to the nationalism of the First...... surrounding refugees and migrancy in Australia and Europe (since this is what we are invited to do by the organisers), and how the deconstruction of such discourses might lead to more constructive ways of speaking through nation, might offer a way. I think Stan Grant’s book, Talking to My Country, through its...... combination of incisive criticism and insistence on constructive nation-(re)building offers an interesting launching pad. I am hoping to use Grant’s nation-rebuilding project to suggest ways that could open up similar spaces in equally exclusivist, the-nation-is-white-places in Europe. I am aware Grant has...
VT Green Mountain National Forest National Recreation Areas
Vermont Center for Geographic Information — (Link to Metadata) This dataset includes National Recreation Areas (NRAs) designated by Congress on the Green Mountain National Forest (GMNF) as of 2006. There are...
Jäntti, H; Kuisma, M; Uusaro, A
2007-11-01
The European Resuscitation Council (ERC) guidelines changed in 2005. We investigated the impact of these changes on no flow time and on the quality of cardiopulmonary resuscitation (CPR). Simulated cardiac arrest (CA) scenarios were managed randomly in manikins using ERC 2000 or 2005 guidelines. Pairs of paramedics/paramedic students treated 34 scenarios with 10min of continuous ventricular fibrillation. The rhythm was analysed and defibrillation shocks were delivered with a semi-automatic defibrillator, and breathing was assisted with a bag-valve-mask; no intravenous medication was given. Time factors related to human intervention and time factors related to device, rhythm analysis, charging and defibrillation were analysed for their contribution to no flow time (time without chest compression). Chest compression quality was also analysed. No flow time (mean+/-S.D.) was 66+/-3% of CA time with ERC 2000 and 32+/-4% with ERC 2005 guidelines (PERC 2000) versus 107+/-4s (ERC 2005) during 600-s scenarios (P=0.237). Device factor interventions took longer using ERC 2000 guidelines: 290+/-19s versus 92+/-15s (PERC 2005 guidelines (808+/-92s versus 458+/-90s, P<0.001), but the quality of CPR did not differ between the groups. The use of a single shock sequence with guidelines 2005 has decreased the no flow time during CPR when compared with guidelines 2000 with multiple shocks.
Redes sociais e conflito organizacional
Directory of Open Access Journals (Sweden)
Jorge Ávila de Lima
2016-06-01
Full Text Available As organizações são redes sociais cujos membros estabelecem entre si ligações de diversos tipos, formais e informais, positivas e negativas. O conflito entre atores é um processo comum que pode ser explicado com base num conjunto diverso de fatores. Contudo, o conflito interno às organizações tem sido pouco estudado, numa perpetiva de redes sociais. Para além disto, o conflito interorganizacional, analisado ao nível dos atores individuais, tem sido ainda menos estudado. No presente artigo, procuramos abordar o modo como as redes sociais das organizações estão associadas a perceções de conflito, quer intra-organizacional, quer interorganizacional, num contexto de proximidade física entre organizações. O estudo empírico, que envolveu duas organizações que partilhavam o mesmo espaço físico, mostra que, apesar da grande proximidade espacial entre ambas, os laços de amizade tendiam a concentrar-se no interior de cada organização e as perceções de conflito eram maiores entre as organizações do que no interior das mesmas. Os resultados são discutidos à luz das teses sobre os efeitos da propinquidade física sobre a atração interpessoal entre membros de grupos distintos
Gibbs Measures Over Locally Tree-Like Graphs and Percolative Entropy Over Infinite Regular Trees
Austin, Tim; Podder, Moumanti
2018-03-01
Consider a statistical physical model on the d-regular infinite tree Td described by a set of interactions Φ . Let Gn be a sequence of finite graphs with vertex sets V_n that locally converge to Td. From Φ one can construct a sequence of corresponding models on the graphs G_n. Let μ_n be the resulting Gibbs measures. Here we assume that μ n converges to some limiting Gibbs measure μ on Td in the local weak^* sense, and study the consequences of this convergence for the specific entropies |V_n|^{-1}H(μ _n). We show that the limit supremum of |V_n|^{-1}H(μ _n) is bounded above by the percolative entropy H_{it{perc}}(μ ), a function of μ itself, and that |V_n|^{-1}H(μ _n) actually converges to H_{it{perc}}(μ ) in case Φ exhibits strong spatial mixing on T_d. When it is known to exist, the limit of |V_n|^{-1}H(μ _n) is most commonly shown to be given by the Bethe ansatz. Percolative entropy gives a different formula, and we do not know how to connect it to the Bethe ansatz directly. We discuss a few examples of well-known models for which the latter result holds in the high temperature regime.
USGS National Hydrography Dataset from The National Map
U.S. Geological Survey, Department of the Interior — USGS The National Map - National Hydrography Dataset (NHD) is a comprehensive set of digital spatial data that encodes information about naturally occurring and...
on germination of chickpea seed
African Journals Online (AJOL)
patience
2014-01-01
Jan 1, 2014 ... capacitor and a thermometer was inserted horizontally. To make good contact between the thermometer and disc, some mercury was poured into the ..... magnetic fields on growth parameters of young sun flower and wheat seedlings. Bioelectromagnetics 25:638-641. Florez M, Carbonell MV, Martínez E ...
Antioxidant Capacity, Radical Scavenging Kinetics and Phenolic ...
African Journals Online (AJOL)
Antioxidant Capacity, Radical Scavenging Kinetics and Phenolic Profile of Methanol Extracts of Wild Plants of Southern Sonora, Mexico. EF Moran-Palacio, LA Zamora-Álvarez, NA Stephens-Camacho, GA Yáñez- Farías, A Virgen-Ortiz, O Martínez-Cruz, JA Rosas-Rodríguez ...
Directory of Open Access Journals (Sweden)
Néstor Tobón Botero
1986-10-01
Full Text Available La arquitectura de la vivienda rural en Colombia, volumen 11: Minifundio cafetero en Antioquia, Caldas, Quindío y Risaralda. Lorenzo Fonseca Martínez y Alberto Saldarriaga Roa. Litocencoa Ltda., Cali, 1984, 204 págs., mapas, planos arquitectónicos, fotografías.
DEFF Research Database (Denmark)
Østergaard, Uffe
2014-01-01
Nation er et gammelt begreb, som kommer af det latinske ord for fødsel, natio. Nationalisme bygger på forestillingen om, at mennesker har én og kun én national identitet og har ret til deres egen nationalstat. Ordet og forestillingen er kun godt 200 år gammel, og i 1900-tallet har ideologien bredt...
Vacunas, biotecnología y su relación con el aborto provocado
José Luis Redondo Calderón
2008-01-01
Las vacunas de células diploides humanas (WI-38, MRC-5) tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6) transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respi...
O papel da cultura e justiça organizacionais no empenhamento organizacional
Saraiva, Sílvia Isabel Vicente
2012-01-01
Dissertação de mest., Psicologia Social e das Organizações, Faculdade de Ciências Humanas e Sociais, Univ. do Algarve, 2012 Este estudo pretende analisar o impacto da cultura organizacional e das perceções de justiça organizacional no empenhamento organizacional. Simultaneamente é nosso objetivo analisar se a influência da cultura organizacional sobre o empenhamento aumenta na presença da justiça organizacional. Com este intuito, recorrendo a uma metodologia de base quantitativ...
Conocimientos sobre VIH/sida en un grupo de embarazadas VIH(+)
Guerra, ME; Rodríguez, AI; S, Rodríguez; Tovar, V; A, Carvajal; Ferreira, A; Blanco, L; León, JR
2009-01-01
OBJETIVO: Determinar el grado de conocimiento sobre VIH/SIDA en mujeres embarazadas VIH(+). MATERIALES Y MÉTODOS: El universo estuvo constituido por 58 embarazadas VIH(+) que acudieron a diferentes servicios de obstetricia de hospitales en Caracas durante los años 2003-2005. Se le aplicó una encuesta anónima individual, previo consentimiento asistido de las evaluadas. RESULTADOS: Fundamentalmente no existe un adecuado conocimiento sobre las vías de transmisión de la enfermedad, así como perce...
WHY 'OPEN INNOVATION' IS OLD WINE IN NEW BOTTLES
PAUL TROTT; DAP HARTMANN
2009-01-01
The concept of 'open innovation' has received a considerable amount of coverage within the academic literature and beyond. Much of this seems to have been without much critical analysis of the evidence. In this paper, we show how Chesbrough creates a false dichotomy by arguing that open innovation is the only alternative to a closed innovation model. We systematically examine the six principles of the open innovation concept and show how the Open Innovation paradigm has created a partial perc...
Elke Holst; Julia Schimeta
2012-01-01
The aim of recruiting more women into top-level management positions in business is attracting increasing interest among the general public and policy-makers alike. Calls for a quota for women and the widely publicized appointment of four women to the executive boards of DAX 30 companies in 2011 still does not detract from the fact that women continue to play a marginal role in the most important economic decision-making processes in Germany's largest companies. Again in 2011, only three perc...
Is student debt jeopardizing the short-term financial health of U.S. households?
Elliott, William; Nam, IlSung
2013-01-01
In this study, the authors use the Survey of Consumer Finances to determine whether student loans are associated with household net worth. They find that median 2009 net worth ($117,700) for households with no outstanding student loan debt is nearly three times higher than for households with outstanding student loan debt ($42,800). Further, multivariate statistics indicate that households with outstanding student loan debt and a median 2007 net worth of $128,828 incur a loss of about 54 perc...
Abortion and Crime: Unwanted Children and Out-of-Wedlock Births
John R. Lott, Jr.; John Whitley
2001-01-01
Abortion may prevent the birth of ''unwanted'' children, who would have relatively small investments in human capital and a higher probability of crime. On the other hand, some research suggests that legalizing abortion increases out-of-wedlock births and single parent families, which implies the opposite impact on investments in human capital and thus crime. The question is: what is the net impact? We find evidence that legalizing abortion increased murder rates by around about 0.5 to 7 perc...
Ochrona przeciwpożarowa jako element zapewnienia bezpieczeństwa – wybrany przykład turystyczny
Krzysztof Kaganek; Joanna Krawczyk
2014-01-01
The main issues of the article touch on some fire protection aspects in the context of tourism which is the security of hotel guests. This article covers basic issues related to providing security and fire protection. The purpose of this article is to raise and diagnose awareness among tourists, including hotel guests with regard to fire protection. At the hotel, in particular, this assessment may help us to find the right answer to the question about how security and fire protection are perc...
Applying CSSI Methodology to the Interpretation of the Audit Expectation Gap
Bruno José Machado de Almeida
2016-01-01
The development of the audit process is underpinned by a set of concepts that are not generally understood by the users of financial information or by the generality of investors. An audit is developed based on an accounting platform whose abstract or formal object consists of a set of conventions, principles and standards that can give rise to what is called an accounting gap. An audit is also grounded on concepts of risk and materiality which, although considered audit anchors, are not perc...
Torres Gómez, Ana C.
2013-01-01
Tesis (Maestría en Gerencia del Talento Humano). Universidad de Manizales. Facultad de Psicología, 2013 La siguiente alternativa de investigación se enmarca en el macroproyecto WONPUM y su objetivo principal es describir la percepción que tienen los docentes de algunas instituciones educativas colombianas acerca del ambiente laboral o entorno físico. Contó con un diseño descriptivo, transversal y relacional que pretendió caracterizar algunos aspectos cualitativos y cuantitativos de la perc...
77 FR 15052 - National Ocean Council-National Ocean Policy Draft Implementation Plan
2012-03-14
... charge for Federal agencies to implement the National Ocean Policy, the National Ocean Council developed... dollars a year to the national economy, and are essential to public health and national security. Next...
2010-12-29
... DEPARTMENT OF HOMELAND SECURITY [Docket No. DHS-2010-0050] National Protection and Programs Directorate; President's National Security Telecommunications Advisory Committee AGENCY: National Protection... Committee Meeting. SUMMARY: The President's National Security Telecommunications Advisory Committee (NSTAC...
Terrain Referenced Navigation Using SIFT Features in LiDAR Range-Based Data
2014-12-26
62] Mesas-Carrascosa, Francisco Javier, Isabel Luisa Castillejo-Gonzalez, Manuel Sanchex de La Orden, and Alfonso Garcia-Ferrer Porras. “Combin...System”. Proceeding of the ION 44th Annual Meeting. 1998. [86] Rueda, Antonio, José M Noguera, and Carmen Martı́nez- Cruz . “A Flooding Algorithm for
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Carmem L P S Zanta1 C A Martínez-Huitle2. Departamento de Química da Universidade Federal de Alagoas, Campus A.C. Simões, Tabuleiro do Martins, Maceió-AL 57072-970, Brazil; University of Milan, Department of Chemistry, Celoria 2, 20133 Milan, Italy ...
Martínez-Araya, Jorge Ignacio; Grand, André; Glossman-Mitnik, Daniel
2016-01-28
Correction for 'Towards the rationalization of catalytic activity values by means of local hyper-softness on the catalytic site: a criticism about the use of net electric charges' by Jorge Ignacio Martínez-Araya et al., Phys. Chem. Chem. Phys., 2015, DOI: 10.1039/c5cp03822g.
Directory of Open Access Journals (Sweden)
SIIS Centro de Documentación y Estudios
2013-07-01
Full Text Available Reseña de la obra 'El amor en personas con discapacidad intelectual y su repercusión en el bienestar emocional' (2012 de Raquel Morentin Gutiérrez, Benito Arias Martínez, José Manuel Rodríguez Mayoral y Miguel Ángel Verdugo Alonso.
RUIPÉREZ MARTÍNEZ, DIEGO
2010-01-01
Ruipérez Martínez, D. (2010). Proyecto de reforestación de tierras agrarias con encina (Quercus ilex L ballota Samp) para la producción de trufa (Tuber melanosporum Vitt.), en el término municipal de Peralveche, Guadalajara. http://hdl.handle.net/10251/8975. Archivo delegado
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. SILVIA MERCADO-SÁENZ1 BEATRIZ LÓPEZ-DÍAZ1 FRANCISCO SENDRA-PORTERO1 MANUEL MARTÍNEZ-MORILLO1 MIGUEL J RUIZ-GÓMEZ1. Facultad de Medicina, Departamento de Radiología y Medicina Física, Universidad de Málaga, Málaga, España ...
México, la economía mundial y la soberanía nacional
Directory of Open Access Journals (Sweden)
Ifigenia Martínez
2012-09-01
Full Text Available El presente análisis fue tomado de Deuda Externa y Soberanía Nacional. Ifigenia Martínez (1986, Materiales de Investigación Económica, Facultad de Economía, UNAM, México. Digitalizado y corregido por Octavio Cortés Gutiérrez.
U.S. Department of Health & Human Services — The national average for the HCAHPS survey categories. HCAHPS is a national, standardized survey of hospital patients about their experiences during a recent...
A national assessment of physical activity on US national forests
Jeffrey D. Kline; Randall S. Rosenberger; Eric M. White
2011-01-01
In an era of declining timber harvests on federal lands, the US Forest Service has sought to better describe the public benefits associated with the nation's continued investment in managing the national forests. We considered how national forests contribute to public health by providing significant outdoor recreation opportunities. Physical inactivity has become...
Energy Technology Data Exchange (ETDEWEB)
Whitehead, K. [Whitby Hydro, ON (Canada)
2002-07-01
The partnership involving the First Nations of Southern First Nations Secretariat (SFNS) Economic Development Corporation and private sector companies is called First Nations Power (FNP), and is Aboriginal-owned. Business opportunities in the energy sector marketplace are being pursued through FNP. The member organizations of FNP are listed. Operating out of facilities located at Delaware First Nation in Moranviatown, Ontario, FNP utilizes strategic alliances with proven private sector firms and other First Nation organizations to advance its plans. FNP operates in the following fields: advisory services, energy management, transmission and grid connections, distribution and utility administration, retail of products and services, training and development, and power generation. The various projects include hydraulic and alternative energy sources. The business activities are briefly described, as are the energy projects and special projects. A discussion of the First Nations Power Team concludes this presentation.
Zoltán BALLA
2009-01-01
National security administration is the special executivedisposal activity of the national security agencies, the section of the state administration that helps the governmental work by reconnoitering and preventing with secret-servicing methods of the risks that shall harm or endanger the national security’s interests. The main operational principles of national security governing are the followings among others: - controlling the operation of national security organization belongs to the ex...
BLM Colorado National Monument and National Conservation Area Polygons
Department of the Interior — Shapefile Format –This data set consists of digital data describing BLM National Conservation Lands or National Landscape Conservation System (NLCS) in the State of...
U.S. Department of Health & Human Services — Payment measures – national data. This data set includes national-level data for the payment measures associated with an episode of care for heart attack, heart...
Cross-National Yardstick Comparisons
DEFF Research Database (Denmark)
Møller Hansen, Kasper; Leth Olsen, Asmus; Bech, Mickael
2015-01-01
performance comparisons—even when accounting for classic national sociotropic and egotropic items. Specifically, voters respond strongly to how the prospective wealth of Denmark evolves relative to the neighboring Sweden. Interestingly, voters are more negative in their response to cross-national losses......Comparing performance between countries is both a theoretically and intuitively useful yardstick for voters. Cross-national comparisons provide voters with heuristics that are less cognitively demanding, less ambiguous, and less uncertain than solely national, absolute performance measurements. We...... test this proposition using a unique, choice experiment embedded in the 2011 Danish National Election Study. This design allows to contrast cross-national comparisons with more traditional national sociotropic and egotropic concerns. The findings suggest that voters are strongly influenced by cross-national...
Los Alamos National Laboratory A National Science Laboratory
Energy Technology Data Exchange (ETDEWEB)
Chadwick, Mark B. [Los Alamos National Laboratory
2012-07-20
Our mission as a DOE national security science laboratory is to develop and apply science, technology, and engineering solutions that: (1) Ensure the safety, security, and reliability of the US nuclear deterrent; (2) Protect against the nuclear threat; and (3) Solve Energy Security and other emerging national security challenges.
75 FR 14454 - National Protection and Programs Directorate; National Infrastructure Advisory Council
2010-03-25
..., National Infrastructure Advisory Council. [FR Doc. 2010-6633 Filed 3-24-10; 8:45 am] BILLING CODE 9110-9P-P ... Directorate; National Infrastructure Advisory Council AGENCY: National Protection and Programs Directorate... Infrastructure Advisory Council (NIAC) will meet on Tuesday, April 13, 2010, at the National Press Club's...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 37; Issue 4. Changes in membrane lipids and carotenoids during light acclimation in a marine cyanobacterium Synechococcus sp. Olimpio Montero Alberto Sánchez-Guijo Luis M Lubián Gonzalo Martínez-Rodríguez. Articles Volume 37 Issue 4 September 2012 pp 635-645 ...
Directory of Open Access Journals (Sweden)
Arturo Durán D.
1933-12-01
servicio de mujeres, salón de caridad, a cargo del doctor Alejandro Bernal Jiménez, del Hospital San José del Líbano, Departamento del Tolima, la enferma L. S., de 70 años de edad natural de Chiquinquirá, hija de Manuel Sánchez y Joaquina Cortés.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Electrochemical behaviour of platinum at polymer-modified glassy carbon electrodes · Carmem L P S Zanta C A Martínez-Huitle · More Details Abstract Fulltext PDF. In this paper, the preparations and voltammetric characteristics of chitosan-modified glassy carbon (Ct-MGC) and platinum electrodes are studied. Ct-MGC can ...
Scientific Openness and National Security at the National Laboratories
McTague, John
2000-04-01
The possible loss to the People's Republic of China of important U.S. nuclear-weapons-related information has aroused concern about interactions of scientists employed by the national laboratories with foreign nationals. As a result, the National Academies assembled a committee to examine the roles of the national laboratories, the contribution of foreign interactions to the fulfillment of those roles, the risks and benefits of scientific openness in this context, and the merits and liabilities of the specific policies being implemented or proposed with respect to contacts with foreign nationals. The committee concluded that there are many aspects of the work at the laboratories that benefit from or even demand the opportunity for foreign interactions. The committee recommended five principles for guiding policy: (1) Maintain balance. Policy governing international dialogue by laboratory staff should seek to encourage international engagement in some areas, while tightly controlling it in others. (2) Educate staff. Security procedures should be clear, easy to follow, and serve an understandable purpose. (3) Streamline procedures. Good science is compatible with good security if there is intelligent line management both at the labs and in Washington, which applies effective tools for security in a sensible fashion. (4) Focus efforts. DOE should focus its efforts governing tightened security for information. The greatest attention should obviously be provided to the protection of classified information by appropriate physical and cybersecurity measures, and by personnel procedures and training. (5) Beware of prejudice against foreigners. Over the past half-century foreign-born individuals have contributed broadly and profoundly to national security through their work at the national laboratories.
Jiménez-Morillo, Nicasio T.; González-Pérez, José A.; Waggoner, Derek C.; Almendros, Gonzalo; González-Vila, Francisco J.; Hatcher, Patrick G.
2016-04-01
Introduction: Fire is one of the most important modulator factors of the environment and the forest. It is able to induce chemical and biological shifts and these, in turn, can alter the physical properties of soil. Generally, fire affects the most reactive fraction, soil organic matter (SOM) (González-Pérez et al., 2004) resulting in changes to several soil properties and functions. To study changes in SOM following a wildfire, researchers can count on several traditional as well as new analytical techniques. One of the most recently employed techniques is Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS). This new powerful ultra-high resolution mass spectral technique, together with graphic interpretation tools such as van Krevelen diagrams (Kim et al, 2003), may be used to shed light on alterations caused by the burning of SOM. The objective of this research is to study fire impacts on SOM, using a sandy soil collected under a Cork oak (Quercus suber) in Doñana National Park, Southwest Spain. that was affected by a wildfire in August 2012. Methods: The impact of fire on SOM was studied in various different sieve fractions (coarse, 1-2 mm, and fine, tannins, lignin, lipids, protein and carbohydrate derived. The unburnt SOM in the coarse fraction was mainly composed of compounds with a high intensity in the tannin-like, lignin-like and carbohydrate-like regions of the van Krevelen diagram, whereas the SOM in the fine fraction showed a high intensity in the lipid-like and protein-like regions. These results suggest that the SOM in the coarse fraction was less altered than that of the fine fraction; the latter believed to be subjected to higher microbial activity. We suggest that the observed changes occurs via a methylation process, producing a SOM that is highly humified (Jiménez-Morillo et al., 2014). The SOM in the coarse fraction affected by fire, showed a high relative intensity of chemical compounds in the carbohydrate-like and
DEFF Research Database (Denmark)
Lippert-Rasmussen, Kasper
2009-01-01
In National Responsibility and Global Justice, David Miller defends the view that a member of a nation can be collectively responsible for an outcome despite the fact that: (i) she did not control it; (ii) she actively opposed those of her nation's policies that produced the outcome; and (iii......) actively opposing the relevant policy was costly for her. I argue that Miller's arguments in favor of this strong externalist view about responsibility and control are insufficient. Specifically, I show that Miller's two models of synchronic collective responsibility*the like-minded group model...
Clara Inés López-Rodríguez
2016-01-01
http://dx.doi.org/10.5007/2175-7968.2016v36nesp1p88 Since the first Corpus Use and Learning to Translate (CULT) Conference in Bertinoro (Italy) in 1997, the usefulness of corpora for translators and trainee translators has been highlighted. From an initial approach where translators compiled ad hoc corpora in their hard drive for a subsequent study with lexical analysis software, there emerged a new trend towards the use of the Internet as corpus. In this second approach, the Web is perce...
Jones, Satu
2015-01-01
This Master s thesis consists of two parts. The first is a literature review and reflection on the research process. The other part is a scientific article (Jones, M., Pietilä, I., Joronen, K., Simpson, W., Gray, S. & Kaunonen, M.: The varied voices of parents with mental illness a discourse analysis of focus group discussions). In the literature review the main themes of the study are discussed in more depth. These include mental illness and the ways in which it is portrayed and perce...
Allen, Valerie
2012-01-01
Against an historical background of sexual inequality in the workplace engineering persists as a bastion of inequality in the 21st century. This research examines the perceptions of engineering of 86 students, who chose to study the new Level 2 Engineering Diploma at age 14. The students were based in the South West of Birmingham, close to the MG Rover Longbridge plant that closed in 2005. The results have been compared with the results of the EngineeringUK survey (EngineeringUK,2012) on perc...
National context, parental socialization, and religious belief: Results from 15 nations
Kelley, J.; Graaf, N.D. de
1997-01-01
How much does a nation's religious environment affect the religious beliefs of its citizens? Do religious nations differfrom secular nations in how beliefs are passed on from generation to generation? To find out, we use data from the 1991 International Social Survey Programme collected in 15
2013-11-19
... OFFICE OF SCIENCE AND TECHNOLOGY POLICY OFFICE National Nanotechnology Initiative Strategic Plan; National Science and Technology Council; National Nanotechnology Coordination Office AGENCY: Executive... Science, Engineering, and Technology Subcommittee requests public comments on the draft 2014 National...
McCrae, Robert R; Terracciano, Antonio; Realo, Anu; Allik, Jüri
2007-12-01
National character stereotypes are widely shared, but do not reflect assessed levels of personality traits. In this article we present data illustrating the divergence of stereotypes and assessed personality traits in north and south Italy, test hypotheses about the associations of temperature and national wealth with national character stereotypes in 49 cultures, and explore possible links to national values and beliefs. Results suggest that warmth and wealth are common determinants of national stereotypes, but that there are also idiosyncratic influences on the perceptions of individual nations.
Asuntos de Arquitectura y Patrimonio.
Directory of Open Access Journals (Sweden)
Antonio Jesús Santana Guzmán
2013-01-01
Full Text Available Mi primer contacto con el mundo de la Historia del Arte llegó a finales de los noventa con una charla sobre la Iglesia del Sagrado Corazón; esa lección me dejó clarísima mi vocación; del mismo modo, el primer texto específico que consulté fue un monográfico en el que se trataba el asunto de la Torre-Camarín de la Victoria. Pues tan solo cinco años después resultaba que la autora de ambas investigaciones, Rosario Camacho Martínez, se convertía en directora de mi tesis doctoral. Por todo esto, es para mí un honor poder contribuir a un homenaje tan merecido para una persona a la que siento (no solo como guía en la docencia, sino también en muchos valores personales y a la que considero toda una maestra en el más amplio sentido del término. Aquel monográfico pertenece a una serie titulada Asuntos de Arquitectura, resultado de la intención común del Colegio de Arquitectos y de la Universidad por difundir el patrimonio arquitectónico de Málaga. Rosario participa en seis de estas elaboradas carpetas, todas dedicadas al Barroco1, debido a su formación en dicho periodo, algo que ya quedó patente en su apasionante tesis doctoral2. Esta colección se presenta en gran formato y se acompaña por una serie de planos realizados ex profeso por José María Romero Martínez con alguna colaboración de Francisco Jiménez y Pedro Lobato
DEFF Research Database (Denmark)
Giri, Krishna Prasad; Kjær-Rasmussen, Lone Krogh
This paper investigates practices related to the ideology of infusing Gross National Happiness (GNH) into school curriculum, the effectiveness of the meditation and mind training and the implication of GNH for school environment. It also explores how GNH ambience has been managed and practiced...... of Gross National Happiness and Educating for Gross National happiness....
Ortega Arjonilla, Emilio
2012-01-01
Obra ressenyada: Emilio ORTEGA ARJONILLA ; Christian BALLIU ; Esperanza ALARCÓN NAVÍO ; Ana B. MARTÍNEZ LÓPEZ (eds.). À propos de l’enseignement de la traduction et l’interprétation en Europe / Sobre la enseñanza de la traducción y la interpretación en Europa. Granada : Editorial Comares, 2012.
Martínez Urrea, José
2009-01-01
Discurso de inauguración del curso 2009 de la Reial Acadèmia de Medicina de la Comunitat Valenciana por el Ilmo. Sr. Dr. D. José Martínez Urrea: El endemismo por paludismo, lepra, leishmaniosis y leptospirosis en la provincia de Castellón, a mediados del siglo XX. Vivencias personales.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. Julio Reyes Leyva. Articles written in Journal of Biosciences. Volume 37 Issue 6 December 2012 pp 999-1004 Articles. Sialyl Lewis x expression in cervical scrapes of premalignant lesions · Noé Velázquez-Márquez Gerardo Santos López Lucio Jiménez Aranda Julio Reyes Leyva ...
van Kooten, G.H.; Hilhorst, A.; Puech,; Tigchelaar, E.
2007-01-01
George H. van Kooten, “Pagan and Jewish Monotheism according to Varro, Plutarch and St Paul: The Aniconic, Monotheistic Beginnings of Rome’s Pagan Cult—Romans 1:19-25 in a Roman Context,” in Flores Florentino: Dead Sea Scrolls and Other Early Jewish Studies in Honour of Florentino García Martínez
Huising, J.
1993-01-01
This thesis describes an approach to land use inventory at the sub-regional scale in the Guacimo-Rio Jiménez-Siquirres (GRS) area in the Atlantic Zone of Costa Rica. Therefore, the concept of "land use zones" is introduced. The land use zone (LUZ) plays a central role in the definition of
Mattson Solomon transform and algebra codes
DEFF Research Database (Denmark)
Martínez-Moro, E.; Benito, Diego Ruano
2009-01-01
In this note we review some results of the first author on the structure of codes defined as subalgebras of a commutative semisimple algebra over a finite field (see Martínez-Moro in Algebra Discrete Math. 3:99-112, 2007). Generator theory and those aspects related to the theory of Gröbner bases ...
Towards Natural Transition in Compressible Boundary Layers
2016-06-29
Email: marcello@sc.usp.br Investigator: Germán Andrés Gaviria Mart́ınez Email: 4ndres.gaviria@gmail.com Universidade de São Paulo, Brazil Grant...hidrodinamica linear do escoamento compressivel em uma cavidade. Master’s thesis, Universidade de Sao Paulo, Escola de Engenharia de São Carlos, Universidade
Growth and yield of barley (Hordeum vulgare L.) as affected by ...
African Journals Online (AJOL)
Bheema
(2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.
The impact of national traditions and cultures on national foresight processes
DEFF Research Database (Denmark)
Andersen, Per Dannemand; Rasmussen, Lauge Baungaard
2014-01-01
This paper addresses the influence of national traditions, styles or culture on the use of foresight in decision-making processes. Inspired by sociologists’ contributions on national culture, the paper demonstrates that two dimensions of national culture, power distance and uncertainty avoidance......, are useful in the characterisation of the context in which national foresight exercises are carried out. The paper is based on two Danish cases: The Danish Government’s Globalisation Strategy, from 2005, and the Danish Research 2015 process, from 2008, which focus on priority settings for strategic research...
Directory of Open Access Journals (Sweden)
Teresa Joa Mesa
Full Text Available Se presentan los resultados de un estudio descriptivo y transversal sobre la alimentación precoz en los recién nacidos intervenidos quirúrgicamente por malformaciones digestivas, atendidos en el Servicio de Neonatología del Hospital Infantil Norte "Dr. Juan de la Cruz Martínez Maceira" de Santiago de Cuba en el quinquenio 2003 _ 2007. La nutrición enteral causó menor número de complicaciones y fallecimientos, propició una mayor recuperación del peso corporal y apenas redujo las cifras de hemoglobina durante la estadía intrahospitalaria.The results of a descriptive and cross-sectional study on the early feeding in newborns surgically treated due to digestive malformations are presented. They were assisted in the Neonatology Service of "Dr. Juan de la Cruz Martínez Maceira" Northern Children Hospital of Santiago de Cuba in the five year period 2003-2007. The enteral nutrition caused less number of complications and deaths, it brought about a greater recovery of the body weight and it barely reduced the hemoglobin during the intrahospital stay.
Directory of Open Access Journals (Sweden)
Isauro Rionda Arreguín
2012-02-01
Full Text Available The Real Colegio de Mineria or Real Seminario de Mineria or Colegio Metalico was founded in 1792 and in january the 1st of that year admitted the first students. Several of their graduates during the firs decade of the XIX century worked in the mining industry in Guanajuato and were involved in the insurrection movement, among them were: José Antonio Rojas, Casimiro Chowell, Rafael Dávalos, y Ramón Fabié y Mariano Jiménez.Se funda en 1792 el Real Colegio de Minería o Real Seminario de Minería, o Colegio Metálico; institución que abre sus puertas a los primeros alumnos, el día primero de enero de ese año. Esos egresados del Real Colegio de Minería que en la primera década del siglo XIX trabajaron en la minería guanajuatense fueron: José Antonio Rojas, Casimiro Chowell, Rafael Dávalos, y Ramón Fabié y Mariano Jiménez.
La construcción de un mito : fortuna crítica de Juan de Juanes en los siglos XVI y XVII
Directory of Open Access Journals (Sweden)
Miguel Falomir Faus
1999-01-01
Full Text Available Este artículo pretende analizar los inicios de la fortuna crítica de Juan de Juanes en los siglos XVI y XVII. La «leyenda» de Juanes se asentó en su triple condición de gloria local, pintor ejemplar y artista piadoso, y quienes la forjaron, de Escolano a Vicente Vitoria pasando por Pacheco o Jusepe Martínez, no dudaron en potenciar, e incluso distorsionar, aquellas facetas de la personalidad de Juanes afines a sus intereses particulares.This article seeks to analyze the origins of the historiographical treatment of Juan de Juanes in the sixteenth and seventeenth centuries. The «myth» of Juanes was posited on three aspects: as exemplary and illustrious citizen, model forpainters, and pious artist. Those who forged this image of the artist, from Escolano to Vicente Vitoria and passing by Pacheco or Jusepe Martínez, did not doubt in emphasizing and even distorting those aspects of his personality and life that affirmed their individual interests.
Chlamydia species in free-living Cattle Egret (Bubulcus ibis and Hoopoe (Upupa epops in Egypt
Directory of Open Access Journals (Sweden)
Jakeen K. El-Jakee
2014-06-01
Full Text Available Little information is available on the presence of chlamydia infection in wildlife. This study was conducted to assess the occurrence of chlamydiae in asymptomatic birds from two species of wild birds (Cattle Egret and Hoopoe in Egypt. In the present study Chlamydiaceae was analyzed using Giemsa stain, Giménez stain, fluorescent antibody test (FAT and PCR. The results of these techniques were compared with CFT for detecting Chlamydia psittaci antibodies among the examined birds. The results reveal that 96.4%, 81.8%, 89.1%, 80.0% and 58.2% of the examined samples were positive for chlamydiosis using PCR, Giemsa stain, Giménez stain, FA, and CFT respectively among Hoopoe. The percentages were 90.6%, 77.4%, 83.0%, 75.5% and 66.0% respectively for the previous tests among Cattle Egret birds. The results suggest that Cattle Egret and Hoopoe may be reservoir of Chlamydiaceae species and thus shed the organisms in their excreta. The shedding of chlamydiae by free living birds in Egypt may expose humans that come in contact with these birds to zoonotic risks.
2010-04-01
... national securities exchanges, national securities associations, registered clearing agencies and the... Certain Stabilizing Activities § 240.17a-1 Recordkeeping rule for national securities exchanges, national...) Every national securities exchange, national securities association, registered clearing agency and the...
Perceções sobre criatividade: Estudo com estudantes do Ensino Superior
Directory of Open Access Journals (Sweden)
Maria de Fátima Morais
2016-01-01
Full Text Available En el mundo actual la universidad tiene un pap el crucial en la formación de ciudadanos capaces de innovar. La creatividad es, pues, un concepto a valorar en la educación superior, pero esta valoración implica cambios en la vida cotidiana educativa. Una fuente de información relevante para la promoción de las habilidades creativas en los estudiantes universitarios es auscultar lo que piensan acerca de estas habilidades. En este sentido, a partir del cuestionario " Universidad y Competencias Creativas" , se analizaron las percepciones de 582 estudiantes de una universidad portuguesa acerca de la conceptualización y de la valoración de la creatividad en el contexto académico. Las percepciones se analizaron de acuerdo con el área cu rricular de formación y el género, encontrando dif ere ncias esta dísticamente significativas en funció n de ambas las variab les. Los resultados permiten refle xiones hacia una mayor pr ofund ización de este estudio, p ero también señalan orientaciones para cu idados y refuerzos sobre las prácti cas educativas en este nivel de ense ñanza.
International Nuclear Information System (INIS)
Takx, Richard A.P.; Hoesein, Firdaus A.A.M.; Mali, Willem P.T.M.; Leiner, Tim; Jong, Pim A. de; Vliegenthart, Rozemarijn; Isgum, Ivana; Koning, Harry J. de; Aalst, Carlijn M. van der; Zanen, Pieter; Lammers, Jan-Willem J.; Groen, Harry J.M.; Rikxoort, Eva M. van; Ginneken, Bram van; Schmidt, Michael; Oudkerk, Matthijs
2015-01-01
The objective of this study was to investigate the association of spirometry and pulmonary CT biomarkers with cardiovascular events. In this lung cancer screening trial 3,080 male participants without a prior cardiovascular event were analysed. Fatal and non-fatal cardiovascular events were included. Spirometry included forced expiratory volume measured in units of one-second percent predicted (FEV 1 %predicted) and FEV 1 divided by forced vital capacity (FVC; FEV 1 /FVC). CT examinations were quantified for coronary artery calcium volume, pulmonary emphysema (perc15) and bronchial wall thickness (pi10). Data were analysed via a Cox proportional hazard analysis, net reclassification improvement (NRI) and C-indices. 184 participants experienced a cardiovascular event during a median follow-up of 2.9 years. Age, pack-years and smoking status adjusted hazard ratios were 0.992 (95 % confidence interval (CI) 0.985-0.999) for FEV 1 %predicted, 1.000 (95%CI 0.986-1.015) for FEV 1 /FVC, 1.014 (95%CI 1.005-1.023) for perc15 per 10 HU, and 1.269 (95%CI 1.024-1.573) for pi10 per 1 mm. The incremental C-index ( 3 , an increase in C-index of 0.076 and an NRI of 16.9 % (P < 0.0001). Pulmonary CT biomarkers and spirometry measurements were significantly associated with cardiovascular events, but did not contain clinically relevant independent prognostic information for cardiovascular events. (orig.)
Marketingová komunikace nezávislé hudební skupiny
Hanke, Lukáš
2010-01-01
The main intention of this dissertation named "Marketing communication of an independent music band" is implementing marketing routines into marketing communication of beginning independent music band considering the influence of various contemporary factors on the music industry as a whole. The first theoretical part of the dissertation illustrates the present-day state of the music industry, influence of digital media - mainly the influence of internet. The second theoretical part describes...
DEFF Research Database (Denmark)
Brincker, Benedikte
The last book Anthony D. Smith wrote before he died, and which will be published in Spring 2017, has the title Nation and Classical Music. Smith had for a long time been intrigued by the intimate relationship between the nation and classical music. At the most manifest level it involves...... them into their compositions thus challenging the romantic musical style searching for an authentic national musical expression. Against the backdrop of the extensive research carried out by Anthony Smith into the relationship between the nation and classical music, the present paper seeks to add...... cultural centers. In doing this, the paper seeks to unfold how composers channeled musical inspiration embedded in cultural environments that cut across national boundaries into national musical traditions thus catering to specific national audiences. The paper is written as a tribute to a great mentor...
National Water Model: Providing the Nation with Actionable Water Intelligence
Aggett, G. R.; Bates, B.
2017-12-01
The National Water Model (NWM) provides national, street-level detail of water movement through time and space. Operating hourly, this flood of information offers enormous benefits in the form of water resource management, natural disaster preparedness, and the protection of life and property. The Geo-Intelligence Division at the NOAA National Water Center supplies forecasters and decision-makers with timely, actionable water intelligence through the processing of billions of NWM data points every hour. These datasets include current streamflow estimates, short and medium range streamflow forecasts, and many other ancillary datasets. The sheer amount of NWM data produced yields a dataset too large to allow for direct human comprehension. As such, it is necessary to undergo model data post-processing, filtering, and data ingestion by visualization web apps that make use of cartographic techniques to bring attention to the areas of highest urgency. This poster illustrates NWM output post-processing and cartographic visualization techniques being developed and employed by the Geo-Intelligence Division at the NOAA National Water Center to provide national actionable water intelligence.
National Hydrography Dataset (NHD) - USGS National Map Downloadable Data Collection
U.S. Geological Survey, Department of the Interior — The USGS National Hydrography Dataset (NHD) Downloadable Data Collection from The National Map (TNM) is a comprehensive set of digital spatial data that encodes...
Martínez Gimeno, Elena
2012-01-01
Tesis doctoral inédita realizada en el Laboratorio de Bioquímica Investigación del Instituto de Investigación Sanitaria de la Fundación Jiménez Díaz y leída en la Universidad Autónoma de Madrid. Facultad de Medicina, Departamento de Medicina. Fecha de lectura: 9 de Julio de 2012
Maternal views and experiences regarding repeat Caesarean section
African Journals Online (AJOL)
2014-11-28
Nov 28, 2014 ... Teaching Hospital, P.M.B 5355, Ado‑Ekiti, Ekiti State, Nigeria. E‑mail: tundeolofinbiyi@gmail.com. Introduction. All women with prior cesarean section may not be eligible .... vaginal delivery (14.7%), cost of surgery (5.9%), stress of .... Gredilla E, Pérez Ferrer A, Martínez B, Alonso E, Díez J, Gilsanz F.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
TIMP2 gene polymorphisms are associated with hypertension in patients with myocardial infarction. José Manuel Rodríguez-Pérez Nancy Martínez-Rodríguez Gilberto Vargas-Alarcón Maite Vallejo Irma Eloisa Monroy-Muñoz Carlos Posadas-Romero Eric Kimura-Hayama Teresa Juárez-Cedillo José Manuel Fragoso ...
KM3MeT 2.0 Letter of intent for ARCA and ORCA
Adrián-Martínez, S.; van Haren, H.; KM3NeT Collaboration
2016-01-01
S Adrián-Martínez, M Ageron, F Aharonian, S Aiello, A Albert, F Ameli, E Anassontzis, M Andre, G Androulakis, M Anghinolfi, G Anton, M Ardid, T Avgitas, G Barbarino, E Barbarito, B Baret, J Barrios-Martí, B Belhorma, A Belias, E Berbee, A van den Berg, V Bertin, S Beurthey, V van Beveren, N
La Familia Drug Cartel: Implications for U.S.-Mexican Security
2010-12-01
opponents of their favored standard-bearers from voting. José Vázquez Piedra , the outgoing mayor of Turicato who won a seat in the state legislature...Brother of “La Tuta” Gómez Martínez. At large. Ibarra Piedra , Martín Plaza chief in Parácuaro At large. Peñaloza Soberanes, Alfredo and Antonio
Spanish Minister of Science and Technology visits the LHC magnet test facility
Patrice Loïez
2002-01-01
H.E. Mr Josep Piqué i Camps, Minister of Science and Technology, Spain, visited CERN in November. Here Felix Rodriguez Mateos (right) explains aspects of the test facility to the Minister (left). Between them are M. Aguilar Benitez, Spanish delegate to CERN Council (left), and Francisco Giménez-Reyna, Spanish delegate to the CERN Finance Committee.
Historia de niños en la guerra
Directory of Open Access Journals (Sweden)
Silvia Monroy Alvarez
2012-01-01
Full Text Available Los caminos a la violencia. Vinculación y trayectorias de los niños en los grupos armados ilegales en Colombia. Gustavo Andrade Martínez-Guerra. Universidad de los Andes, Facultad de Ciencias Sociales, Departamento de Ciencias Políticas, Colección Prometeo, Bogotá, 2010, 169 págs.
Regioselectivity in the hetero-Diels–Alder reactions of styrenes with ...
Indian Academy of Sciences (India)
SAFA ALI-ASGARI
Herrera R, Nagarajan A, Morales M A, Méndez F,. Jiménez-Vázquez H A, Gerardo Zepeda L and Tama- riz J 2001 Regio- and Stereoselectivity of Captodative. Olefins in 1,3-Dipolar Cycloadditions. A DFT/HSAB. Theory Rationale for the Observed Regiochemistry of. Nitrones J. Org. Chem. 66 1252. 19. Chattaraj P K, Sarkar ...
Alvaro Garcé García y Santos
2014-01-01
Contenido: introducción. Desde la fundación de Montevideo hasta la inauguración de la cárcel de Miguelete. El surgimiento del sistema carcelario nacional. Juan Carlos Gómez Folle: un noble anhelo reformista. Situación actual. En el papel, como las leyes de Indias. Homenaje al Dr. Carlos Martínez Moreno
DNA-based population density estimation of black bear at northern ...
African Journals Online (AJOL)
UANL
endangered species (Doan-Crider, 1995; Doan-Crider and Hewitt, 2005, Martínez-Muñoz 2001). In Mexico, three of the subspecies of black bear can be found (U. a. amblyceps, U. a. eremicus and U. a. machetes), which are distributed at the north and central regions. Of these, only U. a. eremicus is considered endangered, ...
National Convective Weather Diagnostic
National Oceanic and Atmospheric Administration, Department of Commerce — Current convective hazards identified by the National Convective Weather Detection algorithm. The National Convective Weather Diagnostic (NCWD) is an automatically...
75 FR 39266 - National Protection and Programs Directorate; National Infrastructure Advisory Council
2010-07-08
... Infrastructure Disruptions VII. New Business VIII. Closing Remarks IX. Adjournment Procedural While this meeting... Directorate; National Infrastructure Advisory Council AGENCY: National Protection and Programs Directorate... Infrastructure Advisory Council (NIAC) will meet on Tuesday, July 13, 2010, at the National Press Club's Ballroom...
National Health Interview Survey (NHIS) - National Cardiovascular Disease Surveillance Data
U.S. Department of Health & Human Services — 2001 forward. The National Health Interview Survey (NHIS) has monitored the health of the nation since 1957. NHIS data on a broad range of health topics are...
The tax behavior of taxpayers: literature review
Cruz, Sérgio; Pinto, Catarina; Abrunheiro, Lígia
2014-01-01
O desenvolvimento das sociedades, a crescente educação e consciencialização dos indivíduos acerca dos impostos e medidas fiscais, conduziu a alterações no comportamento dos contribuintes no que diz respeito à perceção e cumprimento fiscal. Recolhendo e sintetizando a literatura existente, efetuámos uma revisão de literatura de forma a perceber quais as variáveis que influenciam os comportamentos dos contribuintes no que respeita ao seu (in)cumprimento e de que forma se manifestam na socied...
Determinantes de la demanda por Educación Superior en cinco regiones de Colombia
Giraldo Giraldo, María Paulina; Pareja Giraldo, Lady Carolina
2014-01-01
Este artículo estudia algunos de los determinantes de la demanda por educación superior en cinco regiones de Colombia -- Se utiliza información de la gran encuesta integrada de hogares (GEIH) para estimar un modelo Logit dicotómico por cada región, haciendo uso de las variables sociales y personales identificadas como determinantes, permitiendo realizar un análisis comparativo entre estos -- Los resultados del estudio sugieren que la edad, el ingreso percápita en los hogares y la educación de...
Reis, Maria José Carraco Patrão dos
2013-01-01
Dissertação de mestrado em Psicologia Clínica e da Saúde (Intervenções Cognitivo-Comportamentais nas Perturbações Psicológicas e de Saúde), apresentada à Faculdade de Psicologia e de Ciências da Educação da Universidade de Coimbra A inflexibilidade relacionada com a imagem corporal é a indisponibilidade para experienciar perceções, sensações, emoções e pensamentos associados à imagem corporal, que decorrem no momento presente, de uma forma completa e intencional, enquanto o indiví...
Andrea Ruzzi Pereira
2015-01-01
OBJETIVOS GERAIS: Avaliar a prevalência de problemas relacionados ao uso de álcool e outras drogas entre estudantes do 8º e 9º anos do ensino fundamental das escolas públicas municipais de Uberaba MG. OBJETIVOS ESPECÍFICOS - descrever e analisar: o estilo parental adotado pelos pais dos adolescentes, de acordo com a percepção do responsável participante; o estilo parental adotado pelos pais e mães, de acordo com a percepção dos adolescentes; a autoestima dos adolescentes; o apoio social perc...
Eduardo José Fernández Ozcorta; Bartolomé Jesús Almagro Torres; Pedro Sáenz - López Buñuel
2015-01-01
El objetivo principal fue analizar la inteligencia emocional percibida y el bienestar psicológico de los estudiantes universitarios en función de la práctica de actividad física. Se utilizó una muestra de 1008 estudiantes de una universidad pública andaluza con edades comprendidas entre los 17 y los 30 años, de los cuales 414 eran físicamente activos y 594 insuficientemente activos. Se emplearon diferentes cuestionarios para evaluar la actividad física habitual, la inteligencia emocional perc...
Dialetical Images in the cinema
Angélica Antonechen Colombo
2013-01-01
This paper aims to discuss cinema as a Work of Art, its main elements, as the image technique, montage and its role as an essential factor of the aesthetic, perceptive and cognitive variation, from the advent and analyzing the Eisenstein’s intellectual montage, based on Walter Benjamin, Vilém Flusser and Christian Metz ’s theory. Discutir o cinema como obra de arte, seus principais elementos, como a imagem técnica, a montagem e o seu papel como fator essencial das variações estéticas, perc...
Matos, Maria Esperança
2016-01-01
O estudo que aqui se apresenta, tem por objetivos compreender as Perceções de Gestão da Qualidade nas IPSS e Caraterizar as Práticas de Gestão da Qualidade nessas Organizações. Participaram neste estudo 13 organizações de diferentes dimensões e formas jurídicas. A metodologia utilizada é a qualitativa, tendo sido recolhidos os dados através da entrevista semiestruturada, entre os meses de Fevereiro e Abril. Os nossos interlocutores são gestores, por entendermos que estes sujeit...
Work engagement: a influência da personalidade e do clima organizacional no engagement
Bento, Cláudia Filipa Pais Henriques
2017-01-01
Dissertação de mestrado em Psicologia Aplicada O engagement tem um papel fulcral nas organizações, caracterizando-se pelo positivismo que os trabalhadores experimentam, determinado pelo vigor, dedicação e absorção. Sendo o clima organizacional a perceção dos colaboradores acerca da organização este irá influenciar o seu comportamento e os seus níveis de engagement traduzindo-se assim na sua produtividade. O presente estudo pretende analisar se as facetas da personalidade dos tr...
ANÁLISIS ESTADÍSTICO DE RESIDUOS SÓLIDOS DOMÉSTICOS EN UN MUNICIPIO FRONTERIZO DE MÉXICO
Paúl A. Taboada-González; Quetzalli Aguilar-Virgen; Sara Ojeda-Benitez
2011-01-01
Este artículo reporta el comportamiento en la generación de residuos en una comunidad urbana (Ensenada) y dos rurales (San Quintín y Vicente Guerrero) en Baja California, México, durante un periodo estacional. Los residuos analizados provenían directamente de los camiones recolectores municipales, tomándose muestras durante una semana. La generación percápita se determinó considerando los residuos recolectados y el número de habitantes; la composición se determinó conforme a la norma NMX-AA-0...
Fuchs, H.V.; Eckoldt, D.
1997-01-01
The invention relates to a false ceiling for buildings which is designed to absorb sound waves and has perforated metal plates, whereby one or several suspended plates are designed so thin that they are capable of vibrating and, together with the hollow cavities above them, form a spring mass system similar to a film absorber, and whereby the lowest metal ceiling has a large number of evenly or unevenly arranged holes with a diameter of 1-3 mm and a hole surface precentage of less than 4 perc...
National Environmental Policy Act
National Oceanic and Atmospheric Administration, Department of Commerce — The National Environmental Policy Act (NEPA) was the first major environmental law in the United States and established national environmental policies for the...
National Wetlands Inventory Polygons
Minnesota Department of Natural Resources — Wetland area features mapped as part of the National Wetlands Inventory (NWI). The National Wetlands Inventory is a national program sponsored by the US Fish and...
Semantic Framing of NATIONALISM in the National Anthems of Egypt and England
Directory of Open Access Journals (Sweden)
Esra' Mustafa
2015-07-01
Full Text Available Every human experience can be conceptually represented in terms of semantic frames. Frames set the major cognitive general aspects of any concept, as well as the contextual variants of such a concept. Being a universal concept, NATIONALISM is central to the human cognition. However, political scientists and dictionary makers differently view it. This study makes use of semantic frame in understanding NATIONALISM as expressed in English and Egyptian national anthems. It aims at capturing the similarities and differences between the anthems in order to render the basic constituents of the frame. It is evident that despite the different scenes represented in each anthem’s frame, NATIONALISM typically actives the frame of people, place, power and principles. The eight national anthems, subject to the analysis, along with a number of political science definitions of NATIONALISM can be contained under this general conceptual frame. The frame interacts with the basics of sociology. Being developed over time and place, NATIONALISM still summons the same frame of a society of people gathered in one place sharing the same principles and governed by the same power. However, the kind of power, place, and principles varies according to the physical scene.
National Intelligence and Personality: Their Relationships and Impact on National Economic Success
Stolarski, Maciej; Zajenkowski, Marcin; Meisenberg, Gerhard
2013-01-01
The relationships between national personality traits and intelligence from 51 countries were examined. It was found that extraversion, openness to experience and agreeableness measured at the national level were significantly and positively correlated with national IQs; however, in the regression model only the former two were marginally…
Federal Laboratory Consortium — For more than 60 years, Sandia has delivered essential science and technology to resolve the nation's most challenging security issues.Sandia National Laboratories...
2013-03-06
...] National Contact Center; Information Collection; National Contact Center Customer Evaluation Survey AGENCY... National Contact Center customer evaluation surveys. In this request, the previously approved surveys have... several months. These temporary surveys will allow the National Contact Center to compare its customer...
Mediated Nationalism: Press Freedom, Mass Media, and Nationalism
2017-12-01
spread propaganda resulted in a positive response by listeners who were predisposed to anti-Semitism and a negative response by those whose prior...2016/jun/11/ david-cameron-brexit-eu-referendum- listen -jeremy-corbyn. 5 Nations with a censored press would likely have denied the expression of...nationalism. Those “who can understand them, or can acquire such comprehension is included in a moral and economic community.”45 He states that “what is