Neutron Decay with PERC: a Progress Report

International Nuclear Information System (INIS)

Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J

2012-01-01

The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.

Protect and Restore Red River Watershed, 2007-2008 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program

2009-05-04

The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).

77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID

Science.gov (United States)

2012-11-15

... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...

Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

Directory of Open Access Journals (Sweden)

Jing Ma

2009-01-01

Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

International Nuclear Information System (INIS)

Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.

2010-01-01

Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

White Sturgeon Management Plan in the Snake River between Lower Granite and Hells Canyon Dams; Nez Perce Tribe, 1997-2005 Final Report.

Energy Technology Data Exchange (ETDEWEB)

Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)

2005-09-01

White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates

Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

2003-03-01

The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

2003-03-01

The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

Juan Ramón Jiménez and Nietzsche

Directory of Open Access Journals (Sweden)

John P. Devlin

1983-01-01

Full Text Available The young Juan Ramón Jiménez shared the enthusiasm for the writings of Nietzsche prevalent among his contemporaries. More significant are the interest in and affinity with Nietzsche which persisted into the poet's maturity. Jiménez found in Nietzsche not only a man of ideas but a poet who claimed to be a potent spiritual force. Both writers held that the modern age could recover a sense of spiritual integrity through the will of the individual to live and interpret human existence as an aesthetic phenomenon. Nietzsche's views on the nature of art and the role of the artist helped to sustain Jiménez' exalted and elitist view of poetry and the poet's mission. Jiménez felt an ethical kinship with the philosopher who asserted the absolute uniqueness of the creative individual, the end of whose existence was self-realization through his art. Nietzsche's doctrine of heroic vitalism as an antidote to chronic spiritual malaise corresponds to Jiménez' revitalized vision of the poetic word proclaimed in the Diario and elaborated in subsequent verse and prose writings.

High precision neutron polarization for PERC

International Nuclear Information System (INIS)

Klauser, C.

2013-01-01

The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de

Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules

Energy Technology Data Exchange (ETDEWEB)

Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)

2017-04-19

The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.

75 FR 28612 - Environmental Impact Statements; Notice of Availability

Science.gov (United States)

2010-05-21

... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...

Personalized Energy Reduction Cyber-Physical System (PERCS): A gamified end-user platform for energy efficiency and demand response.

Energy Technology Data Exchange (ETDEWEB)

Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley

2015-01-01

The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.

Optimization of Rear Local Al-Contacts on High Efficiency Commercial PERC Solar Cells with Dot and Line Openings

Directory of Open Access Journals (Sweden)

Peisheng Liu

2014-01-01

Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.

Plaidoyer pour le lavage de nez dans les pathologies naso ...

African Journals Online (AJOL)

Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

Lower Red River Meadow Stream Restoration Project

International Nuclear Information System (INIS)

1996-05-01

As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream

Coho Salmon Master Plan, Clearwater River Basin.

Energy Technology Data Exchange (ETDEWEB)

Nez Perce Tribe; FishPro

2004-10-01

The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these

The Native American Persistence in Higher Education: A Journey through Story to Identify the Family Support to Native American Graduates

Science.gov (United States)

Bisbee, Yolanda J. Guzman

2013-01-01

This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…

76 FR 44000 - Environmental Impact Statements; Notice of Availability

Science.gov (United States)

2011-07-22

..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...

Cryopreservation of Adult Male Spring and Summer Chinook Salmon Gametes in the Snake River Basin, 1997 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)

1998-06-01

Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.

Trophic structure and mercury biomagnification in tropical fish assemblages, Iténez River, Bolivia.

Directory of Open Access Journals (Sweden)

Marc Pouilly

Full Text Available We examined mercury concentrations in three fish assemblages to estimate biomagnification rates in the Iténez main river, affected by anthropogenic activities, and two unperturbed rivers from the Iténez basin, Bolivian Amazon. Rivers presented low to moderate water mercury concentrations (from 1.25 ng L(-1 to 2.96 ng L(-1 and natural differences in terms of sediment load. Mercury biomagnification rates were confronted to trophic structure depicted by carbon and nitrogen stable isotopes composition (δ(15N; δ(13C of primary trophic sources, invertebrates and fishes. Results showed a slight fish contamination in the Iténez River compared to the unperturbed rivers, with higher mercury concentrations in piscivore species (0.15 µg g(-1 vs. 0.11 µg g(-1 in the unperturbed rivers and a higher biomagnification rate. Trophic structure analysis showed that the higher biomagnification rate in the Iténez River could not be attributed to a longer food chain. Nevertheless, it revealed for the Iténez River a higher contribution of periphyton to the diet of the primary consumers fish species; and more negative δ(13C values for primary trophic sources, invertebrates and fishes that could indicate a higher contribution of methanotrophic bacteria. These two factors may enhance methylation and methyl mercury transfer in the food web and thus, alternatively or complementarily to the impact of the anthropogenic activities, may explain mercury differences observed in fishes from the Iténez River in comparison to the two other rivers.

Universal Prevention Program Outcomes: Safe Schools Healthy Students in a Rural, Multicultural Setting

Science.gov (United States)

Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana

2007-01-01

The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…

Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.

Energy Technology Data Exchange (ETDEWEB)

Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.

2000-04-01

Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in

Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)

1999-03-01

Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.

Optimization of Controllable Factors in the Aluminum Silicon Eutectic Paste and Rear Silicon Nitride Mono-Passivation Layer of PERC Solar Cells

Science.gov (United States)

Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook

2018-05-01

Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.

Aurelio Martínez Mutis

Directory of Open Access Journals (Sweden)

Rafaél Maya

1979-10-01

Full Text Available La aparición de Aurelio Martínez Mutis en el escenario de las letras colombianas, hace unos treinta y cinco años, más o menos, fue súbita y fulgurante. Su "Epopeya del Cóndor", poesía premiada en el concurso abierto por la revista Mundial, que dirigía en París Rubén Darío, lo hizo célebre, de la noche a la mañana, entre los pueblos de habla hispana.

A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor

OpenAIRE

Sousa, Vasco Monteiro Carvalho de

2016-01-01

O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...

José Miguel Jiménez receives Order of Alfonso X the Wise

CERN Multimedia

CERN Bulletin

2016-01-01

On 12 July 2016, José Miguel Jiménez, Head of CERN Technology Department, has been awarded a spanish civil decoration — an encomienda — of the Order of Alfonso X the Wise (see here), for his outstanding experience in the field of research and scientific management in particle physics.   The ceremony took place at the National Library of Spain, in Madrid, on 12 July. From left: Marcial Marín Hellín, Secretary of State for Education, Professional training and Universities; José María Lassalle Ruiz, Secretary of State for Culture; Íñigo Méndez de Vigo y Montojo, Ministry of Education, Culture and Sport; José Miguel Jiménez, Head of CERN Technology Department; Carmen Vela Olmo, Secretary of State for Investigation, Development and Innovation. (Photo: ©Javier Martínez de la Torre, M...

PERC 2 High-End Computer System Performance: Scalable Science and Engineering

Energy Technology Data Exchange (ETDEWEB)

Daniel Reed

2006-10-15

During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.

Review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)

DEFF Research Database (Denmark)

Jensen, Kim Ebensgaard

2014-01-01

A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)......A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)...

Simulation Tools for Forest Health Analysis: An Application in the Red River Watershed, Idaho

Science.gov (United States)

Andrew J. McMahan; Eric L. Smith

2006-01-01

Software tools for landscape analyses--including FVS model extensions, and a number of FVS-related pre- and post-processing “tools”--are presented, using an analysis in the Red River Watershed, Nez Perce National Forest as an example. We present (1) a discussion of pre-simulation data analysis; (2) the Physiographic Information Extraction System (PIES), a tool that can...

Fish Passage Assessment: Big Canyon Creek Watershed, Technical Report 2004.

Energy Technology Data Exchange (ETDEWEB)

Christian, Richard

2004-02-01

This report presents the results of the fish passage assessment as outlined as part of the Protect and Restore the Big Canyon Creek Watershed project as detailed in the CY2003 Statement of Work (SOW). As part of the Northwest Power Planning Council's Columbia Basin Fish and Wildlife Program (FWP), this project is one of Bonneville Power Administration's (BPA) many efforts at off-site mitigation for damage to salmon and steelhead runs, their migration, and wildlife habitat caused by the construction and operation of federal hydroelectric dams on the Columbia River and its tributaries. The proposed restoration activities within the Big Canyon Creek watershed follow the watershed restoration approach mandated by the Fisheries and Watershed Program. Nez Perce Tribal Fisheries/Watershed Program vision focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects. We strive toward maximizing historic ecosystem productive health, for the restoration of anadromous and resident fish populations. The Nez Perce Tribal Fisheries/Watershed Program (NPTFWP) sponsors the Protect and Restore the Big Canyon Creek Watershed project. The NPTFWP has the authority to allocate funds under the provisions set forth in their contract with BPA. In the state of Idaho vast numbers of relatively small obstructions, such as road culverts, block thousands of miles of habitat suitable for a variety of fish species. To date, most agencies and land managers have not had sufficient, quantifiable data to adequately address these barrier sites. The ultimate objective of this comprehensive inventory and assessment was to identify all barrier crossings within the watershed. The barriers were then prioritized according to the

El Profesor Académico, Dr. Pablo Gómez Martínez.

Directory of Open Access Journals (Sweden)

Zoilo Cuéllar-Montoya

2007-12-01

Más adelante, en la misma Presidencia de la Academia del Profesor Pedro José Almánzar Vargas (1963 – 1965, fue promovido Gómez Martínez a la categoría de Miembro de Número(2,10 con el trabajo “Ilio-cisto-plastia con colgajo sero-muscular invertido y reconstrucción de vejigas funcionales” (2,11. En la sesión ordinaria de la Academia del día 12 de marzo de 1964, el Académico Correspondiente Gómez Martínez presentó el trabajo mencionado(2,12 y, en la sesión ordinaria del día 14 de mayo de 1964, en virtud de haber quedado vacantes las sillas de los Señores Académicos de Número Jaime Jaramillo Arango, fallecido en Bogotá, el 31 de julio de 1962(2,13, Manuel José Luque Guevara, retirado por precarias condiciones de salud(2,14, y Fernando Torres Restrepo, trasladado definitivamente a los Estados Unidos(2,15, la Academia, en votación secreta, eligió, como Miembros de Número, a los Señores Académicos Correspondientes Pablo Gómez Martínez, Alfredo Artunduaga y J. Hernando Hernández Garay(2,16...

Red River Stream Improvement Final Design Nez Perce National Forest.

Energy Technology Data Exchange (ETDEWEB)

Watershed Consulting, LLC

2007-03-15

This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.

South Fork Salmon River Watershed Restoration, 2008-2009 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Reaney, Mark D. [Nez Perce Tribe Department of Fisheries Resource Management

2009-04-15

The watershed restoration work elements within the project area, the South Fork Salmon River Watershed, follow the watershed restoration approach adopted by the Nez Perce Tribe Department of Fisheries Resource Management (DFRM) - Watershed Division. The vision of the Nez Perce Tribe DFRM-Watershed Division focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects and strategies that rely on natural fish production and healthy river ecosystems. The Nez Perce Tribe DFRM-Watershed Division strives towards maximizing historic ecosystem productivity and health for the restoration of anadromous and resident fish populations and the habitat on which all depend on for future generations Originally, this project was funded to create a step/pool stream channel that was appropriate to restore fish passage where the 'Glory Hole Cascade' is currently located at the Stibnite Mine. Due to unforeseen circumstances at the time, the project is unable to move forward as planned and a request for a change in scope of the project and an expansion of the geographic area in which to complete project work was submitted. No additional funds were being requested. The ultimate goal of this project is to work with the holistic, ridge top to ridge top approach to protect and restore the ecological and biological functions of the South Fork Salmon River Watershed to assist in the recovery of threatened and endangered anadromous and resident fish species. FY 2008 Work Elements included two aquatic organism passage (AOP) projects to restore habitat connectivity to two fish-bearing tributaries to the East Fork South Fork Salmon River, Salt and Profile Creeks. The Work Elements also included road survey and assessment

Genetic diversity and conservation of Picea chihuahuana Martínez ...

African Journals Online (AJOL)

SAM

2014-07-09

Jul 9, 2014 ... individuals within a population and among populations within a species. Hence ... risks related to loss of species, populations and genetic resources; c) ... this spruce and two other congeners, Picea mexicana. Martínez and Picea .... high levels of self-fertilization and mating between closely related ...

Loyola University distingue al Ing. Martínez

OpenAIRE

Lezcano, Liseth

2011-01-01

El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.

Genetic diversity and conservation of Picea chihuahuana Martínez ...

African Journals Online (AJOL)

The conservation of genetic diversity in tree populations is an essential component of sustainable forest management. Picea chihuahuana Martínez is an endemic conifer species in Mexico and is considered to be endangered. P. chihuahuana covers a total area of no more than 300 ha at the Sierra Madre Occidental, ...

Več kot predgovor: "urednik" Pepite Jiménez:

OpenAIRE

Fock, Ignac

2014-01-01

The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) "editor". Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator - ficti...

Controversy, Conflict and Compromise: A History of the Lower Snake River Development

Science.gov (United States)

1994-01-01

river, farmers cultivated the loess-covered hills, and ranchers grazed sheep and cattle in the Channeled Scablands. Towns grew up to serve the...North America, the Nez Perce and Palouse practiced selective breeding. They castrated poorer stallions and traded inferior stock to neighboring...rains," making it impossible for "some kinds of grain [to] flourish," he noted that cattle and horses grew fat on the rich bunchgrass, and, like Lewis

Tropic and race. Miguel Jiménez López and the Japanese Immigration in Colombia, 1920-1929

Directory of Open Access Journals (Sweden)

Abel Fernando Martínez Martín

2017-01-01

Full Text Available This article discusses the debate on immigration in Colombia, specifically focusing on Japanese immigration, an problem, by being so far from the desired European immigration. Likewise, the important role played by the psychiatrist and conservative Colombian politician Miguel Jiménez Lopez and his theory of degeneration of the Colombian race. Jiménez Lopez is the author of "The yellow immigration in the America", a publication of the National Academy of Medicine, written in response to the Ministry of Industries about the question for the possible impact of a Japanese immigration in the eastern plains. Jiménez Lopez maintains the problem from medicalization and biology, using more arguments from geographical determinism and racism that from eugenics, to justify that a Japanese immigration to Colombia was not advisable, because it jeopardizes the progressive bleaching managed —with the passage of time— by the Colombian race.

The 'Mini-Perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath: 3-year results in 72 patients

International Nuclear Information System (INIS)

Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo

2006-01-01

To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi

Review of García, Jiménez & Martínez (2010 Guía para incorporar la perspectiva de género a la investigación en salud

Directory of Open Access Journals (Sweden)

Teresa Cabruja-Ubach

2014-12-01

Full Text Available Se trata de una reseña de la “Guía para incorporar la perspectiva de género a la investigación en salud” de María del Mar García Calvente ,  María Luisa Jiménez rodrigo y Emilia Martínez Morante, de la Escuela Andaluza de Salud Pública, 2010, que consiste en un documento de ayuda a la investigación en salud pues a partir de exponer los sesgos androcéntricos y patriarcales de la investigación en salud, organiza un sistema de buenas prácticas para cada uno de los pasos en el proceso de investigación. Trabajo muy riguroso e indispensable para colaborar en una investigación y atención en la salud más justa e igualitaria.

Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

Directory of Open Access Journals (Sweden)

Elisa Kern de Castro

2015-07-01

Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.

Las “Historias ilustrativas de la violencia” de Edilberto Jiménez: narrativa, testimonio y memoria

Directory of Open Access Journals (Sweden)

Elisa Cairati

2013-06-01

Full Text Available This work aims to analyse the cultural contents and aesthetic position of Edilberto Jiménez Quispe’s illustrations of the age of violence, presented in Chungui: violencia y trazos de memoria (Lima, 2009. Jiménez, through the plastic and figurative traditional style, makes public the concealed and denied memory of the Internal Armed Conflict. The combination of testimonies and paintings is concerned as an emotional significance of memory: a space of re-established dialogue after the age of violence, in the direction of the elaboration of identity in the region of Ayacucho.

Martínez Sanabria en un país de artesanos

OpenAIRE

Jimena Montaña Cuéllar

2011-01-01

De la arquitectura orgánica a la arquitectura del lugar en las casas Wilkie (1962) y Calderón (1963) de Fernando Martínez Sanabria. Germán Darío Rodríguez Botero. Universidad Nacional de Colombia (Sede Bogotá), Facultad de Artes, Colección Punto aparte, Bogotá, 2007, 232 págs.

Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

OpenAIRE

Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin

2015-01-01

ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...

Impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física

Directory of Open Access Journals (Sweden)

Diego Augusto Santos Silva

2012-06-01

Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.

The PERC trademark process: Existing and potential applications for induction coupled plasma technology in hazardous and radioactive waste treatment

International Nuclear Information System (INIS)

Blutke, A.S.; Vavruska, J.S.; Serino, J.F.

1996-01-01

Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment

Lago artificial de Martiánez Canarias – España

Directory of Open Access Journals (Sweden)

Amigó, Juan A.

1980-06-01

Full Text Available In this article a technical description is given of the works of the Artificial Lake of Martiánez. This work that was executed after gaining some 33,000 m² from the sea mainly consisted of creating a small artificial lake of seawater surrounded by solariums, beaches and gardens. Inside the lake — that has an area of some 15,000 m² — five natural islands were formed, most of which have tourist complexes built on them, consisting of: night club, restaurants, bars, terraces, etc.

En este artículo se hace una descripción técnica de las obras del Lago Artificial de Martiánez. Esta obra, realizada tras ganar al mar unos 33.000 m² consistió, principalmente, en la creación de un pequeño lago artificial de agua de mar rodeado de solarios, playas y jardines. En el interior del lago —cuya superficie es de unos 15.000 m²— se formaron cinco islas naturales, en la mayor de las cuales se construyó un complejo turístico que consta de: sala de fiestas, restaurantes, bares, terrazas, etc.

Libertad e inconformismo: sobre la concepción del relato de José Jiménez Lozano

Directory of Open Access Journals (Sweden)

Moreno González, Santiago

2010-12-01

Full Text Available José Jiménez Lozano is a unique writer in the Hispanic literary scene of these last decades. His work is vast and diverse, and this initial observation does not escape his narrative, which genre the write demonstrates more prolifically. Despite the apparent diversity, there is outstanding unity underlying Jiménez Lozano´s entire work. This unity lies not only on the constant return to the same matters, but also on the approaches or the reasons, from which his literary work begins. The writer reflects over his work and lets his ideas expand through the diverse manifestations of his ideas on prose. It is a talk about the rhetorical writing of this article, valuing the coherent existence between reflection and literary practice.José Jiménez Lozano es un escritor singular dentro del panorama literario hispánico de las últimas décadas. Su obra es vasta y diversa y a esta observación inicial no escapa su narrativa, género en el que el escritor se muestra más prolífico. A pesar de la diversidad aparente, existe una notable unidad subyacente a toda la obra de Jiménez Lozano. Esta unidad reposa no sólo sobre el regreso constante a unos mismos asuntos sino también sobre los planteamientos o fundamentos de los que parte su creación literaria. El escritor reflexiona sobre su labor y deja diseminado, a través de las diversas manifestaciones de su prosa de ideas, un discurso sobre la escritura que este artículo sintetiza, valorando, asimismo, la coherencia existente entre esta reflexión y la praxis literaria.

El acontecimiento en el cuento: nueva lectura de José Jiménez Lozano

OpenAIRE

Martínez-Illán, A. (Antonio)

2010-01-01

Se reseña un libro que estudia como un todo los cuentos de Jiménez Lozano publicados hasta la fecha (y, en particular, La Piel de los tomates) a la luz de una teoría del cuento desde la categoría del acontecimiento.

Big Canyon Creek Ecological Restoration Strategy.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn; Richardson, Shannon

2007-10-01

He-yey, Nez Perce for steelhead or rainbow trout (Oncorhynchus mykiss), are a culturally and ecologically significant resource within the Big Canyon Creek watershed; they are also part of the federally listed Snake River Basin Steelhead DPS. The majority of the Big Canyon Creek drainage is considered critical habitat for that DPS as well as for the federally listed Snake River fall chinook (Oncorhynchus tshawytscha) ESU. The Nez Perce Soil and Water Conservation District (District) and the Nez Perce Tribe Department of Fisheries Resources Management-Watershed (Tribe), in an effort to support the continued existence of these and other aquatic species, have developed this document to direct funding toward priority restoration projects in priority areas for the Big Canyon Creek watershed. In order to achieve this, the District and the Tribe: (1) Developed a working group and technical team composed of managers from a variety of stakeholders within the basin; (2) Established geographically distinct sub-watershed areas called Assessment Units (AUs); (3) Created a prioritization framework for the AUs and prioritized them; and (4) Developed treatment strategies to utilize within the prioritized AUs. Assessment Units were delineated by significant shifts in sampled juvenile O. mykiss (steelhead/rainbow trout) densities, which were found to fall at fish passage barriers. The prioritization framework considered four aspects critical to determining the relative importance of performing restoration in a certain area: density of critical fish species, physical condition of the AU, water quantity, and water quality. It was established, through vigorous data analysis within these four areas, that the geographic priority areas for restoration within the Big Canyon Creek watershed are Big Canyon Creek from stream km 45.5 to the headwaters, Little Canyon from km 15 to 30, the mainstem corridors of Big Canyon (mouth to 7km) and Little Canyon (mouth to 7km). The District and the Tribe

Production of high titer attenuated poliovirus strains on the serum-free PER.C6(®) cell culture platform for the generation of safe and affordable next generation IPV.

Science.gov (United States)

Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana

2015-11-27

As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and

La historieta como transmisora de ideología: España Una, Grande y Libre (Carlos Giménez = Comic-strip in transmitting ideology: España Una, Grande y Libre (Carlos Giménez

Directory of Open Access Journals (Sweden)

Armiche Carrillo Delgado

2015-06-01

Full Text Available Aunque tradicionalmente se consideró a los cómics como un simple entretenimiento juvenil, lo cierto es que en realidad constituyen una herramienta para la transmisión de concepciones ideológicas y valores. A través del análisis de la obra de Carlos Giménez, publicada en El Papus, veremos como la historieta es perfectamente capaz de convertirse en una forma de lucha ideológica.Although traditionally considered to comics as a mere youth entertainment, the truth is that actually constitute a tool for the transmission of values and ideological concepts. Through the analysis of the work of Carlos Giménez, published in El Papus, we see how the comic-strip is perfectly capable of becoming a form of ideological struggle.

CERT tribal internship program. Final intern report: David Conrad, 1993

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-09-01

The intern`s report contains a Master`s thesis entitled, ``An implementation analysis of the US Department of Energy`s American Indian policy as part of its environmental restoration and waste management mission.`` This thesis examines the implementation of a working relationship between the Nez Perce Tribe and the US Department of Energy`s Office of Environmental Restoration and Waste Management at the Hanford reservation. It examines the relationship using a qualitative methodology and three generations of policy analysis literature to gain a clear understanding of the potential for successful implementation.

Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634

Directory of Open Access Journals (Sweden)

Coello de la Rosa, Alexandre

2009-06-01

Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.

Synthetic virus seeds for improved vaccine safety: Genetic reconstruction of poliovirus seeds for a PER.C6 cell based inactivated poliovirus vaccine.

Science.gov (United States)

Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V

2015-10-13

Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.

“Todo lo que sigue es sencillamente estupendo”. Escritoras en las cartas de Ezequiel Martínez Estrada a Victoria Ocampo

Directory of Open Access Journals (Sweden)

Tania Diz

2016-11-01

Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.

More than a Preface: the »Editor« of Pepita Jiménez

OpenAIRE

Ignac Fock

2014-01-01

The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) “editor”. Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator – ficti...

78 FR 24718 - Nez Perce-Clearwater National Forests; Idaho; Lolo Insect & Disease Project

Science.gov (United States)

2013-04-26

... Lolo Creek watershed. A total of 500 miles occurs within designated PACFISH buffers. Desired Condition... or displaced soil or loss of organic matter. Desired Condition: Soils are productive (functioning... riparian habitat conservation areas. Deferred maintenance opportunities (such as any needed reconstruction...

Treatment of moderate hallux valgus by percutaneous, extra-articular reverse-L Chevron (PERC) osteotomy.

Science.gov (United States)

Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O

2016-03-01

The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.

The philologist Pedro Martínez López: an imaginative liberal lampoonist | El filólogo Pedro Martínez López: un libelista liberal imaginativo

Directory of Open Access Journals (Sweden)

Aline Vauchelle-Haquet

2006-12-01

Full Text Available In 1830, the philologist Pedro Martínez López was forced to go into exile in France for political reasons. In 1832, he published Representación a Fernando VII, rey de España, a lampoon in which he made a whole string of accusations against the tyrant. At the end of the following year, he published España en 1833, al expirar Fernando VII, another lampoon in which he blamed the king's despotic reign for the country's disastrous situation and asserted that such abuses and injustices could only be remedied by re-establishing the Constitution of Cádiz of 1812. In 1834, he ceased to rail against his political enemies, changed strategy, and using his considerable imagination, wrote a kind of fable entitled Una noche en el infierno, vista entre sueños. With a mixture of humour and acid wit, it told of how all the devils in the Kingdom of Darkness, embracing the «sacred» cause of liberalism, vented their anger on the deceased Ferdinand and his followers, who were still in power. It would appear that the work was a success, since it was republished in 1836. In 1835, disillusioned with the tepid and conservative liberal regime of the Estatuto Real, Martínez López wrote another story, Las Brujas en Zugarramurdi, in which different satanic creatures, this time sorceresses, take it upon themselves to defeat moderantismo and establish a progressive regime. After this, he ceased to publish lampoons and political parables and devoted himself to producing learned works, bringing out various dictionaries and grammars which were republished several times. | En 1830, el filólogo Pedro Martínez López tuvo que exiliarse a Francia por motivos políticos. En 1832, sacó a luz en Burdeos una Representación a Fernando VII, rey de España, panfleto en el que espetaba toda una sarta de acusaciones contra el tirano. A finales del año siguiente, publicó La España en 1833, al expirar Fernando VII, otro libelo en que responsabilizaba al despotismo de la

New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856

Directory of Open Access Journals (Sweden)

José Manuel Izquierdo König

2017-07-01

Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.

La influencia de Javier Marías en la traducción española de Martínez-Lage de Absalom, Absalom!

OpenAIRE

Alpuente Civera, Miguel; Marco Borillo, Josep; Martínez Vilinsky, Bárbara

2013-01-01

En el posfacio a su traducción de Absalom, Absalom!, Miguel Martínez-Lage declara haber tomado como «modelos estilísticos» a aquellos narradores en lengua española cuya prosa muestra sin lugar a dudas la influencia de Faulkner. En el presente artículo nos proponemos identificar, en primer lugar, los rasgos de estilo comunes a la traducción de Martínez-Lage y a uno de los modelos estilísticos mencionados –la novela Fiebre y lanza, de Javier Marías– y, en segundo lugar, los aspectos de la tradu...

Vida y obra de Luis Jiménez Moreno (1929-2007

Directory of Open Access Journals (Sweden)

Antonio Jiménez García

2008-10-01

Full Text Available Luis Jiménez Moreno passed away on 27 of October, 2007, 77 years old. For the last 30 years he was professor at Universidad Complutense de Madrid. He became Full Professor. He had studied in Salamanca, Roma, Valencia and München. He got a Ph. Degree whith a tesis about Nietzsche`s Antropological Thought by leading of José Luis López Aranguren. He was High School Teacher in Andujar, Ávila and Badalona; after he was professor at Universities of Barcelona and Madrid. This article develops information about his life and his works: books, articles, essays, conferences, papers to Congress, Symposios, Scientic meetings…

Realismo, margen y fragmentariedad en la narrativa de Ezequiel Martínez Estrada

OpenAIRE

Gasillón, María Lourdes

2012-01-01

En primer lugar, este trabajo intenta analizar los ensayos escritos por Ezequiel Martínez Estrada sobre Franz Kafka (1967) para luego reconocer sus influencias en el concepto de lo real y realismo en sus propias narraciones ficcionales. En este caso, se abordará uno de sus cuentos más conocidos, “Marta Riquelme”, que construye discursivamente una imagen de lo/s otro/s en distintos planos textuales: autor, narrador, organización, género, personajes, etc. Tanto el ensayista argentino como el es...

FACETS OF THE ICONOGRAPHY OF DON JUAN MARTÍNEZ SILÍCEO, ARCHBISHOP OF TOLEDO = ALGUNOS ASPECTOS EN TORNO A LA ICONOGRAFÍA DEL ARZOBISPO DE TOLEDO DON JUAN MARTÍNEZ SILÍCEO

Directory of Open Access Journals (Sweden)

María Alegra García García

2014-02-01

Full Text Available Juan Martínez Siliceo (c. 1477-1557 was a Roman Catholic cardinal and archbishop and a distinguished humanist and mathematician who played an important role in the History and culture of Toledo and Spain during the 16th century. Furthermore, he was admired and recognized even after his death thanks to different literary sources and historiography. This article aims to approach his iconography through a selection of the most important literary and artistic sources from the 16th and 17th Centuries.Juan Martínez Silíceo (c.1477-1557, además de cardenal y arzobispo de Toledo, fue un importante humanista y matemático que desempeñó un destacado papel en la historia y cultura del Toledo y la España del siglo XVI y que gozó de gran admiración y reconocimiento más allá de su muerte, tal como evidencian las fuentes literarias y la historiografía posterior. Sin embargo, aún quedan pendientes de estudio pormenorizado algunos aspectos relativos a su relación con las artes. Este artículo pretende plantear un primer acercamiento a la iconografía de Silíceo a través de una selección de las fuentes literarias y visuales de los siglos XVI al XVIII consideradas más relevantes.

Enfermedad y muerte de Don Gonzalo Jiménez de Quesada

Directory of Open Access Journals (Sweden)

Fernando Serpa Florez

1997-12-01

Full Text Available

La lepra es una enfermedad que se caracteriza por la insidia de su presencia, su lenta evolución y la progresiva incapacidad que en sus víctimas causa.

Esto y el temor que ha infundido desde tiempos bíblicos, han hecho que ante ella se haya mantenido una actitud ambivalente de negación hasta donde es posible y de rechazo irracional a quien la padece, por temor al contagio.

Ejemplo de ello es el aura de sagrado misterio que envuelve la leyenda de los padecimientos del Adelantado don Gonzalo Jiménez de Quesada (1509-1579, conquistador del Nuevo Reino de Granada y fundador de Santafé de Bogotá en el año de 1538, muerto a la edad, avanzada para la época, de setenta años.

No se puede afirmar, en forma definitiva, que el conquistador fuera leproso. Se acepta, acogiendo el argumento de autoridad que tiene el primer historiador médico entre nosotros, don Pedro María Ibáñez, quien escribió en 1884, en las Memorias para la Historia de la Medicina en Santa Fe, que en “1579 falleció en la ciudad de Mariquita, y de mal de lepra o elefancía de los

Coincide ello con lo que consigna don José María Vergara y Vergara en su Cuadro Cronológico de la Nueva Granada (hoi Estados Unidos de Colombia, desde los cipas hasta nuestros días (se ha conservado la ortografía usada a mediados del siglo XIX, preconizada por don Andrés Bello, estudio publicado en 1866, en que informa que a poco de posesionarse el tercer Presidente del Nuevo Reino, don Lope Díez Aux de Armendáriz: “ocurrió la muerte del adelantado Gonzalo Jiménez de Quesada que tuvo lugar en Mariquita el 16 de febrero de 1579, a la edad de ochenta años no cumplidos (sic, i de enfermedad de lepra (…” (2.

Estos conceptos fueron debatidos por contemporáneos de Vergara y de Ibáñez como el doctor Juan de Dios Carrasquilla aduciendo, entre otros argumentos, que la lepra no fue mencionada por los coetáneos del conquistador. Y que la sífilis, com

Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms.

Science.gov (United States)

Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João

2017-10-01

Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

Salmon and the Adaptive Capacity of Nimiipuu (Nez Perce) Culture to Cope with Change

Science.gov (United States)

Colombi, Benedict J.

2012-01-01

Change due to natural disturbances and disasters, population growth and decline, economic crises, and environmental and climate change creates significant cultural challenges. Rapid change and the transformation it brings also involve complex relationships between sovereign tribes, resources, and the global system. This article explores how salmon…

78 FR 9029 - Nez Perce-Clearwater National Forests; ID; Clear Creek Integrated Restoration Project

Science.gov (United States)

2013-02-07

.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and..., and big game species. Fire dependent wildlife species would benefit from landscape burning. Watershed...

77 FR 9621 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-02-17

.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and... mammals, and big game species. Fire dependent wildlife species would benefit from landscape burning...

77 FR 775 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-01-06

.... Shifting tree species composition by retaining and planting early seral species (i.e. ponderosa pine... such as insect, disease, and fire. Historical logging practices and fire suppression have created a... habitats by retaining large trees and promoting establishment of tall shrubs and hardwood tree by using...

77 FR 6778 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-02-09

... patterns that more closely emulate natural mixed severity disturbance. Shifting tree species composition by... logging practices and fire suppression have created a landscape that is more highly fragmented than what... management would increase high quality early seral wildlife habitats by retaining large trees and promoting...

Trayectos de lectura de Espacio, de Juan Ramón Jiménez

OpenAIRE

Luján Atienza, Ángel Luis

2013-01-01

El estudio de Espacio, de Juan Ramón Jiménez, a partir de la teoría cognitiva de las metáforas conceptuales y la fusión de dominios conceptuales (blending), en confluencia con la filosofía heideggeriana, descubre en el poema dos movimientos contradictorios: el de la fuga y de la búsqueda de un centro, que se pueden poner en relación con dos trayectos de lectura y dos tendencias hermenéuticas: la modernista y la post-modernista. En este contexto se tratan de explicar las paradojas y complejida...

Leoncio Martínez Un personaje que marcó pauta en la disidencia

OpenAIRE

Omaira Zambrano Roa

2014-01-01

Cuando se analiza la historia política de un país, se observa énfasis en el estudio de sus períodos gubernamentales y en sus partidos políticos, en los cuales existen personajes que marcaron pauta en su desarrollo de la Nación. Durante la dictadura del general Juan Vicente Gómez (1908-1935)  uno de estos personajes característicos fue Leoncio Martínez, quien ostenta entre sus labores más conocidas la fundación del semanario humorístico Fantoches junto a Francisco Pimentel (Job Pim). En el año...

Perceções de carreira e de sucesso em função do género

OpenAIRE

Tocalino, Renata Leone Pio Galveia

2013-01-01

Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...

Joaquín Ruiz-Giménez, the Catholic exemplar: notes for a political and intellectual biography up to 1963 | Joaquín Ruiz-Giménez o el católico total: apuntes para una biografía política e intelectual hasta 1963

Directory of Open Access Journals (Sweden)

Javier Muñoz Soro

2006-12-01

Full Text Available The biography of Joaquín Ruiz-Giménez is a virtual paradigm of two historical phenomena which distinguished the last two decades of the Franco regime and, to a large extent, paved the way for the future democracy: on the one hand, the rift between Catholic and Falangist intellectuals and the regime which they had enthusiastically helped to establish after the civil war; and on the other, the secularization of its political thinking and practice. Ruíz-Giménez, ambassador and minister under Franco, was an exception among the Catholic laity that collaborated with the dictatorship, in that he held high government positions and, despite all the reservations concerning his personal development, for many of his peers as well as many aspiring figures of the coming generations, he symbolized the definitive renunciation of all legitimacy of power based on victory in battle or on Catholic natural law, and the definitive adoption of the language of human rights and democracy. | La biografía de Joaquín Ruiz-Giménez representa casi de manera paradigmática dos fenómenos históricos que caracterizaron las dos últimas décadas del franquismo y sentaron, en buena medida las bases de la futura democracia: por un lado, el alejamiento de los intelectuales católicos y falangistas respecto al régimen que habían contribuido a levantar con entusiasmo tras la guerra civil; por otro, la secularización de su pensamiento y práctica política. Ruiz-Giménez, embajador y ministro de Franco, fue una excepción entre los seglares católicos que colaboraron con la dictadura desempeñando altas responsabilidades de gobierno y, pese a todas las cautelas de su evolución personal, simbolizó para bastantes compañeros de su generación, así como para muchos jóvenes alumnos de las nuevas generaciones, la renuncia definitiva a toda legitimación del poder basada en la victoria de las armas o en el iusnaturalismo católico y la adopción irreversible del lenguaje de

An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons

International Nuclear Information System (INIS)

Tano, M.L.; Powankee, D.; Lester, A.D.

1995-01-01

The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)

Fall Chinook Salmon Survival and Supplementation Studies in the Snake River Reservoirs, 1996 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Williams, John G.; Bjornn (Bjomn), Theodore C.

1998-05-01

In 1996, the National Marine Fisheries Service, the Nez Perce Tribe, and the U.S. Fish and Wildlife Service completed the second year of cooperative research to investigate migrational characteristics of subyearling fall chinook salmon in the Snake River Basin. In spring and early summer, we captured natural subyearling fall chinook salmon by beach seine, PIT tagged them, and released them in two reaches of the Snake River. Also, subyearling fall chinook salmon reared at Lyons Ferry Hatchery were PIT tagged at the hatchery, transported, and released weekly at Pittsburg Landing on the Snake River and Big Canyon Creek on the Clearwater River to collect data on survival detection probabilities, and travel time.

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River: March 1, 1994--June 15, 1994; TOPICAL

International Nuclear Information System (INIS)

Ashe, B.L.; Miller, A.C.; Kucera, P.A.; Blenden, M.L.

1995-01-01

In 1994, the Nez Perce Tribe began a smolt monitoring study on the Imnaha River in cooperation with the Fish Passage Center (FPC). A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from March 1 to June 15, 1994. We PIT tagged and released 956 wild chinook salmon, 661 hatchery chinook salmon, 1,432 wild steelhead trout and 2,029 hatchery steelhead trout. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 62.2% for wild chinook salmon, 45.2% for hatchery chinook salmon, 51.3% for wild steelhead trout, and 34.3% for hatchery steelhead trout

Ces silences de la narration qui rapprochèrent Jean Giono et Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Dominique Bonnet

2010-01-01

Full Text Available This article intends to show how JeanGiono discovered a purity of writing inJuan Ramón Jiménez that he practicedhimself in his elliptical narratives. Thus,this purifying desire that both sought intheir writings would be one of the commonpoints that would persuade Jean Giono todo the film adaptation of Platero y yo.

En memoria de Michael Jiménez (1948-2001

Directory of Open Access Journals (Sweden)

Mauricio Archila Neira

2001-01-01

Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.

El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda

Directory of Open Access Journals (Sweden)

Calvo López, José

2009-03-01

Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16^th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.

El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.

Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms

Directory of Open Access Journals (Sweden)

Michael J. Drescher

2017-09-01

Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

Perceção dos pais em relação à inclusão de crianças com Necessidades Educativas Especiais no ensino regular

Directory of Open Access Journals (Sweden)

Elisabete Matos Freitas

2015-05-01

Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.

Literatura y realidad histórica. Un reencuentro con Ezequiel Martínez Estrada y su interpretación del Martín Fierro

Directory of Open Access Journals (Sweden)

Amán Rosales Rodríguez

2010-01-01

Full Text Available The purpose of this paper is to critically review some of the main theoretical tenets in Ezequiel Martínez Estrada’s pessimistic stance about the Argentinean history and society of his time. Focusing on his critical remarks about the so-called «literatura o poesía gauchesca» as well as on his enthusiastic assessment of José Hernández’ Martín Fierro, the achievements and missing points in Martínez Estrada’s skeptical diagnosis will be underlined and put in broader philosophical context. For the Argentinean writer the controversial notion of a “superimposed reality” – as he infers its existence from the Martín Fierro – captures a kind of ambivalent metaphysical concurrence among the literary creation, the geographical setting and the sociopolitical state of the country.

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-04-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996; ANNUAL

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-01-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

La presidencia de María Estela Martínez de Perón : la búsqueda de legitimidad y la descalificación del “otro” (1974-1976)

OpenAIRE

Napal, María Celeste

2016-01-01

Napal, M. C. (2016). La presidencia de María Estela Martínez de Perón: la búsqueda de legitimidad y la descalificación del “otro” (1974-1976). Divulgatio, 1(1). El presente artículo busca analizar, a través de los discursos presidenciales, la imagen que la presidente María Estela Martínez de Perón (Isabel) construye del “otro” no partidario en un contexto político en el que se ve cuestionada su propia legitimidad. Partimos de la idea de que el período de su presidencia (1° de julio de 1974...

El Retrato de la última hija de Juan Bautista Martínez del Mazo, boceto para el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena

Directory of Open Access Journals (Sweden)

Gutiérrez Pastor, Ismael

2005-09-01

Full Text Available Por adquisición en el comercio de antigüedades francés se conserva en una colección particular de Bilbao el Retrato de una niña (fig. 2, pintura de carácter velazqueño, que puede ser clasificada perfectamente como obra indiscutible del pintor Juan Bautista Martínez del Mazo (¿Beteta?, Cuenca, 1611-Madrid, 1667, tanto por la característica soltura técnica, como por tratarse de uno de los modelos infantiles que aparecen en el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena (fig. 3, en relación con la cual se conoce otro Retrato de Luis Martínez del Mazo conservado en la Dulwich Picture Gallery de Londres (fig. 1. La importancia de la obra es notable no sólo porque incrementa el catálogo de Martínez del Mazo con una obra indudable, sino también por contribuir a precisar la cronología de la pintura conservada en Viena...

Francisco Ibarra Martínez: renovador de la pedagogía cubana

Directory of Open Access Journals (Sweden)

Lic. Osmar Oliva-Crespo

2015-10-01

Full Text Available The article entitled Francisco Ibarra Martínez: reformer of Cuban Pedagogy, is first of all a well deserved homage to one of the most important pedagogues of the republican period. His thought and his work are approached, from his initial stage of academic formation to his contributions to the educational cuban thought. Stands out his social dimension of his pedagogic work, his integration to the civic life of the city, his reforming vision of the practice of sports and study of the history of his country. Likewise, we refer to his contributions to the historiography as a science, the journalism and his concern for the social and political destination of the country. For this reason this work has among its contributions the treatment to the local history from the specific fild of pedagogy and education, modestly contributing to the rescue of historic memory.

Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica

OpenAIRE

Lobato, Filipa

2012-01-01

Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...

Chemins de traverse d’Ignacio Martínez de Pisón, roman de l’absence, roman de l’amour

Directory of Open Access Journals (Sweden)

André-Alain Morello

2012-08-01

Full Text Available Chemins de traverse d’Ignacio Martínez de Pisón se présente comme la pseudo autobiographie d’un adolescent, Felipe, qui, à la mort de sa mère, est condamné à vivre avec un père marginal. Le texte est aussi la conversion d’un récit de type picaresque en un roman qui débouche sur la découverte mutuelle d’un père et d’un fils. L’errance des deux personnages, chemin de fuite destiné à compenser la disparition de Cecilia, conduit à une sorte d’assomption de l’amour.Caminos secundarios, de Ignacio Martínez de Pisón, se presenta como la supuesta autobiografía de un adolescente, Felipe, quien, a la muerte de su madre, se ve forzado a vivir con un padre marginal. El texto es también la evolución de una narración de carácter picaresco hacia una novela que desemboca en el descubrimiento mutuo entre padre e hijo. El vagabundeo de ambos personajes, escape y consuelo por la desaparición de Cecilia, lleva a una forma de exaltación amorosa.

78 FR 41782 - Nez Perce-Clearwater National Forests; Idaho; Notice To Proceed With Forest Plan Revision

Science.gov (United States)

2013-07-11

... pursuant to the 2012 Forest Planning Rule. This process will ultimately result in a Forest Land Management... Planning Rule) which implements the NFMA. Forest Plans describe the strategic direction for management of... is the first phase of the planning process. Only informal public input is required at this stage (36...

Inventario de bienes de Juan Martínez, escribano público de Jerez de la Frontera en la primera mitad del siglo XV

Directory of Open Access Journals (Sweden)

M.ª Belén Piqueras García

2013-12-01

Full Text Available The present study is centered in the analysis of the Inventory of valuable objects of Juan Martínez, Jerez de la Frontera notary public during the first half of 15th century; Persecuting to bring to light this document from notarial type, until now unpublished, that approached its content and diplomatic analysis.

Retorno de un cruzado, by José Jiménez Lozano. Creation, Intertextuality and Originality of a Writing Process

Directory of Open Access Journals (Sweden)

Guadalupe Arbona Abascal

2017-01-01

Full Text Available This paper analyzes the writing process of José Jiménez Lozano’s Retorno de un cruzado (2013, his 24th novel. First, taking into account the author’s comments about the creation of the text, it presents the different versions and the literary reasons for his final choice. Second, literary intertextualities found in the novel are examined. Finally, the condition of the main character as storyteller is identified as the novel’s major source of originality.

Diiagnóstico económico y financiero de Electrónica Martínez de Cartagena

OpenAIRE

García García, Nuria

2015-01-01

Este Trabajo Fin de Máster está incluido en los estudios del Máster en Contabilidad y Finanzas Corporativas realizados en la Universidad Politécnica de Cartagena en el curso académico 2014-2015. El objetivo principal de este proyecto es realizar un análisis económico y financiero de la empresa Electrónica Martínez de Cartagena, S.L. en el periodo de 2008 a 2013, mediante la utilización de una serie de técnicas estudiadas a lo largo de la carrera y perfeccionadas durante el M...

(ReConstrução Mítica de Eva Perón no Romance Santa Evita (1996 – Tomás Eloy Martínez

Directory of Open Access Journals (Sweden)

Josiane Valcarenghi Ribeiro Nantes

2017-06-01

Full Text Available Eva Perón é um nome significativo na história política da Argentina, sua influência surtiu, e continua surtindo efeito, no povo desse país até os dias atuais. “Evita” foi odiada/amada em níveis extremos, tanto que foi considerada uma santa, um mito para muitas pessoas. Tomás Eloy Martínez escreveu o romance – Santa Evita (1995 – em que narra como viveu a esposa de Juan Domingo Perón. Nesta obra encontra-se muitos elementos que dão indícios da (remitificação de Eva, por isso tenta-se aqui, explorar como se deu a (reconstrução mitológica de Eva Perón, personagem histórica no romance Santa Evita (1996 de Tomás Eloy Martínez, e ainda, expor quais foram os procedimentos adotados pelo autor que (reconstruíram esse mito. Utiliza-se, como base teórica, Linda Hutcheon (1991 e Fleck (2007 no conceito de metaficção historiográfica, Mircea Eliade (1991 e Martín Cezar Feijó (1984 no que cabe à análise do Mito. Esta breve pesquisa se dará a partir da análise bibliográfica e de forma comparativa entre a história e a escrita ficcional do romance Santa Evita (1996 de Tomás Eloy Martínez, discute-se os elementos utilizados e o caminho percorrido para a (reconstrução do mito Eva Perón na obra citada.

The Literary Criticism and Memoirs of Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Allen W. Phillips

1983-01-01

Full Text Available Equally as demanding of others as he was of himself, Juan Ramón Jiménez conceived of literary criticism as a serious and exacting task. The critic and the poet, standing side by side, are devoted to complementary activities of mutual enrichment. However fragmentary and partial the critical opinions of Juan Ramón may be (also outspoken and polemical in nature, they are invaluable as a personal historical and aesthetic guide to about fifty or sixty years of Hispanic literary development (1900-1960. Not to take them into account is to fail to recognize a highly important aspect of his total artistic personality. These varied critical texts are a product of a first rate intelligence and the sensibility of a writer of consummate discrimination who was endowed not only with an excellent memory but also a very special talent for appreciating the authentic. Juan Ramón as a critic is quick to praise (San Juan, Bécquer, Dario, Unamuno and Machado and at the same time strong in his censure of certain contemporaries. Several recently collected volumes of miscellaneous critical materials have resolved the bibliographical muddle for the initial study of this fundamental aspect of the poet, but still particularly important are the expressionistic portraits of Españoles de tres mundos , longer tributes to Valle, Ortega and Villaespesa as well as the extensive lectures delivered in his latter years. Examination of these pages gives us an historical and creative overview of the period in which he lived and worked in addition to original considerations about the evolution of Hispanic poetry. Of course, one of the constant focal points of his literary criticism was the modernist epoch of his early days, a movement or attitude which he considered to be a modern twentieth century renaissance. Together with detailed study of these two areas of historical and aesthetic nature, in the ensuing pages some conclusions are pointed out as to the essence of poetry

Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835

Directory of Open Access Journals (Sweden)

María José Vilar García

2016-12-01

Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.

A prática de formação da câmara municipal de Setúbal: a perceção dos

OpenAIRE

Claré, Lúcia Sofia Balagueira

2013-01-01

Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...

A military officer in Rif: Jesús Jiménez Ortoneda (1911-1936

Directory of Open Access Journals (Sweden)

José Luis Villanova

2009-08-01

Full Text Available This paper uses original and for the most part unpublished documentation in order to examine the career of Jesús Jiménez Ortoneda, a highly successful career officer who served in the Spanish Protectorate of Morocco between 1907 and 1936. He occupied important positions in the political administration of the Protectorate (as director of the political section of Melilla’s Oficina Central de Intervenciones and a senior official in the Department of Indigenous Affairs; he was fluent in Arab and Tamazight, and gained a sound knowledge of the geography of the Rif mountains. His military career, in which he achieved the rank of lieutenant colonel, was characterized by his strictly professional attitude. He was one of the few career officers in Africa who were faithful to Spain’s republican government and who did not participate in the military uprising of 1936. This discussion of his career brings into question some well-established ideas concerning Spanish colonial policy in Morocco.

La légalisation de l’eugénisme en Espagne. Les théories de Jiménez de Asúa dans Libertad de amar y derecho a morir (1928

Directory of Open Access Journals (Sweden)

María Flores Rodríguez

2013-03-01

Full Text Available Cet article étudie les théories eugénistes du juriste et socialiste espagnol Luis Jiménez de Asúa, exposées dans son livre Libertad de amar y derecho a morir (1928, dont l’examen met en évidence l’importance des débats autour de la légalisation de l’eugénisme en Espagne. En démontrant sa viabilité juridique, fondée sur le respect du droit et des principes socialistes, Jiménez de Asúa ouvre de nouvelles perspectives au mouvement eugéniste espagnol, laissant entrevoir les contours d’un nouvel ordre, au détriment de la Dictature de Primo de Rivera, déjà sclérosée.

Why interdisciplinary research enriches the study of crime. Comment on "Statistical physics of crime: A review" by M.R. D'Orsogna and M. Perc

Science.gov (United States)

Donnay, Karsten

2015-03-01

The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].

SÈNECA, L. A.: Tragèdies, edició crítica de Tomàs Martínez Romero, 2 volums, Barcelona, Barcino, 1995 («Els Nostres Clàssics», Col.lecció B, núm. 14-15)

OpenAIRE

Pujol i Gómez, Josep

1998-01-01

Obra ressenyada: L. A. SÈNECA; edició crítica de Tomàs MARTÍNEZ ROMERO, Tragèdies. Barcelona: Barcino, 1995. Tomàs Martínez fa una edició crítica de les traduccions catalanes medievals de les següents tragèdies de Sèneca: 'Hercules furens', 'Thyestes', 'Thebais (Phoenissiae)', 'Hippolytus (Phaedra)' 'Oedipus', 'Troades', 'Medea' i 'Agamemnon'. A banda de l'edició, tracta qüestions com la difusió tardomedieval de Sèneca a la corona d'Aragó, la bibliografia sobre la diversitat dels mètodes d...

Vargas Jiménez, Dolores: Picasso: iconografías del baile.

Directory of Open Access Journals (Sweden)

José Jiménez Guerrero

2016-01-01

Full Text Available Fue en el año 1967. Bajo el mecenazgo de una institución ya desaparecida, el Liceo de Málaga, se convocó la primera edición del «Premio Málaga de Investigación». Esta loable iniciativa tuvo una continuidad temporal ininterrumpida hasta 1999. Tras ocho años de silencio, y gracias al respaldo de la Real Academia de Bellas Artes de San Telmo y de la Academia Malagueña de Ciencias, y al patrocinio de la entidad Cajamar, este prestigioso premio fue de nuevo convocado. A ello se sumó en el año 2012 la decisión adoptada por la Diputación de Málaga de publicar los trabajos premia dos en las dos modalidades del referido premio: Humanidades y Ciencias. Los libros editados forman parte de la colección que lleva por título «Premios Málaga de Investigación». En la convocatoria del año 2013, el premio de la sección humanística recayó en el trabajo presentado por Dolores Vargas Jiménez, doctora en Historia del Arte, bajo el título de Picasso: iconografías del baile. Y siguiendo lo preestablecido, su obra fue editada por la entidad supramunicipal.

Linguistic Norms at the Crossover: The Verbal Tenses and Modes, and the Structure of the Predicate in «Libro decimosexto» from Comentarios de erudición by Bartolomé Jiménez Patón

Directory of Open Access Journals (Sweden)

Juan Miguel Monterrubio Prieto

2013-11-01

Full Text Available This study examines verb modes and tenses as well as the predicate structure in «Libro decimosexto» of Bartolomé Jiménez Patón’s Comentarios de erudición in an effort to demonstrate how the text straddles the line between Medieval and Golden Age norms. Jiménez Patón, thus, combines traits already considered archaic at the time, due perhaps to his solid training in grammar and his linguistic awareness, with those modern solutions which, towards the end of the 1500’s, were forging the new Spanish language (that of the «plain style», which he championed, one that was gradually being refined in order to take its place as the language of culture.

Carlos Martínez Assad, coord. 2010. El camino de la rebelión del general Saturnino Cedillo. México: Editorial Océano ISBN 978-607-40034-7-5

Directory of Open Access Journals (Sweden)

Victor Rayon García

2015-01-01

Full Text Available Carlos Martínez Assad publicó Los rebeldes vencidos. Cedillo contra el Estado cardenista en 1990. En ese trabajo, el ahora investigador emérito por la Universidad Nacional Autónoma de México y el Sistema Nacional de Investigadores dio cuenta, mediante un meticuloso análisis de fuentes primarias, de la última rebelión que conmovió al México contemporáneo. La investigación de Martínez Assad tuvo muchos méritos, aunque tal vez el mayor de ellos fue el hecho de analizar el movimiento de Saturnino Cedillo en sus aspectos económicos, sociales, políticos e ideológicos. Con la seriedad académica que siempre lo caracteriza, el ahora también Premio Nacional de Ciencias y Artes 2013 examinó los momentos más importantes en la vida del cacique potosino: su incursión en el torbellino revolucionario (1912, su apoyo al Plan de Agua Prieta (1920, su alianza con los gobiernos de Álvaro Obregón (1920-1924 y Plutarco Elías Calles (1924-1928, y su enfrentamiento final con el gobierno de Lázaro Cárdenas (1934-1940. De esta manera, Martínez Assad demostró que Cedillo, al rechazar el socialismo, las huelgas y el ejido, fue expuesto por el Estado cardenista —empeñado en lograr una centralización política y administrativa— como aliado de las compañías petroleras expropiadas el 18 de marzo de 1938 y portavoz del fascismo alemán en México.

Hebrew Hermeneutics and Inquisitorial Persecution: The Case of The Hebraist from Salamanca Martín Martínez de Cantalapiedra (XVI^th Century

Directory of Open Access Journals (Sweden)

Ricardo Muñoz Solla

2016-12-01

Full Text Available

Halfway through the 16th century in Spain the reading and interpretation of the Bible based on its original languages involved a very real danger for humanists who were seeking a better understanding of the Scriptures. The exclusive authority of the Latin Vulgate version declared by the Council of Trent in 1546 hindered the intellectual work of many Biblicists and Theologians, who were subjected to tight ideological control. In this context it must be considered the case of the Hebraist and scholar from the University of Salamanca, Martín Martínez de Cantalapiedra (1518-1579, who was prosecuted by the Inquisition of Valladolid in 1572 along with his colleagues Fray Luis de León and Gaspar de Grajal. All of them were accused of deviating from the genuine sense of the Vulgate in their more literal interpretations of the Masoretic text. The purpose of this article is to provide new evidence for the intellectual biography of Master Martínez de Cantalapiedra as well a to analyze the hermeneutical principles exposed during his inquisitorial in which he defended the Hebrew knowledge as an essential means of interpreting the Old Testament.

Santa Efigenia / Ifigenia : hagiografía y mito en "San Mateo en Etiopía", de Felipe Godínez

OpenAIRE

Márquez, Esther

2017-01-01

Este artículo aborda el estudio de las fuentes de San Mateo en Etiopía, obra que lleva a las tablas la vida del apóstol San Mateo, centrándose en el episodio de la evangelización de Etiopía y la conversión al cristianismo de Santa Efigenia, la hija del rey Egipo. Mediante el examen de sus fuentes, tanto hagiográficas como mitológicas, se pretende demostrar la contaminación que lleva a cabo Godínez entre la historia de Santa Efigenia y el mito de Ifigenia, la hija de Agamenón. El estudio compa...

El converso sevillano Nicolás Martínez de Medina (o de Sevilla, contador mayor de Castilla. Apuntes para una biografía = Nicolás Martínez Medina (or de Sevilla, Sevilian Converso and Chief Accountant of Castile. Notes for a Biography

Directory of Open Access Journals (Sweden)

Isabel Montes Romero-Camacho

2014-06-01

Full Text Available A partir de la conquista de Sevilla, en 1248, fueron muchos los judíos, primero, y los conversos, después, que llegaron a ocupar una posición preeminente, tanto en la ciudad, como en la corte, desempeñando, casi siempre, importantes oficios, al servicio de la hacienda real castellana, en una secuencia prácticamente ininterrumpida que va desde Alfonso X (1252-1284 hasta la nueva dinastía Trastámara. Uno de estos importantes conversos fue Nicolás Martínez de Medina (o de Sevilla, cuya actuación pública se desarrolló durante los reinados y a la sombra de los primeros Trastámara, desde Enrique II (1369-1379 hasta Juan II (1406-1454 y que, tras una brillante carrera en Sevilla y en la corte, llegaría a ser contador mayor de Castilla y, por tanto, uno de los personajes más influyentes de su época.After the conquest of Seville in 1248, many Jews and later «Conversos» played a prominent role both in the city and in the Court. They occupied significant positions at the service of the Spanish royal treasury almost uninterruptedly from the reign of Alfonso X (1252-1284 to that of the new Trastámara dynasty. One of these important «Conversos» was Nicolás Martínez de Medina (or de Sevilla, who held public positions under the reigns of the first Trastámara kings, from Enrique II (1369-1379 to Juan II (1406-1454. After a brilliant career in Seville and in the Court, he would become chief accountant of Castile and, consequently, one of the most influential individuals of his time.

An Indian tribal view of the back end of the nuclear fuel cycle: Historical and cultural lessons

International Nuclear Information System (INIS)

Tano, M.L.; Reuben, J.H.; Powaukee, D.; Lester, A.D.

1996-01-01

Indian tribes of the western United States, including the Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and the Yakama Indian Nation, have entered into cooperative agreements with the U.S. Department of Energy to oversee the cleanup of the Hanford Reservation, in Washington state. These and other tribes considering involvement in nuclear waste management programs have been subjected to severe criticism from some Indians and non-Indians, accusing them of aiding and abetting the violation of Mother Earth by acquiescing in the contamination of lands by radioactive wastes. We'd like to suggest that this view of the Indian relationship to nature and the environment is too narrow. While the purpose of this article is not to suggest that Indian beliefs support the location of waste management facilities on Indian lands, we will describe aspects of Indian religion and culture that support tribal involvement in radioactive waste management and environmental restoration, and participation in radioactive waste management decision making

Homenaje de los Institutos de Derecho Constitucional y Derechos Humanos a Justino Jiménez de Aréchaga en el centenario de su nacimiento

Directory of Open Access Journals (Sweden)

Alberto Pérez Pérez

2014-02-01

Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.

De mitos y realidades (respuesta a Luciano Martínez

Directory of Open Access Journals (Sweden)

José Luis Coraggio

2009-10-01

Full Text Available Este artículo constituye la respuesta del autor al comentario crítico realizado, en esta misma sección, por Luciano Martínez, en la pasada edición. El autor sostiene que la economía social y solidaria como un ámbito en construcción, que alberga a diversas vertientes que intentan avanzar hacia otra economía. Este carácter si bien puede albergar dudas, no debe transformase en un fatalismo inmovilizador, que permite la actualización constante del libre mercado como institución hegemónica. Antes que una utopía a denunciar desde una visión “realista”, se trata de construir una economía que combine mecanismos de mercado regulados socio-políticamente y relaciones de reciprocidad y redistribución. El texto explora, en pos de la argumentación, algunos de los elementos que conforman la economía social y solidaria.This article represents the author's response to critical commentary made in this section in the last edition by Luciano Martinez. The author maintains that the social and solidarity economy is a sphere under construction, in which several strands can be found. All of these approaches aim to move towards a different type of economy. This character as a developing realm can prompt doubts; this, however, should not lead to a paralyzing fatalism which allows the constant updating of the free market as a hegemonic institution. Far from a utopia to be denounced from a “realistic” viewpoint of economy, its concerns the construction of an economy that combines socio-politically regulated market mechanisms as well as relations of reciprocity and redistribution. The text also explores some of the elements that make up the solidarity and social economy.

BPA riparian fencing and alternative water development projects completed within Asotin Creek Watershed ; 2000 and 2001 Asotin Creek fencing final report of accomplishments

International Nuclear Information System (INIS)

Johnson, B.J.Bradley J.

2002-01-01

The Asotin County Conservation District (ACCD) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in Water Resource Inventory Area (WRIA) 35. According to Washington Department of Fish and Wildlife's (WDFW) Priority WRIA's by ''At-Risk Stock Significance Map'', it is the highest priority WRIA in southeastern Washington. Summer steelhead, bull trout, and Snake River spring chinook salmon which are listed under the Endangered Species Act (ESA), are present in the watershed. WDFW manages it as a Wild Steelhead Reserve; no hatchery fish have been released here since 1997. The ACCD has been working with landowners, Bonneville Power Administration (BPA), Washington State Conservation Commission (WCC), Natural Resource Conservation Service (NRCS), Washington Department of Fish and Wildlife (WDFW), U.S. Forest Service, Pomeroy Ranger District (USFS), Nez Perce Tribe, Washington Department of Ecology (DOE), National Marine Fisheries Service (NMFS), and U.S. Fish and Wildlife Service (USFWS) to address habitat projects in Asotin County. Local students, volunteers and Salmon Corps members from the Nez Perce Tribe have been instrumental in the success of the Model Watershed Program on Asotin Creek. ACCD began coordinating habitat projects in 1995 with the help of BPA funding. Approximately two hundred and seventy-six projects have been implemented as of 1999. The Washington State Legislature was successful in securing funding for endangered salmon and steelhead recovery throughout the State in 1998. While these issues were new to most of the State, the ACCD has been securing and administering funding for endangered salmonids since 1994. The ''Asotin Creek Riparian Planting 2000-053-00 and Asotin Creek Riparian Fencing 2000-054-00'' teamed BPA and the Governor's Salmon Recovery Funding to plant approximately 84

L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo Ibérico e l’azionismo torinese.

OpenAIRE

Bottai, Alessio

2016-01-01

Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...

Estudo sobre a perceção individual de adolescentes no uso de aparatologia funcional removível e a sua predisposição no sucesso do tratamento ortodôntico

OpenAIRE

Figueira, Maria Margarida Góis

2016-01-01

Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...

Towards a Poetry of Silence: Stéphane Mallarmé and Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Mervyn Coke-Enguídanos

1983-01-01

Full Text Available In an era of apparent dissolution, "la Obra" of Juan Ramón Jiménez, like "l'Oeuvre" of Stéphane Mallarmé, has for its goal the attainment of timelessness. In both poets, the concept of absolute Time—the timelessness of eternal Time—is yoked with the ideal of silence. But this is no ordinary silence, and certainly not the kind that results from inadequacy of expression. It is the silence of perfection, the expression of the ineffable: pure Poetry. Since the poetic language is the silent language of thought, both Mallarmé and Juan Ramón seek to convey the pure idea. In so doing, both must stringently eliminate whatever is not essential in their poetry. The astonishing paradox, central to Mallarmé and Juan Ramón alike, is the urge to create an "unwritten" poetry.

[Rural medical practice at the beginning of the 20th century. Martínez Saldise (1855-1937), honorary member of Paediatric Society of Madrid in 1927].

Science.gov (United States)

Zafra Anta, Miguel Ángel; Flores Martín, Carlos; Ponte Hernando, Fernando Julio; Gil García, Andrés; Gómez López, Ana; Fernández Durán, Carla

2016-01-01

On the centenary of the foundation of the Paediatrics Society of Madrid, a tribute is presented to rural medical practice of that time, although there are few documents on the history of rural medicine. The main objective is to describe the context of the rural medical practice in the late 19th and beginning 20th century, while presenting a historical biographical review of Manuel Martínez Saldise, who was medical specialist from Cazalegas (Toledo). He was appointed an Honorary Member by the Paediatrics Society of Madrid in 1927. A search was carried out in repositories of digitized media, web portals of history of medicine, PubMed, IME files of local councils and medical colleges. The family archives were reviewed with the collaboration of his descendants. The hiring of rural doctors was carried out by the municipalities, and the salary largely depended on private practice as well as "retainers". Specialist physicians took part in epidemics, legal medicine, and in hygiene measures. They also had disputes with mayors, chiefs, with colleagues and with protectionism. A summary of the biography and occupational activity of Manuel Martínez Saldise is presented. Rural doctors were subjected to the society of their time, with the issues that arose, denouncing the shortcomings of the local administrations, dedicated efforts to their family and the most disadvantaged. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.

« Nez et langues électroniques » : bilan et perspectives pour les huiles alimentaires

Directory of Open Access Journals (Sweden)

Mielle Patrick

2003-07-01

Full Text Available Le « Nez électronique », et plus récemment la « Langue électronique » ont été fort médiatisés durant la dernière décennie. Aussi est-il nécessaire, avec le recul, de faire le point sur les bénéfices que ces technologies peuvent apporter dans le domaine des produits alimentaires, et en particulier pour huiles végétales. On trouve une littérature relativement abondante dans ce domaine, mais les applications qui ont réussi à franchir le cap de l’utilisation industrielle sont extrêmement restreintes. S’agit-il d’une frilosité des industriels pour des investissements de contrôle-qualité ou d’un manque de fiabilité des résultats de laboratoire ? Pourtant, la demande en outils rapides de contrôle-qualité (ou de contrôle d’origine n’a jamais été aussi pressante. Nous expliquerons ce point par la nature même du produit, principalement pour l’huile d’olive extra vierge. D’autres techniques faisant appel à l’enrichissement en composés volatils seront introduites, laissant espérer à l’avenir une amélioration de la fiabilité des analyses.

Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed, Technical Report 2003-2006.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn

2007-02-01

The Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed is a multi-phase project to enhance steelhead trout in the Lapwai Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District (District). Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period December 1, 2003 through February 28, 2004 include; seven grade stabilization structures, 0.67 acres of wetland plantings, ten acres tree planting, 500 linear feet streambank erosion control, two acres grass seeding, and 120 acres weed control.

José Martínez Millán y Carlos Javier de Carlos Morales. Religión, política y tolerancia en la Europa Moderna

OpenAIRE

Torres Corominas, Eduardo

2013-01-01

Como fruto maduro de una larga trayectoria docente e investigadora en la Universidad Autónoma de Madrid, José Martínez Millán y Carlos Javier de Carlos Morales ofrecen en Religión, política y tolerancia en la Europa Moderna una serena reflexión sobre la época del Antiguo Régimen que pretende superar, desde los estudios sobre la Corte, los límites y contradicciones de las escuelas y paradigmas precedentes, como la escuela de los Annales y el marxismo, por medio de un discurso renovador donde s...

Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega - José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro

Directory of Open Access Journals (Sweden)

Enrico Di Pastena

2012-12-01

Full Text Available Review of Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega, Homo Legens (Bibliotheca Homolegens, 63, Madrid, 2011, 334 pp. ISBN: 978-84-92518-72-2 y José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro, PPU, Barcelona, 2011, 783 pp. ISBN: 978-84-477-1114-7.

Initial Flight Test of the Production Support Flight Control Computers at NASA Dryden Flight Research Center

Science.gov (United States)

Carter, John; Stephenson, Mark

1999-01-01

The NASA Dryden Flight Research Center has completed the initial flight test of a modified set of F/A-18 flight control computers that gives the aircraft a research control law capability. The production support flight control computers (PSFCC) provide an increased capability for flight research in the control law, handling qualities, and flight systems areas. The PSFCC feature a research flight control processor that is "piggybacked" onto the baseline F/A-18 flight control system. This research processor allows for pilot selection of research control law operation in flight. To validate flight operation, a replication of a standard F/A-18 control law was programmed into the research processor and flight-tested over a limited envelope. This paper provides a brief description of the system, summarizes the initial flight test of the PSFCC, and describes future experiments for the PSFCC.

Alarma sobre el aplastamiento de la persona en la sociedad contemporánea: José Jiménez Lozano en la prensa regional

Directory of Open Access Journals (Sweden)

María Merino Bobillo

2011-11-01

Full Text Available Las enfermedades de la sociedad contemporánea son descritas, con lucidez y brillantez literaria, por el periodista y escritor José Jiménez Lozano, en las entregas periodísticas al Grupo Promecal. Los nacionalismos, la movida y el botellón, la violencia de género, el lenguaje sexista, etc. son retazos de la actualidad que su mirada atraviesa y dimensiona. Sus artículos traspasan la contingencia de lo periodístico para convertirse en propuestas culturales con tonalidad universal. No se quedan en la crítica de los sucesos concretos sino que, apoyándose en ellos, derivan en reflexiones de corte antropológico y ofrecen pensamientos válidos para los lectores de hoy y de mañana.

Flight Test of an Intelligent Flight-Control System

Science.gov (United States)

Davidson, Ron; Bosworth, John T.; Jacobson, Steven R.; Thomson, Michael Pl; Jorgensen, Charles C.

2003-01-01

The F-15 Advanced Controls Technology for Integrated Vehicles (ACTIVE) airplane (see figure) was the test bed for a flight test of an intelligent flight control system (IFCS). This IFCS utilizes a neural network to determine critical stability and control derivatives for a control law, the real-time gains of which are computed by an algorithm that solves the Riccati equation. These derivatives are also used to identify the parameters of a dynamic model of the airplane. The model is used in a model-following portion of the control law, in order to provide specific vehicle handling characteristics. The flight test of the IFCS marks the initiation of the Intelligent Flight Control System Advanced Concept Program (IFCS ACP), which is a collaboration between NASA and Boeing Phantom Works. The goals of the IFCS ACP are to (1) develop the concept of a flight-control system that uses neural-network technology to identify aircraft characteristics to provide optimal aircraft performance, (2) develop a self-training neural network to update estimates of aircraft properties in flight, and (3) demonstrate the aforementioned concepts on the F-15 ACTIVE airplane in flight. The activities of the initial IFCS ACP were divided into three Phases, each devoted to the attainment of a different objective. The objective of Phase I was to develop a pre-trained neural network to store and recall the wind-tunnel-based stability and control derivatives of the vehicle. The objective of Phase II was to develop a neural network that can learn how to adjust the stability and control derivatives to account for failures or modeling deficiencies. The objective of Phase III was to develop a flight control system that uses the neural network outputs as a basis for controlling the aircraft. The flight test of the IFCS was performed in stages. In the first stage, the Phase I version of the pre-trained neural network was flown in a passive mode. The neural network software was running using flight data

In-Flight Sleep of Flight Crew During a 7-hour Rest Break: Implications for Research and Flight Safety

Science.gov (United States)

Signal, T. Leigh; Gander, Philippa H.; van den Berg, Margo J.; Graeber, R. Curtis

2013-01-01

Study Objectives: To assess the amount and quality of sleep that flight crew are able to obtain during flight, and identify factors that influence the sleep obtained. Design: Flight crew operating flights between Everett, WA, USA and Asia had their sleep recorded polysomnographically for 1 night in a layover hotel and during a 7-h in-flight rest opportunity on flights averaging 15.7 h. Setting: Layover hotel and in-flight crew rest facilities onboard the Boeing 777-200ER aircraft. Participants: Twenty-one male flight crew (11 Captains, mean age 48 yr and 10 First Officers, mean age 35 yr). Interventions: N/A. Measurements and Results: Sleep was recorded using actigraphy during the entire tour of duty, and polysomnographically in a layover hotel and during the flight. Mixed model analysis of covariance was used to determine the factors affecting in-flight sleep. In-flight sleep was less efficient (70% vs. 88%), with more nonrapid eye movement Stage 1/Stage 2 and more frequent awakenings per h (7.7/h vs. 4.6/h) than sleep in the layover hotel. In-flight sleep included very little slow wave sleep (median 0.5%). Less time was spent trying to sleep and less sleep was obtained when sleep opportunities occurred during the first half of the flight. Multivariate analyses suggest age is the most consistent factor affecting in-flight sleep duration and quality. Conclusions: This study confirms that even during long sleep opportunities, in-flight sleep is of poorer quality than sleep on the ground. With longer flight times, the quality and recuperative value of in-flight sleep is increasingly important for flight safety. Because the age limit for flight crew is being challenged, the consequences of age adversely affecting sleep quantity and quality need to be evaluated. Citation: Signal TL; Gander PH; van den Berg MJ; Graeber RC. In-flight sleep of flight crew during a 7-hour rest break: implications for research and flight safety. SLEEP 2013;36(1):109–115. PMID:23288977

In-flight sleep of flight crew during a 7-hour rest break: implications for research and flight safety.

Science.gov (United States)

Signal, T Leigh; Gander, Philippa H; van den Berg, Margo J; Graeber, R Curtis

2013-01-01

To assess the amount and quality of sleep that flight crew are able to obtain during flight, and identify factors that influence the sleep obtained. Flight crew operating flights between Everett, WA, USA and Asia had their sleep recorded polysomnographically for 1 night in a layover hotel and during a 7-h in-flight rest opportunity on flights averaging 15.7 h. Layover hotel and in-flight crew rest facilities onboard the Boeing 777-200ER aircraft. Twenty-one male flight crew (11 Captains, mean age 48 yr and 10 First Officers, mean age 35 yr). N/A. Sleep was recorded using actigraphy during the entire tour of duty, and polysomnographically in a layover hotel and during the flight. Mixed model analysis of covariance was used to determine the factors affecting in-flight sleep. In-flight sleep was less efficient (70% vs. 88%), with more nonrapid eye movement Stage 1/Stage 2 and more frequent awakenings per h (7.7/h vs. 4.6/h) than sleep in the layover hotel. In-flight sleep included very little slow wave sleep (median 0.5%). Less time was spent trying to sleep and less sleep was obtained when sleep opportunities occurred during the first half of the flight. Multivariate analyses suggest age is the most consistent factor affecting in-flight sleep duration and quality. This study confirms that even during long sleep opportunities, in-flight sleep is of poorer quality than sleep on the ground. With longer flight times, the quality and recuperative value of in-flight sleep is increasingly important for flight safety. Because the age limit for flight crew is being challenged, the consequences of age adversely affecting sleep quantity and quality need to be evaluated.

Análisis e interpretación de la columna de opinión en la obra periodística del murciano José García Martínez

OpenAIRE

Castelo Blasco, Carmen

2015-01-01

Objetivos.- El presente trabajo analiza 300 columnas de opinión del periodista murciano José García Martínez publicadas en el periódico La Verdad entre los años 1975 y 2010. Para ello, se ha utilizado un análisis de contenido que ha permitido identificar las particularidades y características en cuanto a temas, enfoque, estructura y lenguaje que el autor utiliza. Se trata de un periodista singular por el hecho de haber desarrollado durante más de medio siglo su carrera profesional en un único...

Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2002 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

2003-07-01

Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.

Historias y viñetas, una versión del pasado traumático. Carlos Giménez: variaciones entre España y Argentina

Directory of Open Access Journals (Sweden)

Néstor Bórquez

2013-12-01

Full Text Available The following paper shall focus especially on the work of Carlos Giménez, a comic author from Madrid who attempts to represent there Spanish daily life from Civil War times up to the end of the Francoist regime –and his own life experience displays there an unavoidable reference point: 36-39 Malos tiempos, but mostly Paracuellos and Barrio are part of his own life story during the Civil War and the Francoist regime. In Argentina, authors such as Mariano Grassi or María Delia Lozupone and Rafael Cippolini try a similar intimist gaze upon the representation of dictatorship times in Argentina. This paper shall seek to establish a dialogue between these manifestations, attempting thereby to analyze the intimate plot of history and representation in these comic books.

Miracle Flights

Science.gov (United States)

... a Flight Get Involved Events Shop Miles Contact Miracle Flights Blog Giving Tuesday 800-359-1711 Thousands of children have been saved, but we still have miles to go. Request a Flight Click Here to Donate - Your ...

¿Es posible provocar la madurez del conflicto? A propósito de la correspondencia entre Medófilo Medina y Timoleón Jiménez

Directory of Open Access Journals (Sweden)

Adolfo León Atehortúa Cruz

2012-08-01

Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?

Perceções parentais sobre estado nutricional, imagem corporal e saúde em crianças com idade escolar Las percepciones de los padres sobre el estado nutricional, la imagen corporal y la salud en niños en edad escolar Parental perceptions of nutritional status, body image and health in school-aged children

Directory of Open Access Journals (Sweden)

Lúcia Macedo

2012-03-01

Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las

Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice

International Nuclear Information System (INIS)

Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.

2007-01-01

The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure

Indoor tetrachloroethylene levels and determinants in Paris dwellings.

Science.gov (United States)

Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle

2013-01-01

There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.

Perceções dos(as) psicoterapeutas sobre a influência dos estereótipos de género e das relações íntimas, heterossexuais e não-heterossexuais, nas vivências da disfunção erétil

OpenAIRE

Cunha, Catarina Gradíssimo Dias da

2012-01-01

Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...

Modeling the Potential Distribution of Picea chihuahuana Martínez, an Endangered Species at the Sierra Madre Occidental, Mexico

Directory of Open Access Journals (Sweden)

Victor Aguilar-Soto

2015-03-01

Full Text Available Species distribution models (SDMs help identify areas for the development of populations or communities to prevent extinctions, especially in the face of the global environmental change. This study modeled the potential distribution of the tree Picea chihuahuana Martínez, a species in danger of extinction, using the maximum entropy modeling method (MaxEnt at three scales: local, state and national. We used a total of 38 presence data from the Sierra Madre Occidental. At the local scale, we compared MaxEnt with the reclassification and overlay method integrated in a geographic information system. MaxEnt generated maps with a high predictive capability (AUC > 0.97. The distribution of P. chihuahuana is defined by vegetation type and minimum temperature at national and state scales. At the local scale, both models calculated similar areas for the potential distribution of the species; the variables that better defined the species distribution were vegetation type, aspect and distance to water flows. Populations of P. chihuahuana have always been small, but our results show potential habitat greater than the area of the actual distribution. These results provide an insight into the availability of areas suitable for the species’ regeneration, possibly through assisted colonization.

Toma de decisiones y actitudes emprendedoras en estudiantes del 5° grado de secundaria de la Institución Educativa 2015” Pública José Jiménez Borja – Cercado de Lima

OpenAIRE

Riva Novoa, Ronal

2015-01-01

Es una investigación descriptiva correlacional, orientada a estudiar la relación entre toma de decisión y la actitud emprendedora estudiantes del 5° grado de secundaria de la Institución Educativa Pública José Jiménez Borja del Cercado de Lima, Se seleccionó una población de 80 estudiantes de ambos sexos del 5° año de educación secundaria. A dicha población se les aplicó Cuestionario para evaluar la aptitud en la Toma de Decisiones, el cuestionario fue elaborado por Jonifer Benitez (2011) ...

Flight Test Implementation of a Second Generation Intelligent Flight Control System

Science.gov (United States)

Williams-Hayes, Peggy S.

2005-01-01

The NASA F-15 Intelligent Flight Control System project team has developed a series of flight control concepts designed to demonstrate the benefits of a neural network-based adaptive controller. The objective of the team was to develop and flight-test control systems that use neural network technology, to optimize the performance of the aircraft under nominal conditions, and to stabilize the aircraft under failure conditions. Failure conditions include locked or failed control surfaces as well as unforeseen damage that might occur to the aircraft in flight. The Intelligent Flight Control System team is currently in the process of implementing a second generation control scheme, collectively known as Generation 2 or Gen 2, for flight testing on the NASA F-15 aircraft. This report describes the Gen 2 system as implemented by the team for flight test evaluation. Simulation results are shown which describe the experiment to be performed in flight and highlight the ways in which the Gen 2 system meets the defined objectives.

17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

CERN Multimedia

Pantelia, Anna

2014-01-01

17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

Effect of the Pulmonary Embolism Rule-Out Criteria on Subsequent Thromboembolic Events Among Low-Risk Emergency Department Patients: The PROPER Randomized Clinical Trial.

Science.gov (United States)

Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno

2018-02-13

The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected

La Economía Política y las Motivaciones de Participación Socio-Política de Jóvenes Chilenos: Una Interpretación de los Hallazgos de Martínez, Silva y Hernández (2010 Political Economy and Youth Motivations of Socio-Political Participation: An Interpretation of the Findings From Martínez, Silva and Hernández (2010

Directory of Open Access Journals (Sweden)

Eduardo Silva

2010-11-01

Full Text Available El artículo de Martínez, Silva y Hernández (en este número argumenta que los jóvenes chilenos se han distanciado de la participación sociopolítica convencional, porque perciben una falta de validación de las personas en el sistema sociopolítico actual, debido a la vulneración de derechos, inequidad social y falta de voz y poder de los ciudadanos. Esto choca con sus valores de fraternidad y desarrollo justo y digno de las personas. En este ensayo se examina si ese sentir tiene fundamentos reales en la estructura y lógica del modelo político-económico que ellos critican. Se aborda el tema desde el marco analítico de la economía política, que parte del supuesto de que las estructuras económicas y políticas determinan sujetos sociales, sus intereses y su poder relativo. Se encontró una asociación directa entre la lógica del modelo político-económico y los sentimientos de exclusión que expresaron los entrevistados.The article by Martínez, Silva, and Hernández (in this issue argues that Chilean youth have disengaged from participation in conventional socio-political institutions because they believe that the sociopolitical system does not validate the persons, violates their rights, is highly inequitable, and excludes them from having a real voice in public decision-making. This perception clashes with their values of fraternity and a just and dignified development for everyone. This essay examines if these beliefs have a real basis in the structure and logic of the economic and political model they criticize. This issue is analyzed from a political economy perspective, built on the assumption that economic and political structures determine social subjects, their interests, and their relative power. A direct association was found between the logic of Chile's political-economic model and the feelings of exclusion that the interviewees expressed.

A Survey of Open-Source UAV Flight Controllers and Flight Simulators

DEFF Research Database (Denmark)

Ebeid, Emad Samuel Malki; Skriver, Martin; Terkildsen, Kristian Husum

2018-01-01

, which are all tightly linked to the UAV flight controller hardware and software. The lack of standardization of flight controller architectures and the use of proprietary closed-source flight controllers on many UAV platforms, however, complicates this work: solutions developed for one flight controller...... may be difficult to port to another without substantial extra development and testing. Using open-source flight controllers mitigates some of these challenges and enables other researchers to validate and build upon existing research. This paper presents a survey of the publicly available open...

The role of situation assessment and flight experience in pilots' decisions to continue visual flight rules flight into adverse weather.

Science.gov (United States)

Wiegmann, Douglas A; Goh, Juliana; O'Hare, David

2002-01-01

Visual flight rules (VFR) flight into instrument meteorological conditions (IMC) is a major safety hazard in general aviation. In this study we examined pilots' decisions to continue or divert from a VFR flight into IMC during a dynamic simulation of a cross-country flight. Pilots encountered IMC either early or later into the flight, and the amount of time and distance pilots flew into the adverse weather prior to diverting was recorded. Results revealed that pilots who encountered the deteriorating weather earlier in the flight flew longer into the weather prior to diverting and had more optimistic estimates of weather conditions than did pilots who encountered the deteriorating weather later in the flight. Both the time and distance traveled into the weather prior to diverting were negatively correlated with pilots' previous flight experience. These findings suggest that VFR flight into IMC may be attributable, at least in part, to poor situation assessment and experience rather than to motivational judgment that induces risk-taking behavior as more time and effort are invested in a flight. Actual or potential applications of this research include the design of interventions that focus on improving weather evaluation skills in addition to addressing risk-taking attitudes.

Theseus in Flight

Science.gov (United States)

1996-01-01

The twin pusher propeller-driven engines of the Theseus research aircraft can be clearly seen in this photo, taken during a 1996 research flight at NASA's Dryden Flight Research Center, Edwards, California. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to validate satellite

A Simple Flight Mill for the Study of Tethered Flight in Insects.

Science.gov (United States)

Attisano, Alfredo; Murphy, James T; Vickers, Andrew; Moore, Patricia J

2015-12-10

Flight in insects can be long-range migratory flights, intermediate-range dispersal flights, or short-range host-seeking flights. Previous studies have shown that flight mills are valuable tools for the experimental study of insect flight behavior, allowing researchers to examine how factors such as age, host plants, or population source can influence an insects' propensity to disperse. Flight mills allow researchers to measure components of flight such as speed and distance flown. Lack of detailed information about how to build such a device can make their construction appear to be prohibitively complex. We present a simple and relatively inexpensive flight mill for the study of tethered flight in insects. Experimental insects can be tethered with non-toxic adhesives and revolve around an axis by means of a very low friction magnetic bearing. The mill is designed for the study of flight in controlled conditions as it can be used inside an incubator or environmental chamber. The strongest points are the very simple electronic circuitry, the design that allows sixteen insects to fly simultaneously allowing the collection and analysis of a large number of samples in a short time and the potential to use the device in a very limited workspace. This design is extremely flexible, and we have adjusted the mill to accommodate different species of insects of various sizes.

Bat flight: aerodynamics, kinematics and flight morphology.

Science.gov (United States)

Hedenström, Anders; Johansson, L Christoffer

2015-03-01

Bats evolved the ability of powered flight more than 50 million years ago. The modern bat is an efficient flyer and recent research on bat flight has revealed many intriguing facts. By using particle image velocimetry to visualize wake vortices, both the magnitude and time-history of aerodynamic forces can be estimated. At most speeds the downstroke generates both lift and thrust, whereas the function of the upstroke changes with forward flight speed. At hovering and slow speed bats use a leading edge vortex to enhance the lift beyond that allowed by steady aerodynamics and an inverted wing during the upstroke to further aid weight support. The bat wing and its skeleton exhibit many features and control mechanisms that are presumed to improve flight performance. Whereas bats appear aerodynamically less efficient than birds when it comes to cruising flight, they have the edge over birds when it comes to manoeuvring. There is a direct relationship between kinematics and the aerodynamic performance, but there is still a lack of knowledge about how (and if) the bat controls the movements and shape (planform and camber) of the wing. Considering the relatively few bat species whose aerodynamic tracks have been characterized, there is scope for new discoveries and a need to study species representing more extreme positions in the bat morphospace. © 2015. Published by The Company of Biologists Ltd.

Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing

Directory of Open Access Journals (Sweden)

Martha A. T. Lenio

2012-01-01

Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.

Selected Flight Test Results for Online Learning Neural Network-Based Flight Control System

Science.gov (United States)

Williams-Hayes, Peggy S.

2004-01-01

The NASA F-15 Intelligent Flight Control System project team developed a series of flight control concepts designed to demonstrate neural network-based adaptive controller benefits, with the objective to develop and flight-test control systems using neural network technology to optimize aircraft performance under nominal conditions and stabilize the aircraft under failure conditions. This report presents flight-test results for an adaptive controller using stability and control derivative values from an online learning neural network. A dynamic cell structure neural network is used in conjunction with a real-time parameter identification algorithm to estimate aerodynamic stability and control derivative increments to baseline aerodynamic derivatives in flight. This open-loop flight test set was performed in preparation for a future phase in which the learning neural network and parameter identification algorithm output would provide the flight controller with aerodynamic stability and control derivative updates in near real time. Two flight maneuvers are analyzed - pitch frequency sweep and automated flight-test maneuver designed to optimally excite the parameter identification algorithm in all axes. Frequency responses generated from flight data are compared to those obtained from nonlinear simulation runs. Flight data examination shows that addition of flight-identified aerodynamic derivative increments into the simulation improved aircraft pitch handling qualities.

14 CFR 121.412 - Qualifications: Flight instructors (airplane) and flight instructors (simulator).

Science.gov (United States)

2010-01-01

... (airplane) and flight instructors (simulator). 121.412 Section 121.412 Aeronautics and Space FEDERAL... OPERATIONS Training Program § 121.412 Qualifications: Flight instructors (airplane) and flight instructors (simulator). (a) For the purposes of this section and § 121.414: (1) A flight instructor (airplane) is a...

Overview of Pre-Flight Physical Training, In-Flight Exercise Countermeasures and the Post-Flight Reconditioning Program for International Space Station Astronauts

Science.gov (United States)

Kerstman, Eric

2011-01-01

International Space Station (ISS) astronauts receive supervised physical training pre-flight, utilize exercise countermeasures in-flight, and participate in a structured reconditioning program post-flight. Despite recent advances in exercise hardware and prescribed exercise countermeasures, ISS crewmembers are still found to have variable levels of deconditioning post-flight. This presentation provides an overview of the astronaut medical certification requirements, pre-flight physical training, in-flight exercise countermeasures, and the post-flight reconditioning program. Astronauts must meet medical certification requirements on selection, annually, and prior to ISS missions. In addition, extensive physical fitness testing and standardized medical assessments are performed on long duration crewmembers pre-flight. Limited physical fitness assessments and medical examinations are performed in-flight to develop exercise countermeasure prescriptions, ensure that the crewmembers are physically capable of performing mission tasks, and monitor astronaut health. Upon mission completion, long duration astronauts must re-adapt to the 1 G environment, and be certified as fit to return to space flight training and active duty. A structured, supervised postflight reconditioning program has been developed to prevent injuries, facilitate re-adaptation to the 1 G environment, and subsequently return astronauts to training and space flight. The NASA reconditioning program is implemented by the Astronaut Strength, Conditioning, and Rehabilitation (ASCR) team and supervised by NASA flight surgeons. This program has evolved over the past 10 years of the International Space Station (ISS) program and has been successful in ensuring that long duration astronauts safely re-adapt to the 1 g environment and return to active duty. Lessons learned from this approach to managing deconditioning can be applied to terrestrial medicine and future exploration space flight missions.

Advanced aircraft service life monitoring method via flight-by-flight load spectra

Science.gov (United States)

Lee, Hongchul

This research is an effort to understand current method and to propose an advanced method for Damage Tolerance Analysis (DTA) for the purpose of monitoring the aircraft service life. As one of tasks in the DTA, the current indirect Individual Aircraft Tracking (IAT) method for the F-16C/D Block 32 does not properly represent changes in flight usage severity affecting structural fatigue life. Therefore, an advanced aircraft service life monitoring method based on flight-by-flight load spectra is proposed and recommended for IAT program to track consumed fatigue life as an alternative to the current method which is based on the crack severity index (CSI) value. Damage Tolerance is one of aircraft design philosophies to ensure that aging aircrafts satisfy structural reliability in terms of fatigue failures throughout their service periods. IAT program, one of the most important tasks of DTA, is able to track potential structural crack growth at critical areas in the major airframe structural components of individual aircraft. The F-16C/D aircraft is equipped with a flight data recorder to monitor flight usage and provide the data to support structural load analysis. However, limited memory of flight data recorder allows user to monitor individual aircraft fatigue usage in terms of only the vertical inertia (NzW) data for calculating Crack Severity Index (CSI) value which defines the relative maneuver severity. Current IAT method for the F-16C/D Block 32 based on CSI value calculated from NzW is shown to be not accurate enough to monitor individual aircraft fatigue usage due to several problems. The proposed advanced aircraft service life monitoring method based on flight-by-flight load spectra is recommended as an improved method for the F-16C/D Block 32 aircraft. Flight-by-flight load spectra was generated from downloaded Crash Survival Flight Data Recorder (CSFDR) data by calculating loads for each time hack in selected flight data utilizing loads equations. From

Improving couples' quality of life through a Web-based prostate cancer education intervention.

Science.gov (United States)

Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H

2015-03-01

To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.

Características tecnológicas de la madera de palo morado (Peltogyne mexicana Martínez de tierra colorada, Guerrero, México

Directory of Open Access Journals (Sweden)

J. Navarro-Martínez

2005-01-01

Full Text Available El presente trabajo contribuye al conocimiento de las características y propiedades tecnológicas de la madera de Palo morado (Peltogyne mexicana Martínez, mediante la caracterización anatómica, porcentaje de elementos y determinación de las propiedades físicas y tres mecánicas. Se colectaron dos árboles en Tierra Colorada Guerrero. El material se obtuvo de trozas a 1.30 m de altura. Para el estudio macroscópico se usaron muestras de 7 x 15 x 1 cm y para el microscópico se elaboraron preparaciones fijas de cortes y de material disociado. La madera presenta un color violeta intenso, porosidad difusa, parénquima en bandas y aliforme confluente con cristales, los elementos de vaso son cortos de diámetro medio, con inclusiones, rayos uniseriados, biseriados, triseriados y raramente multiseriados; las fibras son de tipo libriforme de longitud media, diámetro fino y pared gruesa, presenta densidad básica, contracciones y dureza alta.

Advanced Transport Operating System (ATOPS) Flight Management/Flight Controls (FM/FC) software description

Science.gov (United States)

Wolverton, David A.; Dickson, Richard W.; Clinedinst, Winston C.; Slominski, Christopher J.

1993-01-01

The flight software developed for the Flight Management/Flight Controls (FM/FC) MicroVAX computer used on the Transport Systems Research Vehicle for Advanced Transport Operating Systems (ATOPS) research is described. The FM/FC software computes navigation position estimates, guidance commands, and those commands issued to the control surfaces to direct the aircraft in flight. Various modes of flight are provided for, ranging from computer assisted manual modes to fully automatic modes including automatic landing. A high-level system overview as well as a description of each software module comprising the system is provided. Digital systems diagrams are included for each major flight control component and selected flight management functions.

1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

CERN Multimedia

Pantelia, Anna

2014-01-01

1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos

Directory of Open Access Journals (Sweden)

Raquel V. Oliveira

2014-03-01

Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.

Flight Planning

Science.gov (United States)

1991-01-01

Seagull Technology, Inc., Sunnyvale, CA, produced a computer program under a Langley Research Center Small Business Innovation Research (SBIR) grant called STAFPLAN (Seagull Technology Advanced Flight Plan) that plans optimal trajectory routes for small to medium sized airlines to minimize direct operating costs while complying with various airline operating constraints. STAFPLAN incorporates four input databases, weather, route data, aircraft performance, and flight-specific information (times, payload, crew, fuel cost) to provide the correct amount of fuel optimal cruise altitude, climb and descent points, optimal cruise speed, and flight path.

Habitat Evaluation Procedures (HEP) Report; Precious Lands Wildlife Management Area, Technical Report 2000-2003.

Energy Technology Data Exchange (ETDEWEB)

Kozusko, Shana

2003-12-01

The Nez Perce Tribe (NPT) currently manages a 15,325 acre parcel of land known as the Precious Lands Wildlife Management Area that was purchased as mitigation for losses incurred by construction of the four lower Snake River dams. The Management Area is located in northern Wallowa County, Oregon and southern Asotin County, Washington (Figure 1). It is divided into three management parcels--the Buford parcel is located on Buford Creek and straddles the WA-OR state line, and the Tamarack and Basin parcels are contiguous to each other and located between the Joseph Creek and Cottonwood Creek drainages in Wallowa County, OR. The project was developed under the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L. 96-501), with funding from the Bonneville Power Administration (BPA). The acreage protected under this contract will be credited to BPA as habitat permanently dedicated to wildlife and wildlife mitigation. A modeling strategy known as Habitat Evaluation Procedure (HEP) was developed by the U.S. Fish and Wildlife Service and adopted by BPA as a habitat equivalency accounting system. Nine wildlife species models were used to evaluate distinct cover type features and provide a measure of habitat quality. Models measure a wide range of life requisite variables for each species and monitor overall trends in vegetation community health and diversity. One product of HEP is an evaluation of habitat quality expressed in Habitat Units (HUs). This HU accounting system is used to determine the amount of credit BPA receives for mitigation lands. After construction of the four lower Snake River dams, a HEP loss assessment was conducted to determine how many Habitat Units were inundated behind the dams. Twelve target species were used in that evaluation: Canada goose, mallard, river otter, downy woodpecker, song sparrow, yellow warbler, marsh wren, western meadowlark, chukar, ring-necked pheasant, California quail, and mule deer. The U.S. Army Corp of

Flight Planning in the Cloud

Science.gov (United States)

Flores, Sarah L.; Chapman, Bruce D.; Tung, Waye W.; Zheng, Yang

2011-01-01

This new interface will enable Principal Investigators (PIs), as well as UAVSAR (Uninhabited Aerial Vehicle Synthetic Aperture Radar) members to do their own flight planning and time estimation without having to request flight lines through the science coordinator. It uses an all-in-one Google Maps interface, a JPL hosted database, and PI flight requirements to design an airborne flight plan. The application will enable users to see their own flight plan being constructed interactively through a map interface, and then the flight planning software will generate all the files necessary for the flight. Afterward, the UAVSAR team can then complete the flight request, including calendaring and supplying requisite flight request files in the expected format for processing by NASA s airborne science program. Some of the main features of the interface include drawing flight lines on the map, nudging them, adding them to the current flight plan, and reordering them. The user can also search and select takeoff, landing, and intermediate airports. As the flight plan is constructed, all of its components are constantly being saved to the database, and the estimated flight times are updated. Another feature is the ability to import flight lines from previously saved flight plans. One of the main motivations was to make this Web application as simple and intuitive as possible, while also being dynamic and robust. This Web application can easily be extended to support other airborne instruments.

Advanced transport operating system software upgrade: Flight management/flight controls software description

Science.gov (United States)

Clinedinst, Winston C.; Debure, Kelly R.; Dickson, Richard W.; Heaphy, William J.; Parks, Mark A.; Slominski, Christopher J.; Wolverton, David A.

1988-01-01

The Flight Management/Flight Controls (FM/FC) software for the Norden 2 (PDP-11/70M) computer installed on the NASA 737 aircraft is described. The software computes the navigation position estimates, guidance commands, those commands to be issued to the control surfaces to direct the aircraft in flight based on the modes selected on the Advanced Guidance Control System (AGSC) mode panel, and the flight path selected via the Navigation Control/Display Unit (NCDU).

Free Flight Ground Testing of ADEPT in Advance of the Sounding Rocket One Flight Experiment

Science.gov (United States)

Smith, B. P.; Dutta, S.

2017-01-01

The Adaptable Deployable Entry and Placement Technology (ADEPT) project will be conducting the first flight test of ADEPT, titled Sounding Rocket One (SR-1), in just two months. The need for this flight test stems from the fact that ADEPT's supersonic dynamic stability has not yet been characterized. The SR-1 flight test will provide critical data describing the flight mechanics of ADEPT in ballistic flight. These data will feed decision making on future ADEPT mission designs. This presentation will describe the SR-1 scientific data products, possible flight test outcomes, and the implications of those outcomes on future ADEPT development. In addition, this presentation will describe free-flight ground testing performed in advance of the flight test. A subsonic flight dynamics test conducted at the Vertical Spin Tunnel located at NASA Langley Research Center provided subsonic flight dynamics data at high and low altitudes for multiple center of mass (CoM) locations. A ballistic range test at the Hypervelocity Free Flight Aerodynamics Facility (HFFAF) located at NASA Ames Research Center provided supersonic flight dynamics data at low supersonic Mach numbers. Execution and outcomes of these tests will be discussed. Finally, a hypothesized trajectory estimate for the SR-1 flight will be presented.

Flight control actuation system

Science.gov (United States)

Wingett, Paul T. (Inventor); Gaines, Louie T. (Inventor); Evans, Paul S. (Inventor); Kern, James I. (Inventor)

2006-01-01

A flight control actuation system comprises a controller, electromechanical actuator and a pneumatic actuator. During normal operation, only the electromechanical actuator is needed to operate a flight control surface. When the electromechanical actuator load level exceeds 40 amps positive, the controller activates the pneumatic actuator to offset electromechanical actuator loads to assist the manipulation of flight control surfaces. The assistance from the pneumatic load assist actuator enables the use of an electromechanical actuator that is smaller in size and mass, requires less power, needs less cooling processes, achieves high output forces and adapts to electrical current variations. The flight control actuation system is adapted for aircraft, spacecraft, missiles, and other flight vehicles, especially flight vehicles that are large in size and travel at high velocities.

Aurora Flight Sciences' Perseus B Remotely Piloted Aircraft in Flight

Science.gov (United States)

1998-01-01

A long, slender wing and a pusher propeller at the rear characterize the Perseus B remotely piloted research aircraft, seen here during a test flight in June 1998. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft (SHASA) program, which later evolved into the ERAST

Flight Testing an Iced Business Jet for Flight Simulation Model Validation

Science.gov (United States)

Ratvasky, Thomas P.; Barnhart, Billy P.; Lee, Sam; Cooper, Jon

2007-01-01

A flight test of a business jet aircraft with various ice accretions was performed to obtain data to validate flight simulation models developed through wind tunnel tests. Three types of ice accretions were tested: pre-activation roughness, runback shapes that form downstream of the thermal wing ice protection system, and a wing ice protection system failure shape. The high fidelity flight simulation models of this business jet aircraft were validated using a software tool called "Overdrive." Through comparisons of flight-extracted aerodynamic forces and moments to simulation-predicted forces and moments, the simulation models were successfully validated. Only minor adjustments in the simulation database were required to obtain adequate match, signifying the process used to develop the simulation models was successful. The simulation models were implemented in the NASA Ice Contamination Effects Flight Training Device (ICEFTD) to enable company pilots to evaluate flight characteristics of the simulation models. By and large, the pilots confirmed good similarities in the flight characteristics when compared to the real airplane. However, pilots noted pitch up tendencies at stall with the flaps extended that were not representative of the airplane and identified some differences in pilot forces. The elevator hinge moment model and implementation of the control forces on the ICEFTD were identified as a driver in the pitch ups and control force issues, and will be an area for future work.

Flight research and testing

Science.gov (United States)

Putnam, Terrill W.; Ayers, Theodore G.

1989-01-01

Flight research and testing form a critical link in the aeronautic research and development chain. Brilliant concepts, elegant theories, and even sophisticated ground tests of flight vehicles are not sufficient to prove beyond a doubt that an unproven aeronautical concept will actually perform as predicted. Flight research and testing provide the ultimate proof that an idea or concept performs as expected. Ever since the Wright brothers, flight research and testing were the crucible in which aeronautical concepts were advanced and proven to the point that engineers and companies are willing to stake their future to produce and design aircraft. This is still true today, as shown by the development of the experimental X-30 aerospace plane. The Dryden Flight Research Center (Ames-Dryden) continues to be involved in a number of flight research programs that require understanding and characterization of the total airplane in all the aeronautical disciplines, for example the X-29. Other programs such as the F-14 variable-sweep transition flight experiment have focused on a single concept or discipline. Ames-Dryden also continues to conduct flight and ground based experiments to improve and expand the ability to test and evaluate advanced aeronautical concepts. A review of significant aeronautical flight research programs and experiments is presented to illustrate both the progress being made and the challenges to come.

14 CFR 25.865 - Fire protection of flight controls, engine mounts, and other flight structure.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fire protection of flight controls, engine... Design and Construction Fire Protection § 25.865 Fire protection of flight controls, engine mounts, and other flight structure. Essential flight controls, engine mounts, and other flight structures located in...

L(sub 1) Adaptive Flight Control System: Flight Evaluation and Technology Transition

Science.gov (United States)

Xargay, Enric; Hovakimyan, Naira; Dobrokhodov, Vladimir; Kaminer, Isaac; Gregory, Irene M.; Cao, Chengyu

2010-01-01

Certification of adaptive control technologies for both manned and unmanned aircraft represent a major challenge for current Verification and Validation techniques. A (missing) key step towards flight certification of adaptive flight control systems is the definition and development of analysis tools and methods to support Verification and Validation for nonlinear systems, similar to the procedures currently used for linear systems. In this paper, we describe and demonstrate the advantages of L(sub l) adaptive control architectures for closing some of the gaps in certification of adaptive flight control systems, which may facilitate the transition of adaptive control into military and commercial aerospace applications. As illustrative examples, we present the results of a piloted simulation evaluation on the NASA AirSTAR flight test vehicle, and results of an extensive flight test program conducted by the Naval Postgraduate School to demonstrate the advantages of L(sub l) adaptive control as a verifiable robust adaptive flight control system.

Cellular renewal and improvement of local cell effector activity in peritoneal cavity in response to infectious stimuli.

Directory of Open Access Journals (Sweden)

Alexandra dos Anjos Cassado

Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.

Perseus Post-flight

Science.gov (United States)

1991-01-01

Crew members check out the Perseus proof-of-concept vehicle on Rogers Dry Lake, adjacent to the Dryden Flight Research Center, Edwards, California, after a test flight in 1991. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft (SHASA) program, which later evolved

Wind and Wake Sensing with UAV Formation Flight: System Development and Flight Testing

Science.gov (United States)

Larrabee, Trenton Jameson

Wind turbulence including atmospheric turbulence and wake turbulence have been widely investigated; however, only recently it become possible to use Unmanned Aerial Vehicles (UAVs) as a validation tool for research in this area. Wind can be a major contributing factor of adverse weather for aircraft. More importantly, it is an even greater risk towards UAVs because of their small size and weight. Being able to estimate wind fields and gusts can potentially provide substantial benefits for both unmanned and manned aviation. Possible applications include gust suppression for improving handling qualities, a better warning system for high wind encounters, and enhanced control for small UAVs during flight. On the other hand, the existence of wind can be advantageous since it can lead to fuel savings and longer duration flights through dynamic soaring or thermal soaring. Wakes are an effect of the lift distribution across an aircraft's wing or tail. Wakes can cause substantial disturbances when multiple aircraft are moving through the same airspace. In fact, the perils from an aircraft flying through the wake of another aircraft is a leading cause of the delay between takeoff times at airports. Similar to wind, though, wakes can be useful for energy harvesting and increasing an aircraft's endurance when flying in formation which can be a great advantage to UAVs because they are often limited in flight time due to small payload capacity. Formation flight can most often be seen in manned aircraft but can be adopted for use with unmanned systems. Autonomous flight is needed for flying in the "sweet spot" of the generated wakes for energy harvesting as well as for thermal soaring during long duration flights. For the research presented here formation flight was implemented for the study of wake sensing and gust alleviation. The major contributions of this research are in the areas of a novel technique to estimate wind using an Unscented Kalman filter and experimental wake

Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

OpenAIRE

Eulalia Hernández Ciro

2015-01-01

Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprens...

La conformación de la provincia jesuítica de Toledo en torno al generalato de Diego Laínez 1556-1565

Directory of Open Access Journals (Sweden)

Martín López, David

2014-12-01

Full Text Available The newest Jesuits soon began incardinated in the Iberian territory, home of its founder. As one of the most important territories of Catholic Christianity, soon saw the need to distribute what would soon become a large crown in a number of provinces for a more effective government and evangelization. After the first division, at the time of the Spanish general Lines were the final foundations of penta-provincialization between Portugal, Castile, Aragon, Andalusia and —novelty— Toledo.La novísima Compañía de Jesús empezó pronto a incardinarse en el territorio ibérico, patria de su fundador. Como uno de los territorios más importantes de la Cristiandad católica, pronto se vio la necesidad de distribuir lo que pronto sería una gran corona en una serie de provincias para unos más eficaces gobierno y evangelización. Después de una primera división, en la época del generalato del español Laínez se pusieron las bases de la pentaprovincialización definitiva entre Portugal, Castilla, Aragón, Bética y —la novedad— Toledo.

X-43A Flight Controls

Science.gov (United States)

Baumann, Ethan

2006-01-01

A viewgraph presentation detailing X-43A Flight controls at NASA Dryden Flight Research Center is shown. The topics include: 1) NASA Dryden, Overview and current and recent flight test programs; 2) Unmanned Aerial Vehicle Synthetic Aperture Radar (UAVSAR) Program, Program Overview and Platform Precision Autopilot; and 3) Hyper-X Program, Program Overview, X-43A Flight Controls and Flight Results.

F-16XL ship #1 (#849) during first flight of the Digital Flight Control System (DFCS)

Science.gov (United States)

1997-01-01

After completing its first flight with the Digital Flight Control System on December 16, 1997, the F-16XL #1 aircraft began a series of envelope expansion flights. On January 27 and 29, 1998, it successfully completed structural clearance tests, as well as most of the load testing Only flights at Mach 1.05 at 10,000 feet, Mach 1.1 at 15,000 feet, and Mach 1.2 at 20,000 feet remained. During the next flight, on February 4, an instrumentation problem cut short the planned envelope expansion tests. After the problem was corrected, the F-16XL returned to flight status, and on February 18 and 20, flight control and evaluation flights were made. Two more research flights were planned for the following week, but another problem appeared. During the ground start up, project personnel noticed that the leading edge flap moved without being commanded. The Digital Flight Control Computer was sent to the Lockheed-Martin facility at Fort Worth, where the problem was traced to a defective chip in the computer. After it was replaced, the F-16XL #1 flew a highly successful flight controls and handling qualities evaluation flight on March 26, clearing the way for the final tests. The final limited loads expansion flight occurred on March 31, and was fully successful. As a result, the on-site Lockheed-Martin loads engineer cleared the aircraft to Mach 1.8. The remaining two handling qualities and flight control evaluation flights were both made on April 3, 1998. These three flights concluded the flight test portion of the DFCS upgrade.

DAST in Flight

Science.gov (United States)

1980-01-01

The modified BQM-34 Firebee II drone with Aeroelastic Research Wing (ARW-1), a supercritical airfoil, during a 1980 research flight. The remotely-piloted vehicle, which was air launched from NASA's NB-52B mothership, participated in the Drones for Aerodynamic and Structural Testing (DAST) program which ran from 1977 to 1983. The DAST 1 aircraft (Serial #72-1557), pictured, crashed on 12 June 1980 after its right wing ripped off during a test flight near Cuddeback Dry Lake, California. The crash occurred on the modified drone's third free flight. These are the image contact sheets for each image resolution of the NASA Dryden Drones for Aerodynamic and Structural Testing (DAST) Photo Gallery. From 1977 to 1983, the Dryden Flight Research Center, Edwards, California, (under two different names) conducted the DAST Program as a high-risk flight experiment using a ground-controlled, pilotless aircraft. Described by NASA engineers as a 'wind tunnel in the sky,' the DAST was a specially modified Teledyne-Ryan BQM-34E/F Firebee II supersonic target drone that was flown to validate theoretical predictions under actual flight conditions in a joint project with the Langley Research Center, Hampton, Virginia. The DAST Program merged advances in electronic remote control systems with advances in airplane design. Drones (remotely controlled, missile-like vehicles initially developed to serve as gunnery targets) had been deployed successfully during the Vietnamese conflict as reconnaissance aircraft. After the war, the energy crisis of the 1970s led NASA to seek new ways to cut fuel use and improve airplane efficiency. The DAST Program's drones provided an economical, fuel-conscious method for conducting in-flight experiments from a remote ground site. DAST explored the technology required to build wing structures with less than normal stiffness. This was done because stiffness requires structural weight but ensures freedom from flutter-an uncontrolled, divergent oscillation of

Práticas de colaboração para inclusão de alunos com Necessidades Educativas Especiais nas escolas portuguesas : Perceções de professores e Equipa técnico pedagógica/ Collaboration practices for inclusion of students with special educational needs

Directory of Open Access Journals (Sweden)

Raquel Batista de Oliveira

2017-12-01

Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental,  tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi

Flapping wing flight can save aerodynamic power compared to steady flight.

Science.gov (United States)

Pesavento, Umberto; Wang, Z Jane

2009-09-11

Flapping flight is more maneuverable than steady flight. It is debated whether this advantage is necessarily accompanied by a trade-off in the flight efficiency. Here we ask if any flapping motion exists that is aerodynamically more efficient than the optimal steady motion. We solve the Navier-Stokes equation governing the fluid dynamics around a 2D flapping wing, and determine the minimal aerodynamic power needed to support a specified weight. While most flapping wing motions are more costly than the optimal steady wing motion, we find that optimized flapping wing motions can save up to 27% of the aerodynamic power required by the optimal steady flight. We explain the cause of this energetic advantage.

Flight code validation simulator

Science.gov (United States)

Sims, Brent A.

1996-05-01

An End-To-End Simulation capability for software development and validation of missile flight software on the actual embedded computer has been developed utilizing a 486 PC, i860 DSP coprocessor, embedded flight computer and custom dual port memory interface hardware. This system allows real-time interrupt driven embedded flight software development and checkout. The flight software runs in a Sandia Digital Airborne Computer and reads and writes actual hardware sensor locations in which Inertial Measurement Unit data resides. The simulator provides six degree of freedom real-time dynamic simulation, accurate real-time discrete sensor data and acts on commands and discretes from the flight computer. This system was utilized in the development and validation of the successful premier flight of the Digital Miniature Attitude Reference System in January of 1995 at the White Sands Missile Range on a two stage attitude controlled sounding rocket.

Perseus in Flight

Science.gov (United States)

1991-01-01

The Perseus proof-of-concept vehicle flies over Rogers Dry Lake at the Dryden Flight Research Center, Edwards, California, to test basic design concepts for the remotely-piloted, high-altitude vehicle. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft (SHASA

Orion Exploration Flight Test Post-Flight Inspection and Analysis

Science.gov (United States)

Miller, J. E.; Berger, E. L.; Bohl, W. E.; Christiansen, E. L.; Davis, B. A.; Deighton, K. D.; Enriquez, P. A.; Garcia, M. A.; Hyde, J. L.; Oliveras, O. M.

2017-01-01

The principal mechanism for developing orbital debris environment models, is to make observations of larger pieces of debris in the range of several centimeters and greater using radar and optical techniques. For particles that are smaller than this threshold, breakup and migration models of particles to returned surfaces in lower orbit are relied upon to quantify the flux. This reliance on models to derive spatial densities of particles that are of critical importance to spacecraft make the unique nature of the EFT-1's return surface a valuable metric. To this end detailed post-flight inspections have been performed of the returned EFT-1 backshell, and the inspections identified six candidate impact sites that were not present during the pre-flight inspections. This paper describes the post-flight analysis efforts to characterize the EFT-1 mission craters. This effort included ground based testing to understand small particle impact craters in the thermal protection material, the pre- and post-flight inspection, the crater analysis using optical, X-ray computed tomography (CT) and scanning electron microscope (SEM) techniques, and numerical simulations.

Capital Flight and Economic Performance

OpenAIRE

Beja, Edsel Jr.

2007-01-01

Capital flight aggravates resource constraints and contributes to undermine long-term economic growth. Counterfactual calculations on the Philippines suggest that capital flight contributed to lower the quality of long-term economic growth. Sustained capital flight over three decades means that capital flight had a role for the Philippines to lose the opportunities to achieve economic takeoff. Unless decisive policy actions are taken up to address enduring capital flight and manage the macroe...

Recent estimates of capital flight

OpenAIRE

Claessens, Stijn; Naude, David

1993-01-01

Researchers and policymakers have in recent years paid considerable attention to the phenomenon of capital flight. Researchers have focused on four questions: What concept should be used to measure capital flight? What figure for capital flight will emerge, using this measure? Can the occurrence and magnitude of capital flight be explained by certain (economic) variables? What policy changes can be useful to reverse capital flight? The authors focus strictly on presenting estimates of capital...

The relationship of certified flight instructors' emotional intelligence levels on flight student advancement

Science.gov (United States)

Hokeness, Mark Merrill

Aviation researchers estimate airline companies will require nearly 500,000 pilots in the next 20 years. The role of a Certified Flight Instructor (CFI) is to move student pilots to professional pilots with training typically conducted in one-on-one student and instructor sessions. The knowledge of aviation, professionalism as a teacher, and the CFI’s interpersonal skills can directly affect the successes and advancement of a student pilot. A new and emerging assessment of people skills is known as emotional intelligence (EI). The EI of the CFI can and will affect a flight students’ learning experiences. With knowledge of emotional intelligence and its effect on flight training, student pilot dropouts from aviation may be reduced, thus helping to ensure an adequate supply of pilots. Without pilots, the growth of the commercial aviation industry will be restricted. This mixed method research study established the correlation between a CFI’s measured EI levels and the advancement of flight students. The elements contributing to a CFI’s EI level were not found to be teaching or flight-related experiences, suggesting other life factors are drawn upon by the CFI and are reflected in their emotional intelligence levels presented to flight students. Students respond positively to CFIs with higher levels of emotional intelligence. Awareness of EI skills by both the CFI and flight student contribute to flight student successes and advancement.

Insect flight muscle metabolism

NARCIS (Netherlands)

Horst, D.J. van der; Beenakkers, A.M.Th.; Marrewijk, W.J.A. van

1984-01-01

The flight of an insect is of a very complicated and extremely energy-demanding nature. Wingbeat frequency may differ between various species but values up to 1000 Hz have been measured. Consequently metabolic activity may be very high during flight and the transition from rest to flight is

14 CFR 63.23 - Special purpose flight engineer and flight navigator certificates: Operation of U.S.-registered...

Science.gov (United States)

2010-01-01

... purpose flight engineer and flight navigator certificates: Operation of U.S.-registered civil airplanes... flight engineer or flight navigator duties on a civil airplane of U.S. registry, leased to a person not a... certificate holder is performing flight engineer or flight navigator duties on the U.S.-registered civil...

14 CFR 23.865 - Fire protection of flight controls, engine mounts, and other flight structure.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fire protection of flight controls, engine... controls, engine mounts, and other flight structure. Flight controls, engine mounts, and other flight... they are capable of withstanding the effects of a fire. Engine vibration isolators must incorporate...

Navigation and flight director guidance for the NASA/FAA helicopter MLS curved approach flight test program

Science.gov (United States)

Phatak, A. V.; Lee, M. G.

1985-01-01

The navigation and flight director guidance systems implemented in the NASA/FAA helicopter microwave landing system (MLS) curved approach flight test program is described. Flight test were conducted at the U.S. Navy's Crows Landing facility, using the NASA Ames UH-lH helicopter equipped with the V/STOLAND avionics system. The purpose of these tests was to investigate the feasibility of flying complex, curved and descending approaches to a landing using MLS flight director guidance. A description of the navigation aids used, the avionics system, cockpit instrumentation and on-board navigation equipment used for the flight test is provided. Three generic reference flight paths were developed and flown during the test. They were as follows: U-Turn, S-turn and Straight-In flight profiles. These profiles and their geometries are described in detail. A 3-cue flight director was implemented on the helicopter. A description of the formulation and implementation of the flight director laws is also presented. Performance data and analysis is presented for one pilot conducting the flight director approaches.

Experimental Results and Issues on Equalization for Nonlinear Memory Channel: Pre-Cursor Enhanced Ram-DFE Canceler

Science.gov (United States)

Yuan, Lu; LeBlanc, James

1998-01-01

This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.

Aviator's Fluid Balance During Military Flight.

Science.gov (United States)

Levkovsky, Anna; Abot-Barkan, Sivan; Chapnik, Leah; Doron, Omer; Levy, Yuval; Heled, Yuval; Gordon, Barak

2018-02-01

A loss of 1% or more of bodyweight due to dehydration has a negative effect on cognitive performance, which could critically affect flight safety. There is no mention in the literature concerning the amounts of military pilots' fluid loss during flight. The aim of this study was to quantify fluid loss of pilots during military flight. There were 48 aviators (mean age 23.9) from the Israeli Air Force who participated in the study, which included 104 training flights in various flight platforms. Bodyweight, urine specific gravity, and environmental heat strain were measured before and after each flight. Fluid loss was calculated as the weight differences before and after the flight. We used a univariate and one-way ANOVA to analyze the effect of different variables on the fluid loss. The mean fluid loss rate was 462 ml · h-1. The results varied among different aircraft platforms and depended on flight duration. Blackhawk pilots lost the highest amount of fluids per flight, albeit had longer flights (mean 108 min compared to 35.5 in fighter jets). Jet fighter pilots had the highest rate of fluid loss per hour of flight (up to 692 ml, extrapolated). Overall, at 11 flights (11%) aircrew completed their flight with a meaningful fluid loss. We conclude that military flights may be associated with significant amount of fluid loss among aircrew.Levkovsky A, Abot-Barkan S, Chapnik L, Doron O, Levy Y, Heled Y, Gordon B. Aviator's fluid balance during military flight. Aerosp Med Hum Perform. 2018; 89(2):9498.

Apollo experience report: Development flight instrumentation. [telemetry equipment for space flight test program

Science.gov (United States)

Farmer, N. B.

1974-01-01

Development flight instrumentation was delivered for 25 Apollo vehicles as Government-furnished equipment. The problems and philosophies of an activity that was concerned with supplying telemetry equipment to a space-flight test program are discussed. Equipment delivery dates, system-design details, and flight-performance information for each mission also are included.

IRVE-II Post-Flight Trajectory Reconstruction

Science.gov (United States)

O'Keefe, Stephen A.; Bose, David M.

2010-01-01

NASA s Inflatable Re-entry Vehicle Experiment (IRVE) II successfully demonstrated an inflatable aerodynamic decelerator after being launched aboard a sounding rocket from Wallops Flight Facility (WFF). Preliminary day of flight data compared well with pre-flight Monte Carlo analysis, and a more complete trajectory reconstruction performed with an Extended Kalman Filter (EKF) approach followed. The reconstructed trajectory and comparisons to an attitude solution provided by NASA Sounding Rocket Operations Contract (NSROC) personnel at WFF are presented. Additional comparisons are made between the reconstructed trajectory and pre and post-flight Monte Carlo trajectory predictions. Alternative observations of the trajectory are summarized which leverage flight accelerometer measurements, the pre-flight aerodynamic database, and on-board flight video. Finally, analysis of the payload separation and aeroshell deployment events are presented. The flight trajectory is reconstructed to fidelity sufficient to assess overall project objectives related to flight dynamics and overall, IRVE-II flight dynamics are in line with expectations

A Interface e as suas dimensões na perceção de credibilidade e confiança na e-Health. Proposta de uma estrutura para análise da Interface

Directory of Open Access Journals (Sweden)

Andreia Pinto de Sousa

2015-07-01

Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.

Flight Tasks and Metrics to Evaluate Laser Eye Protection in Flight Simulators

Science.gov (United States)

2017-07-07

IFR ) IFR Instrument Flight Rules LED Light Emitting Diode LEP Laser Eye Protection MAPP Model Assessing Pilot Performance OD Optical Density...LEP and then use them to assess the impact of wearing LEP in a flight simulator environment. 2 Pending Distribution, A: Approved for public...2005). LEP has the potential to alter distinct characteristics of the visual environment, giving rise to concerns over the impact on flight tasks and

Aviadores en el desierto. Aventura y viaje del capitán Rafael Martínez Esteve en el Ḥamad jordano-iraquí (1926

Directory of Open Access Journals (Sweden)

Córdoba, Joaquín Mª

2005-04-01

Full Text Available A comienzos del siglo XX, cuando el redescubrimiento de Oriente se había trocado en su colonización tras la I Guerra Mundial, la poesía del viaje y el reencuentro con gentes y paisajes parecían ya imposibles. De hecho, la literatura «clásica» del viaje a Oriente estaba ya más que acabada. Sin embargo, un accidente de la historia de la aviación española haría que el capitán Rafael Martínez Esteve, integrante de la patrulla que emprendió el viaje Madrid-Manila, viviera una trágica aventura en el desierto jordano- iraquí. Fruto de esa experiencia sería un libro que es, al mismo tiempo que emocionante relato, descripción poética del desierto y la vida de los beduinos, sarcástica mirada a los poderes coloniales, y un amable epígono en la historia de la literatura española de viajes a Oriente.…

IceBridge Mission Flight Reports

Data.gov (United States)

National Aeronautics and Space Administration — The IceBridge Mission Flight Reports data set contains flight reports from NASA Operation IceBridge Greenland, Arctic, Antarctic, and Alaska missions. Flight reports...

INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.

Science.gov (United States)

Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...

Integrated flight path planning system and flight control system for unmanned helicopters.

Science.gov (United States)

Jan, Shau Shiun; Lin, Yu Hsiang

2011-01-01

This paper focuses on the design of an integrated navigation and guidance system for unmanned helicopters. The integrated navigation system comprises two systems: the Flight Path Planning System (FPPS) and the Flight Control System (FCS). The FPPS finds the shortest flight path by the A-Star (A*) algorithm in an adaptive manner for different flight conditions, and the FPPS can add a forbidden zone to stop the unmanned helicopter from crossing over into dangerous areas. In this paper, the FPPS computation time is reduced by the multi-resolution scheme, and the flight path quality is improved by the path smoothing methods. Meanwhile, the FCS includes the fuzzy inference systems (FISs) based on the fuzzy logic. By using expert knowledge and experience to train the FIS, the controller can operate the unmanned helicopter without dynamic models. The integrated system of the FPPS and the FCS is aimed at providing navigation and guidance to the mission destination and it is implemented by coupling the flight simulation software, X-Plane, and the computing software, MATLAB. Simulations are performed and shown in real time three-dimensional animations. Finally, the integrated system is demonstrated to work successfully in controlling the unmanned helicopter to operate in various terrains of a digital elevation model (DEM).

Integrated Flight Path Planning System and Flight Control System for Unmanned Helicopters

Science.gov (United States)

Jan, Shau Shiun; Lin, Yu Hsiang

2011-01-01

This paper focuses on the design of an integrated navigation and guidance system for unmanned helicopters. The integrated navigation system comprises two systems: the Flight Path Planning System (FPPS) and the Flight Control System (FCS). The FPPS finds the shortest flight path by the A-Star (A*) algorithm in an adaptive manner for different flight conditions, and the FPPS can add a forbidden zone to stop the unmanned helicopter from crossing over into dangerous areas. In this paper, the FPPS computation time is reduced by the multi-resolution scheme, and the flight path quality is improved by the path smoothing methods. Meanwhile, the FCS includes the fuzzy inference systems (FISs) based on the fuzzy logic. By using expert knowledge and experience to train the FIS, the controller can operate the unmanned helicopter without dynamic models. The integrated system of the FPPS and the FCS is aimed at providing navigation and guidance to the mission destination and it is implemented by coupling the flight simulation software, X-Plane, and the computing software, MATLAB. Simulations are performed and shown in real time three-dimensional animations. Finally, the integrated system is demonstrated to work successfully in controlling the unmanned helicopter to operate in various terrains of a digital elevation model (DEM). PMID:22164029

Eclipse takeoff and flight

Science.gov (United States)

1998-01-01

This 25-second clip shows the QF-106 'Delta Dart' tethered to the USAF C-141A during takeoff and in flight. NASA Dryden Flight Research Center, Edwards, California, supported a Kelly Space and Technology, Inc. (KST)/U.S. Air Force project known as Eclipse, which demonstrated a reusable tow launch vehicle concept. The purpose of the project was to demonstrate a reusable tow launch vehicle concept that had been conceived and patented by KST. Kelly Space obtained a contract with the USAF Research Laboratory for the tow launch demonstration project under the Small Business Innovation Research (SBIR) program. The USAF SBIR contract included the modifications to turn the QF-106 into the Experimental Demonstrator #1 (EXD-01), and the C141A aircraft to incorporate the tow provisions to link the two aircraft, as well as conducting flight tests. The demonstration consisted of ground and flight tests. These tests included a Combined Systems Test of both airplanes joined by a tow rope, a towed taxi test, and six towed flights. The primary goal of the project was demonstrating the tow phase of the Eclipse concept using a scaled-down tow aircraft (C-141A) and a representative aerodynamically-shaped aircraft (QF-106A) as a launch vehicle. This was successfully accomplished. On December 20, 1997, NASA research pilot Mark Stucky flew a QF-106 on the first towed flight behind an Air Force C-141 in the joint Eclipse project with KST to demonstrate the reusable tow launch vehicle concept developed by KST. Kelly hoped to use the data from the tow tests to validate a tow-to-launch procedure for reusable space launch vehicles. Stucky flew six successful tow tests between December 1997 and February 6, 1998. On February 6, 1998, the sixth and final towed flight brought the project to a successful completion. Preliminary flight results determined that the handling qualities of the QF-106 on tow were very stable; actual flight measured values of tow rope tension were well within predictions

The flights before the flight - An overview of shuttle astronaut training

Science.gov (United States)

Sims, John T.; Sterling, Michael R.

1989-01-01

Space shuttle astronaut training is centered at NASA's Johnson Space Center in Houston, Texas. Each astronaut receives many different types of training from many sources. This training includes simulator training in the Shuttle Mission Simulator, in-flight simulator training in the Shuttle Training Aircraft, Extravehicular Activity training in the Weightless Environment Training Facility and a variety of lectures and briefings. Once the training program is completed each shuttle flight crew is well-prepared to perform the normal operations required for their flight and deal with any shuttle system malfunctions that might occur.

Implementation and flight tests for the Digital Integrated Automatic Landing System (DIALS). Part 1: Flight software equations, flight test description and selected flight test data

Science.gov (United States)

Hueschen, R. M.

1986-01-01

Five flight tests of the Digital Automated Landing System (DIALS) were conducted on the Advanced Transport Operating Systems (ATOPS) Transportation Research Vehicle (TSRV) -- a modified Boeing 737 aircraft for advanced controls and displays research. These flight tests were conducted at NASA's Wallops Flight Center using the microwave landing system (MLS) installation on runway 22. This report describes the flight software equations of the DIALS which was designed using modern control theory direct-digital design methods and employed a constant gain Kalman filter. Selected flight test performance data is presented for localizer (runway centerline) capture and track at various intercept angles, for glideslope capture and track of 3, 4.5, and 5 degree glideslopes, for the decrab maneuver, and for the flare maneuver. Data is also presented to illustrate the system performance in the presence of cross, gust, and shear winds. The mean and standard deviation of the peak position errors for localizer capture were, respectively, 24 feet and 26 feet. For mild wind conditions, glideslope and localizer tracking position errors did not exceed, respectively, 5 and 20 feet. For gusty wind conditions (8 to 10 knots), these errors were, respectively, 10 and 30 feet. Ten hands off automatic lands were performed. The standard deviation of the touchdown position and velocity errors from the mean values were, respectively, 244 feet and 0.7 feet/sec.

Theseus Landing Following Maiden Flight

Science.gov (United States)

1996-01-01

The Theseus prototype research aircraft shows off its high aspect-ratio wing as it comes in for a landing on Rogers Dry Lake after its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able

Cooperative random Levy flight searches and the flight patterns of honeybees

International Nuclear Information System (INIS)

Reynolds, A.M.

2006-01-01

The most efficient Levy flight (scale-free) searching strategy for N independent searchers to adopt when target sites are randomly and sparsely distributed is identified. For N=1, it is well known that the optimal searching strategy is attained when μ=2, where the exponent μ characterizes the Levy distribution, P(l)=l -μ , of flight-lengths. For N>1, the optimal searching strategy is attained as μ->1. It is suggested that the orientation flights of honeybees can be understood within the context of such an optimal cooperative random Levy flight searching strategy. Upon returning to their hive after surveying a landscape honeybees can exchange information about the locations of target sites through the waggle dance. In accordance with observations it is predicted that the waggle dance can be disrupted without noticeable influence on a hive's ability to maintain weight when forage is plentiful

Factors of Predicted Learning Disorders and their Interaction with Attentional and Perceptual Training Procedures.

Science.gov (United States)

Friar, John T.

Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…

75 FR 14131 - Effect on Propane Consumers of the Propane Education and Research Council's Operations, Market...

Science.gov (United States)

2010-03-24

... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...

X-36 in Flight over Mojave Desert during 5th Flight

Science.gov (United States)

1997-01-01

The unusual lines of the X-36 Tailless Fighter Agility Research Aircraft contrast sharply with the desert floor as the remotely-piloted aircraft flies over the Mojave Desert on a June 1997 research flight. The NASA/Boeing X-36 Tailless Fighter Agility Research Aircraft program successfully demonstrated the tailless fighter design using advanced technologies to improve the maneuverability and survivability of possible future fighter aircraft. The program met or exceeded all project goals. For 31 flights during 1997 at the Dryden Flight Research Center, Edwards, California, the project team examined the aircraft's agility at low speed / high angles of attack and at high speed / low angles of attack. The aircraft's speed envelope reached up to 206 knots (234 mph). This aircraft was very stable and maneuverable. It handled very well. The X-36 vehicle was designed to fly without the traditional tail surfaces common on most aircraft. Instead, a canard forward of the wing was used as well as split ailerons and an advanced thrust-vectoring nozzle for directional control. The X-36 was unstable in both pitch and yaw axes, so an advanced, single-channel digital fly-by-wire control system (developed with some commercially available components) was put in place to stabilize the aircraft. Using a video camera mounted in the nose of the aircraft and an onboard microphone, the X-36 was remotely controlled by a pilot in a ground station virtual cockpit. A standard fighter-type head-up display (HUD) and a moving-map representation of the vehicle's position within the range in which it flew provided excellent situational awareness for the pilot. This pilot-in-the-loop approach eliminated the need for expensive and complex autonomous flight control systems and the risks associated with their inability to deal with unknown or unforeseen phenomena in flight. Fully fueled the X-36 prototype weighed approximately 1,250 pounds. It was 19 feet long and three feet high with a wingspan of

In-flight sleep, pilot fatigue and Psychomotor Vigilance Task performance on ultra-long range versus long range flights.

Science.gov (United States)

Gander, Philippa H; Signal, T Leigh; van den Berg, Margo J; Mulrine, Hannah M; Jay, Sarah M; Jim Mangie, Captain

2013-12-01

This study evaluated whether pilot fatigue was greater on ultra-long range (ULR) trips (flights >16 h on 10% of trips in a 90-day period) than on long range (LR) trips. The within-subjects design controlled for crew complement, pattern of in-flight breaks, flight direction and departure time. Thirty male Captains (mean age = 54.5 years) and 40 male First officers (mean age = 48.0 years) were monitored on commercial passenger flights (Boeing 777 aircraft). Sleep was monitored (actigraphy, duty/sleep diaries) from 3 days before the first study trip to 3 days after the second study trip. Karolinska Sleepiness Scale, Samn-Perelli fatigue ratings and a 5-min Psychomotor Vigilance Task were completed before, during and after every flight. Total sleep in the 24 h before outbound flights and before inbound flights after 2-day layovers was comparable for ULR and LR flights. All pilots slept on all flights. For each additional hour of flight time, they obtained an estimated additional 12.3 min of sleep. Estimated mean total sleep was longer on ULR flights (3 h 53 min) than LR flights (3 h 15 min; P(F) = 0.0004). Sleepiness ratings were lower and mean reaction speed was faster at the end of ULR flights. Findings suggest that additional in-flight sleep mitigated fatigue effectively on longer flights. Further research is needed to clarify the contributions to fatigue of in-flight sleep versus time awake at top of descent. The study design was limited to eastward outbound flights with two Captains and two First Officers. Caution must be exercised when extrapolating to different operations. © 2013 European Sleep Research Society.

The Orion Exploration Flight Test Post Flight Solid Particle Flight Environment Inspection and Analysis

Science.gov (United States)

Miller, Joshua E.

2016-01-01

Orbital debris in the millimeter size range can pose a hazard to current and planned spacecraft due to the high relative impact speeds in Earth orbit. Fortunately, orbital debris has a relatively short life at lower altitudes due to atmospheric effects; however, at higher altitudes orbital debris can survive much longer and has resulted in a band of high flux around 700 to 1,500 km above the surface of the Earth. While large orbital debris objects are tracked via ground based observation, little information can be gathered about small particles except by returned surfaces, which until the Orion Exploration Flight Test number one (EFT-1), has only been possible for lower altitudes (400 to 500 km). The EFT-1 crew module backshell, which used a porous, ceramic tile system with surface coatings, has been inspected post-flight for potential micrometeoroid and orbital debris (MMOD) damage. This paper describes the pre- and post-flight activities of inspection, identification and analysis of six candidate MMOD impact craters from the EFT-1 mission.

Manned Flight Simulator (MFS)

Data.gov (United States)

Federal Laboratory Consortium — The Aircraft Simulation Division, home to the Manned Flight Simulator (MFS), provides real-time, high fidelity, hardware-in-the-loop flight simulation capabilities...

NASA/FAA/NCAR Supercooled Large Droplet Icing Flight Research: Summary of Winter 1996-1997 Flight Operations

Science.gov (United States)

Miller, Dean; Ratvasky, Thomas; Bernstein, Ben; McDonough, Frank; Strapp, J. Walter

1998-01-01

During the winter of 1996-1997, a flight research program was conducted at the NASA-Lewis Research Center to study the characteristics of Supercooled Large Droplets (SLD) within the Great Lakes region. This flight program was a joint effort between the National Aeronautics and Space Administration (NASA), the National Center for Atmospheric Research (NCAR), and the Federal Aviation Administration (FAA). Based on weather forecasts and real-time in-flight guidance provided by NCAR, the NASA-Lewis Icing Research Aircraft was flown to locations where conditions were believed to be conducive to the formation of Supercooled Large Droplets aloft. Onboard instrumentation was then used to record meteorological, ice accretion, and aero-performance characteristics encountered during the flight. A total of 29 icing research flights were conducted, during which "conventional" small droplet icing, SLD, and mixed phase conditions were encountered aloft. This paper will describe how flight operations were conducted, provide an operational summary of the flights, present selected experimental results from one typical research flight, and conclude with practical "lessons learned" from this first year of operation.

In-flight Assessment of Lower Body Negative Pressure as a Countermeasure for Post-flight Orthostatic Intolerance

Science.gov (United States)

Charles, J. B.; Stenger, M. B.; Phillips, T. R.; Arzeno, N. M.; Lee, S. M. C.

2009-01-01

Introduction. We investigated the efficacy of combining fluid loading with sustained lower body negative pressure (LBNP) to reverse orthostatic intolerance associated with weightlessness during and immediately after Space Shuttle missions. Methods. Shuttle astronauts (n=13) underwent 4 hours of LBNP at -30 mm(Hg) and ingested water and salt ( soak treatment) during flight in two complementary studies. In the first study (n=8), pre-flight heart rate (HR) and blood pressure (BP) responses to an LBNP ramp (5-min stages of -10 mm(Hg) steps to -50 mm(Hg) were compared to responses in-flight one and two days after LBNP soak treatment. In the second study (n=5), the soak was performed 24 hr before landing, and post-flight stand test results of soak subjects were compared with those of an untreated cohort (n=7). In both studies, the soak was scheduled late in the mission and was preceded by LBNP ramp tests at approximately 3-day intervals to document the in-flight loss of orthostatic tolerance. Results. Increased HR and decreased BP responses to LBNP were evident early in-flight. In-flight, one day after LBNP soak, HR and BP responses to LBNP were not different from pre-flight, but the effect was absent the second day after treatment. Post-flight there were no between-group differences in HR and BP responses to standing, but all 5 treatment subjects completed the 5-minute stand test whereas 2 of 7 untreated cohort subjects did not. Discussion. Exaggerated HR and BP responses to LBNP were evident within the first few days of space flight, extending results from Skylab. The combined LBNP and fluid ingestion countermeasure restored in-flight LBNP HR and BP responses to pre-flight levels and provided protection of post-landing orthostatic function. Unfortunately, any benefits of the combined countermeasure were offset by the complexity of its implementation, making it inappropriate for routine application during Shuttle flights.

Vision based flight procedure stereo display system

Science.gov (United States)

Shen, Xiaoyun; Wan, Di; Ma, Lan; He, Yuncheng

2008-03-01

A virtual reality flight procedure vision system is introduced in this paper. The digital flight map database is established based on the Geographic Information System (GIS) and high definitions satellite remote sensing photos. The flight approaching area database is established through computer 3D modeling system and GIS. The area texture is generated from the remote sensing photos and aerial photographs in various level of detail. According to the flight approaching procedure, the flight navigation information is linked to the database. The flight approaching area vision can be dynamic displayed according to the designed flight procedure. The flight approaching area images are rendered in 2 channels, one for left eye images and the others for right eye images. Through the polarized stereoscopic projection system, the pilots and aircrew can get the vivid 3D vision of the flight destination approaching area. Take the use of this system in pilots preflight preparation procedure, the aircrew can get more vivid information along the flight destination approaching area. This system can improve the aviator's self-confidence before he carries out the flight mission, accordingly, the flight safety is improved. This system is also useful in validate the visual flight procedure design, and it helps to the flight procedure design.

Review on flight simulators (today and tomorrow); Flight simulatior no genjo to kongo

Energy Technology Data Exchange (ETDEWEB)

Komura, T. [Mitsubishi Precision Company Limited, Tokyo (Japan)

2000-04-05

This paper presents various flight simulators. A flight simulator is classified into that for R and D on aircraft and that for flight training according to its usage. As an example of the former, the general-purpose flight simulation test facility of National Aerospace Laboratory, Science and Technology Agency is in use for development of the STOL experimental aircraft 'Asuka' and simulation experiments for space development. A civil aircraft simulator simulating the interior of a cockpit, operation feeling of piloting devices, flight performance, dynamic characteristics, an engine system and a hydraulic system like a real aircraft is in wide use for training pilots. A fighter simulator for air force is used for training detection of enemy's aircraft by radar, and missile shooting. An antisubmarine patrol aircraft simulator is used for training detection of submarines by sonic detector and magnetic detector, and torpedo air-launching. For both simulators, real simulation of detection sensors or battle environment is required. (NEDO)

Flight Muscle Dimorphism and Heterogeneity in Flight Initiation of Field-Collected Triatoma infestans (Hemiptera: Reduviidae)

OpenAIRE

Gurevitz, Juan M.; Kitron, Uriel; Gürtler, Ricardo E.

2007-01-01

Recent experiments demonstrated that most field-collected Triatoma infestans (Klug) (Hemiptera: Reduviidae) adults from northern Argentina either never initiated flight or did so repeatedly in both sexes. This pattern could not be explained by sex, adult age, weight, weight-to-length ratio (W/L), or chance. We examined whether bugs that never initiated flight possessed developed flight muscles, and whether flight muscle mass relative to total body mass (FMR) was related to the probability of ...

14 CFR 27.151 - Flight controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight controls. 27.151 Section 27.151... STANDARDS: NORMAL CATEGORY ROTORCRAFT Flight Flight Characteristics § 27.151 Flight controls. (a) Longitudinal, lateral, directional, and collective controls may not exhibit excessive breakout force, friction...

14 CFR 29.151 - Flight controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight controls. 29.151 Section 29.151... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Flight Flight Characteristics § 29.151 Flight controls. (a) Longitudinal, lateral, directional, and collective controls may not exhibit excessive breakout force, friction...

Capital Flight from Russia

OpenAIRE

Prakash Loungani; Paolo Mauro

2000-01-01

This paper documents the scale of capital flight from Russia, compares it with that observed in other countries, and reviews policy options. The evidence from other countries suggests that capital flight can be reversed once reforms take hold. The paper argues that capital flight from Russia can only be curbed through a medium-term reform strategy aimed at improving governance and macroeconomic performance, and strengthening the banking system. Capital controls result in costly distortions an...

Passengers waste production during flights.

Science.gov (United States)

Tofalli, Niki; Loizia, Pantelitsa; Zorpas, Antonis A

2017-12-20

We assume that during flights the amount of waste that is produced is limited. However, daily, approximately 8000 commercial airplanes fly above Europe's airspace while at the same time, more than 17,000 commercial flights exist in the entire world. Using primary data from airlines, which use the Larnaca's International Airport (LIA) in Cyprus, we have tried to understand why wastes are produced during a typical flight such as food waste, paper, and plastics, as well as how passengers affect the production of those wastes. The compositional analysis took place on 27 flights of 4 different airlines which used LIA as final destination. The evaluation indicated that the passenger's habits and ethics, and the policy of each airline produced different kinds of waste during the flights and especially food waste (FW). Furthermore, it was observed that the only waste management strategy that exists in place in the airport is the collection and the transportation of all those wastes from aircrafts and from the airport in the central unit for further treatment. Hence, this research indicated extremely difficulties to implement any specific waste minimization, or prevention practice or other sorting methods during the flights due to the limited time of the most flights (less than 3 h), the limited available space within the aircrafts, and the strictly safety roles that exist during the flights.

A Flight Control System Architecture for the NASA AirSTAR Flight Test Infrastructure

Science.gov (United States)

Murch, Austin M.

2008-01-01

A flight control system architecture for the NASA AirSTAR infrastructure has been designed to address the challenges associated with safe and efficient flight testing of research control laws in adverse flight conditions. The AirSTAR flight control system provides a flexible framework that enables NASA Aviation Safety Program research objectives, and includes the ability to rapidly integrate and test research control laws, emulate component or sensor failures, inject automated control surface perturbations, and provide a baseline control law for comparison to research control laws and to increase operational efficiency. The current baseline control law uses an angle of attack command augmentation system for the pitch axis and simple stability augmentation for the roll and yaw axes.

Free Flight Rotorcraft Flight Test Vehicle Technology Development

Science.gov (United States)

Hodges, W. Todd; Walker, Gregory W.

1994-01-01

A rotary wing, unmanned air vehicle (UAV) is being developed as a research tool at the NASA Langley Research Center by the U.S. Army and NASA. This development program is intended to provide the rotorcraft research community an intermediate step between rotorcraft wind tunnel testing and full scale manned flight testing. The technologies under development for this vehicle are: adaptive electronic flight control systems incorporating artificial intelligence (AI) techniques, small-light weight sophisticated sensors, advanced telepresence-telerobotics systems and rotary wing UAV operational procedures. This paper briefly describes the system's requirements and the techniques used to integrate the various technologies to meet these requirements. The paper also discusses the status of the development effort. In addition to the original aeromechanics research mission, the technology development effort has generated a great deal of interest in the UAV community for related spin-off applications, as briefly described at the end of the paper. In some cases the technologies under development in the free flight program are critical to the ability to perform some applications.

76 FR 16236 - Prohibition Against Certain Flights Within the Tripoli (HLLL) Flight Information Region (FIR)

Science.gov (United States)

2011-03-23

... Tripoli (HLLL) Flight Information Region (FIR) AGENCY: Federal Aviation Administration (FAA), Department... the Tripoli (HLLL) Flight Information Region (FIR) by all U.S. air carriers; U.S. commercial operators...) Flight Information Region (FIR). (a) Applicability. This section applies to the following persons: (1...

78 FR 66261 - Certified Flight Instructor Flight Reviews; Recent Pilot in Command Experience; Airmen Online...

Science.gov (United States)

2013-11-05

...-0780; Amdt. No. 61-131] RIN 2120-AK23 Certified Flight Instructor Flight Reviews; Recent Pilot in Command Experience; Airmen Online Services; Confirmation of Effective Date AGENCY: Federal Aviation...-calendar month flight review requirements. This rule also clarifies that the generally applicable recent...

78 FR 56822 - Certified Flight Instructor Flight Reviews; Recent Pilot in Command Experience; Airmen Online...

Science.gov (United States)

2013-09-16

...-0780; Amdt. No. 61-131] RIN 2120-AK23 Certified Flight Instructor Flight Reviews; Recent Pilot in Command Experience; Airmen Online Services AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... review requirements. This rule also clarifies that the generally applicable recent flight experience...

Flight to Safety from European Stock Markets

DEFF Research Database (Denmark)

Aslanidis, Nektarios; Christiansen, Charlotte

-return trade-off is positive and during flight-to-safety episodes it is negative. The effects of flight-to-safety episodes on the risk-return trade-off are qualitatively similar for own country flight-to-safety episodes, for flight from own country stock market to the US bond market, and for US flight......This paper investigates flight-to-safety from stocks to bonds in seven European markets. We use quantile regressions to identify flight-to-safety episodes. The simple risk-return trade-off on the stock markets is negative which is caused by flight-to-safety episodes: During normal periods, the risk...

Asset Analysis and Operational Concepts for Separation Assurance Flight Testing at Dryden Flight Research Center

Science.gov (United States)

Costa, Guillermo J.; Arteaga, Ricardo A.

2011-01-01

A preliminary survey of existing separation assurance and collision avoidance advancements, technologies, and efforts has been conducted in order to develop a concept of operations for flight testing autonomous separation assurance at Dryden Flight Research Center. This effort was part of the Unmanned Aerial Systems in the National Airspace System project. The survey focused primarily on separation assurance projects validated through flight testing (including lessons learned), however current forays into the field were also examined. Comparisons between current Dryden flight and range assets were conducted using House of Quality matrices in order to allow project management to make determinations regarding asset utilization for future flight tests. This was conducted in order to establish a body of knowledge of the current collision avoidance landscape, and thus focus Dryden s efforts more effectively towards the providing of assets and test ranges for future flight testing within this research field.

CONTABILIDAD CASTELLANA EN LA PRIMERA MITAD DEL SIGLO XIX: EL LIBRO DE CUENTAS DE MANUEL MARTÍNEZ LERMA

Directory of Open Access Journals (Sweden)

Juan José Martín García

2016-07-01

Full Text Available La aparición en un archivo particular de la localidad burgalesa de Pradoluengo, del libro de cuentas de Manuel Martínez Lerma, y su análisis desde los puntos de vista formal, conceptual y de contenidos, supone uno de los pocos casos sobre contabilidad privada, estudiados en el ámbito rural castellano de la primera mitad del siglo XIX.                   En su funcionamiento interno, este documento contable es deudor de la tradición castellana. Su fin es eminentemente práctico y su contexto cronológico le hace no estar sujeto a supervisiones de estamentos superiores, lo que le otorga una verosimilitud prácticamente absoluta. Sin lugar a dudas, supuso la piedra angular del trabajo de despacho de su redactor, quien, a pesar de declarar como actividad principal la de escribano, diversificó sus negocios en multitud de ámbitos: fabricación de tejidos, comercio al por menor, actividades financieras y de préstamo, compraventa de lanas, adquisición de tierras e inmuebles, etcétera.                  La versatilidad de nuestro personaje, se plasma en múltiples perspectivas que manan constantemente del libro de cuentas, cuyo análisis hemos apoyado con documentación notarial, parroquial y municipal. Manuel se situará progresivamente en lo más alto de la cúspide social, estableciendo relaciones clientelares con grandes comerciantes, convirtiéndose en un destacado fabricante local, accediendo a puestos de responsabilidad municipal, fijando alianzas matrimoniales ventajosas para sus hijos, o siendo pieza clave en el encumbramiento de uno de ellos como arzobispo de Manila.

The reproduction of sea birds of La Hague and of the Nez-de-Jobourg: The search for reasons of decline (Manche)

International Nuclear Information System (INIS)

James, Jean-Baptiste

2001-11-01

Since 1965, the site of the Nez-de-Jobourg, in the Manche district and at the vicinity of the La Hague plant, has been a site of ornithological follow-up, notably because it harbours different population of nesting sea birds. Since 1990, it has been noticed that the population of European shags has been keeping on decreasing, with abnormally low birth rate, while the European herring gull has totally disappeared. If the relationship between this decline and the releases of the La Hague nuclear waste processing plant is easily and quickly suspected, other reasons are also plausible. The authors report a study of this decline and an investigation of its possible origins. After a presentation of the site, of its status regarding hunting and specie protection, and a presentation of other close sites (small islands, bay), the report addresses the case of the European shag. It gives information on its biology, characteristics, location and population, reproduction sites and nesting cycle. It presents the method adopted to test the various hypotheses of origin of the noticed decline: contamination by radioactive materials or by chemical substances, problems of disturbance by fishers, tourists or others, problems of predation, parasitism or lack of food resources. Samplings have been performed within the studied site and also within reference sites located some miles away. Based on data and observations, hypotheses are then discussed. An analytical report of measurement of artificial radio-elements performed by gamma spectrometry is provided

Solar array flight dynamic experiment

Science.gov (United States)

Schock, Richard W.

1987-01-01

The purpose of the Solar Array Flight Dynamic Experiment (SAFDE) is to demonstrate the feasibility of on-orbit measurement and ground processing of large space structures' dynamic characteristics. Test definition or verification provides the dynamic characteristic accuracy required for control systems use. An illumination/measurement system was developed to fly on space shuttle flight STS-41D. The system was designed to dynamically evaluate a large solar array called the Solar Array Flight Experiment (SAFE) that had been scheduled for this flight. The SAFDE system consisted of a set of laser diode illuminators, retroreflective targets, an intelligent star tracker receiver and the associated equipment to power, condition, and record the results. In six tests on STS-41D, data was successfully acquired from 18 retroreflector targets and ground processed, post flight, to define the solar array's dynamic characteristic. The flight experiment proved the viability of on-orbit test definition of large space structures dynamic characteristics. Future large space structures controllability should be greatly enhanced by this capability.

System Identification of Flight Mechanical Characteristics

OpenAIRE

Larsson, Roger

2013-01-01

With the demand for more advanced fighter aircraft, relying on relaxed stability or even unstable flight mechanical characteristics to gain flight performance, more focus has been put on model-based system engineering to help with the design work. The flight control system design is one important part that relies on this modeling. Therefore it has become more important to develop flight mechanical models that are highly accurate in the whole flight envelop. For today’s newly developed fighter...

Aerodynamics of bird flight

Directory of Open Access Journals (Sweden)

Dvořák Rudolf

2016-01-01

Full Text Available Unlike airplanes birds must have either flapping or oscillating wings (the hummingbird. Only such wings can produce both lift and thrust – two sine qua non attributes of flying.The bird wings have several possibilities how to obtain the same functions as airplane wings. All are realized by the system of flight feathers. Birds have also the capabilities of adjusting the shape of the wing according to what the immediate flight situation demands, as well as of responding almost immediately to conditions the flow environment dictates, such as wind gusts, object avoidance, target tracking, etc. In bird aerodynamics also the tail plays an important role. To fly, wings impart downward momentum to the surrounding air and obtain lift by reaction. How this is achieved under various flight situations (cruise flight, hovering, landing, etc., and what the role is of the wing-generated vortices in producing lift and thrust is discussed.The issue of studying bird flight experimentally from in vivo or in vitro experiments is also briefly discussed.

Production Support Flight Control Computers: Research Capability for F/A-18 Aircraft at Dryden Flight Research Center

Science.gov (United States)

Carter, John F.

1997-01-01

NASA Dryden Flight Research Center (DFRC) is working with the United States Navy to complete ground testing and initiate flight testing of a modified set of F/A-18 flight control computers. The Production Support Flight Control Computers (PSFCC) can give any fleet F/A-18 airplane an in-flight, pilot-selectable research control law capability. NASA DFRC can efficiently flight test the PSFCC for the following four reasons: (1) Six F/A-18 chase aircraft are available which could be used with the PSFCC; (2) An F/A-18 processor-in-the-loop simulation exists for validation testing; (3) The expertise has been developed in programming the research processor in the PSFCC; and (4) A well-defined process has been established for clearing flight control research projects for flight. This report presents a functional description of the PSFCC. Descriptions of the NASA DFRC facilities, PSFCC verification and validation process, and planned PSFCC projects are also provided.

Orion Exploration Flight Test Reaction Control System Jet Interaction Heating Environment from Flight Data

Science.gov (United States)

White, Molly E.; Hyatt, Andrew J.

2016-01-01

The Orion Multi-Purpose Crew Vehicle (MPCV) Reaction Control System (RCS) is critical to guide the vehicle along the desired trajectory during re-­-entry. However, this system has a significant impact on the convective heating environment to the spacecraft. Heating augmentation from the jet interaction (JI) drives thermal protection system (TPS) material selection and thickness requirements for the spacecraft. This paper describes the heating environment from the RCS on the afterbody of the Orion MPCV during Orion's first flight test, Exploration Flight Test 1 (EFT-1). These jet plumes interact with the wake of the crew capsule and cause an increase in the convective heating environment. Not only is there widespread influence from the jet banks, there may also be very localized effects. The firing history during EFT-1 will be summarized to assess which jet bank interaction was measured during flight. Heating augmentation factors derived from the reconstructed flight data will be presented. Furthermore, flight instrumentation across the afterbody provides the highest spatial resolution of the region of influence of the individual jet banks of any spacecraft yet flown. This distribution of heating augmentation across the afterbody will be derived from the flight data. Additionally, trends with possible correlating parameters will be investigated to assist future designs and ground testing programs. Finally, the challenges of measuring JI, applying this data to future flights and lessons learned will be discussed.

Flight testing a propulsion-controlled aircraft emergency flight control system on an F-15 airplane

Science.gov (United States)

Burcham, F. W., Jr.; Burken, John; Maine, Trindel A.

1994-01-01

Flight tests of a propulsion-controlled aircraft (PCA) system on an F-15 airplane have been conducted at the NASA Dryden Flight Research Center. The airplane was flown with all flight control surfaces locked both in the manual throttles-only mode and in an augmented system mode. In the latter mode, pilot thumbwheel commands and aircraft feedback parameters were used to position the throttles. Flight evaluation results showed that the PCA system can be used to land an airplane that has suffered a major flight control system failure safely. The PCA system was used to recover the F-15 airplane from a severe upset condition, descend, and land. Pilots from NASA, U.S. Air Force, U.S. Navy, and McDonnell Douglas Aerospace evaluated the PCA system and were favorably impressed with its capability. Manual throttles-only approaches were unsuccessful. This paper describes the PCA system operation and testing. It also presents flight test results and pilot comments.

Investigation of controlled flight into terrain : descriptions of flight paths for selected controlled flight into terrain (CFIT) aircraft accidents, 1985-1997

Science.gov (United States)

1999-03-01

This report documents an investigation of the flight paths of 13 selected controlled flight into terrain (CFIT) aircraft accidents that occurred between 1985 and 1997. The Operations Assessment Division (DTS-43) and the Aviation Safety Division (DTS-...

The development of a Flight Test Engineer's Workstation for the Automated Flight Test Management System

Science.gov (United States)

Tartt, David M.; Hewett, Marle D.; Duke, Eugene L.; Cooper, James A.; Brumbaugh, Randal W.

1989-01-01

The Automated Flight Test Management System (ATMS) is being developed as part of the NASA Aircraft Automation Program. This program focuses on the application of interdisciplinary state-of-the-art technology in artificial intelligence, control theory, and systems methodology to problems of operating and flight testing high-performance aircraft. The development of a Flight Test Engineer's Workstation (FTEWS) is presented, with a detailed description of the system, technical details, and future planned developments. The goal of the FTEWS is to provide flight test engineers and project officers with an automated computer environment for planning, scheduling, and performing flight test programs. The FTEWS system is an outgrowth of the development of ATMS and is an implementation of a component of ATMS on SUN workstations.

14 CFR 141.41 - Flight simulators, flight training devices, and training aids.

Science.gov (United States)

2010-01-01

..., and training aids. 141.41 Section 141.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... aids. An applicant for a pilot school certificate or a provisional pilot school certificate must show that its flight simulators, flight training devices, training aids, and equipment meet the following...

The use of an automated flight test management system in the development of a rapid-prototyping flight research facility

Science.gov (United States)

Duke, Eugene L.; Hewett, Marle D.; Brumbaugh, Randal W.; Tartt, David M.; Antoniewicz, Robert F.; Agarwal, Arvind K.

1988-01-01

An automated flight test management system (ATMS) and its use to develop a rapid-prototyping flight research facility for artificial intelligence (AI) based flight systems concepts are described. The ATMS provides a flight test engineer with a set of tools that assist in flight planning and simulation. This system will be capable of controlling an aircraft during the flight test by performing closed-loop guidance functions, range management, and maneuver-quality monitoring. The rapid-prototyping flight research facility is being developed at the Dryden Flight Research Facility of the NASA Ames Research Center (Ames-Dryden) to provide early flight assessment of emerging AI technology. The facility is being developed as one element of the aircraft automation program which focuses on the qualification and validation of embedded real-time AI-based systems.

X-1A in flight with flight data superimposed

Science.gov (United States)

1953-01-01

This photo of the X-1A includes graphs of the flight data from Maj. Charles E. Yeager's Mach 2.44 flight on December 12, 1953. (This was only a few days short of the 50th anniversary of the Wright brothers' first powered flight.) After reaching Mach 2.44, then the highest speed ever reached by a piloted aircraft, the X-1A tumbled completely out of control. The motions were so violent that Yeager cracked the plastic canopy with his helmet. He finally recovered from a inverted spin and landed on Rogers Dry Lakebed. Among the data shown are Mach number and altitude (the two top graphs). The speed and altitude changes due to the tumble are visible as jagged lines. The third graph from the bottom shows the G-forces on the airplane. During the tumble, these twice reached 8 Gs or 8 times the normal pull of gravity at sea level. (At these G forces, a 200-pound human would, in effect, weigh 1,600 pounds if a scale were placed under him in the direction of the force vector.) Producing these graphs was a slow, difficult process. The raw data from on-board instrumentation recorded on oscillograph film. Human computers then reduced the data and recorded it on data sheets, correcting for such factors as temperature and instrument errors. They used adding machines or slide rules for their calculations, pocket calculators being 20 years in the future. Three second generation Bell Aircraft Corporations X-1s were built, though four were requested. They were the X-1A (48-1384); X-1B (48-1385); X-1C (canceled and never built); X-1D (48-1386). These aircraft were similar to the X-1s, except they were five feet longer, had conventional canopies, and were powered by Reaction Motors, Inc. XLR11-RM-5 rocket engines. The RM-5, like the previous engines, had no throttle and was controlled by igniting one or more of the four thrust chambers at will. The original program outline called for the X-1A and X-1B to be used for dynamic stability and air loads investigations. The X-1D was to be used

14 CFR 63.43 - Flight engineer courses.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight engineer courses. 63.43 Section 63...) AIRMEN CERTIFICATION: FLIGHT CREWMEMBERS OTHER THAN PILOTS Flight Engineers § 63.43 Flight engineer courses. An applicant for approval of a flight engineer course must submit a letter to the Administrator...

Design and utilization of a Flight Test Engineering Database Management System at the NASA Dryden Flight Research Facility

Science.gov (United States)

Knighton, Donna L.

1992-01-01

A Flight Test Engineering Database Management System (FTE DBMS) was designed and implemented at the NASA Dryden Flight Research Facility. The X-29 Forward Swept Wing Advanced Technology Demonstrator flight research program was chosen for the initial system development and implementation. The FTE DBMS greatly assisted in planning and 'mass production' card preparation for an accelerated X-29 research program. Improved Test Plan tracking and maneuver management for a high flight-rate program were proven, and flight rates of up to three flights per day, two times per week were maintained.

Magnesium and Space Flight

Science.gov (United States)

Smith, Scott M.; Zwart, Sara R.

2015-01-01

Magnesium is an essential nutrient for muscle, cardiovascular, and bone health on Earth, and during space flight. We sought to evaluate magnesium status in 43 astronauts (34 male, 9 female; 47 ± 5 years old, mean ± SD) before, during, and after 4–6-month space missions. We also studied individuals participating in a ground analog of space flight (head-down-tilt bed rest; n = 27 (17 male, 10 female), 35 ± 7 years old). We evaluated serum concentration and 24-h urinary excretion of magnesium, along with estimates of tissue magnesium status from sublingual cells. Serum magnesium increased late in flight, while urinary magnesium excretion was higher over the course of 180-day space missions. Urinary magnesium increased during flight but decreased significantly at landing. Neither serum nor urinary magnesium changed during bed rest. For flight and bed rest, significant correlations existed between the area under the curve of serum and urinary magnesium and the change in total body bone mineral content. Tissue magnesium concentration was unchanged after flight and bed rest. Increased excretion of magnesium is likely partially from bone and partially from diet, but importantly, it does not come at the expense of muscle tissue stores. While further study is needed to better understand the implications of these findings for longer space exploration missions, magnesium homeostasis and tissue status seem well maintained during 4–6-month space missions. PMID:26670248

Magnesium and Space Flight

Directory of Open Access Journals (Sweden)

Scott M. Smith

2015-12-01

Full Text Available Magnesium is an essential nutrient for muscle, cardiovascular, and bone health on Earth, and during space flight. We sought to evaluate magnesium status in 43 astronauts (34 male, 9 female; 47 ± 5 years old, mean ± SD before, during, and after 4–6-month space missions. We also studied individuals participating in a ground analog of space flight (head-down-tilt bed rest; n = 27 (17 male, 10 female, 35 ± 7 years old. We evaluated serum concentration and 24-h urinary excretion of magnesium, along with estimates of tissue magnesium status from sublingual cells. Serum magnesium increased late in flight, while urinary magnesium excretion was higher over the course of 180-day space missions. Urinary magnesium increased during flight but decreased significantly at landing. Neither serum nor urinary magnesium changed during bed rest. For flight and bed rest, significant correlations existed between the area under the curve of serum and urinary magnesium and the change in total body bone mineral content. Tissue magnesium concentration was unchanged after flight and bed rest. Increased excretion of magnesium is likely partially from bone and partially from diet, but importantly, it does not come at the expense of muscle tissue stores. While further study is needed to better understand the implications of these findings for longer space exploration missions, magnesium homeostasis and tissue status seem well maintained during 4–6-month space missions.

Flight Technical Error Analysis of the SATS Higher Volume Operations Simulation and Flight Experiments

Science.gov (United States)

Williams, Daniel M.; Consiglio, Maria C.; Murdoch, Jennifer L.; Adams, Catherine H.

2005-01-01

This paper provides an analysis of Flight Technical Error (FTE) from recent SATS experiments, called the Higher Volume Operations (HVO) Simulation and Flight experiments, which NASA conducted to determine pilot acceptability of the HVO concept for normal operating conditions. Reported are FTE results from simulation and flight experiment data indicating the SATS HVO concept is viable and acceptable to low-time instrument rated pilots when compared with today s system (baseline). Described is the comparative FTE analysis of lateral, vertical, and airspeed deviations from the baseline and SATS HVO experimental flight procedures. Based on FTE analysis, all evaluation subjects, low-time instrument-rated pilots, flew the HVO procedures safely and proficiently in comparison to today s system. In all cases, the results of the flight experiment validated the results of the simulation experiment and confirm the utility of the simulation platform for comparative Human in the Loop (HITL) studies of SATS HVO and Baseline operations.

Advanced in-flight measurement techniques

CERN Document Server

Lawson, Nicholas; Jentink, Henk; Kompenhans, Jürgen

2013-01-01

The book presents a synopsis of the main results achieved during the 3 year EU-project "Advanced Inflight Measurement Techniques (AIM)" which applied advanced image based measurement techniques to industrial flight testing. The book is intended to be not only an overview on the AIM activities but also a guide on the application of advanced optical measurement techniques for future flight testing. Furthermore it is a useful guide for engineers in the field of experimental methods and flight testing who face the challenge of a future requirement for the development of highly accurate non-intrusive in-flight measurement techniques.

Armstrong Flight Research Center Flight Test Capabilities and Opportunities for the Applications of Wireless Data Acquisition Systems

Science.gov (United States)

Hang, Richard

2015-01-01

The presentation will overview NASA Armstrong Flight Research Centers flight test capabilities, which can provide various means for flight testing of passive and active wireless sensor systems, also, it will address the needs of the wireless data acquisition solutions for the centers flight instrumentation issues such as additional weight caused by added instrumentation wire bundles, connectors, wire cables routing, moving components, etc., that the Passive Wireless Sensor Technology Workshop may help. The presentation shows the constraints and requirements that the wireless sensor systems will face in the flight test applications.

Flight demonstration of flight termination system and solid rocket motor ignition using semiconductor laser initiated ordnance

Science.gov (United States)

Schulze, Norman R.; Maxfield, B.; Boucher, C.

1995-01-01

Solid State Laser Initiated Ordnance (LIO) offers new technology having potential for enhanced safety, reduced costs, and improved operational efficiency. Concerns over the absence of programmatic applications of the technology, which has prevented acceptance by flight programs, should be abated since LIO has now been operationally implemented by the Laser Initiated Ordnance Sounding Rocket Demonstration (LOSRD) Program. The first launch of solid state laser diode LIO at the NASA Wallops Flight Facility (WFF) occurred on March 15, 1995 with all mission objectives accomplished. This project, Phase 3 of a series of three NASA Headquarters LIO demonstration initiatives, accomplished its objective by the flight of a dedicated, all-LIO sounding rocket mission using a two-stage Nike-Orion launch vehicle. LIO flight hardware, made by The Ensign-Bickford Company under NASA's first Cooperative Agreement with Profit Making Organizations, safely initiated three demanding pyrotechnic sequence events, namely, solid rocket motor ignition from the ground and in flight, and flight termination, i.e., as a Flight Termination System (FTS). A flight LIO system was designed, built, tested, and flown to support the objectives of quickly and inexpensively putting LIO through ground and flight operational paces. The hardware was fully qualified for this mission, including component testing as well as a full-scale system test. The launch accomplished all mission objectives in less than 11 months from proposal receipt. This paper concentrates on accomplishments of the ordnance aspects of the program and on the program's implementation and results. While this program does not generically qualify LIO for all applications, it demonstrated the safety, technical, and operational feasibility of those two most demanding applications, using an all solid state safe and arm system in critical flight applications.

Quantifying Pilot Contribution to Flight Safety During an In-Flight Airspeed Failure

Science.gov (United States)

Etherington, Timothy J.; Kramer, Lynda J.; Bailey, Randall E.; Kennedey, Kellie D.

2017-01-01

Accident statistics cite the flight crew as a causal factor in over 60% of large transport fatal accidents. Yet a well-trained and well-qualified crew is acknowledged as the critical center point of aircraft systems safety and an integral component of the entire commercial aviation system. A human-in-the-loop test was conducted using a Level D certified Boeing 737-800 simulator to evaluate the pilot's contribution to safety-of-flight during routine air carrier flight operations and in response to system failures. To quantify the human's contribution, crew complement was used as an independent variable in a between-subjects design. This paper details the crew's actions and responses while dealing with an in-flight airspeed failure. Accident statistics often cite flight crew error (Baker, 2001) as the primary contributor in accidents and incidents in transport category aircraft. However, the Air Line Pilots Association (2011) suggests "a well-trained and well-qualified pilot is acknowledged as the critical center point of the aircraft systems safety and an integral safety component of the entire commercial aviation system." This is generally acknowledged but cannot be verified because little or no quantitative data exists on how or how many accidents/incidents are averted by crew actions. Anecdotal evidence suggest crews handle failures on a daily basis and Aviation Safety Action Program data generally supports this assertion, even if the data is not released to the public. However without hard evidence, the contribution and means by which pilots achieve safety of flight is difficult to define. Thus, ways to improve the human ability to contribute or overcome deficiencies are ill-defined.

Theseus First Flight - May 24, 1996

Science.gov (United States)

1996-01-01

The Theseus prototype research aircraft shows off its high aspect-ratio wing as it lifts off from Rogers Dry Lake during its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to

Altitude exposures during commercial flight: a reappraisal.

Science.gov (United States)

Hampson, Neil B; Kregenow, David A; Mahoney, Anne M; Kirtland, Steven H; Horan, Kathleen L; Holm, James R; Gerbino, Anthony J

2013-01-01

Hypobaric hypoxia during commercial air travel has the potential to cause or worsen hypoxemia in individuals with pre-existing cardiopulmonary compromise. Knowledge of cabin altitude pressures aboard contemporary flights is essential to counseling patients accurately about flying safety. The objective of the study was to measure peak cabin altitudes during U.S. domestic commercial flights on a variety of aircraft. A handheld mountaineering altimeter was carried by the investigators in the plane cabin during commercial air travel and peak cabin altitude measured. The values were then compared between aircraft models, aircraft classes, and distances flown. The average peak cabin altitude on 207 flights aboard 17 different aircraft was 6341 +/- 1813 ft (1933 m +/- 553 m), significantly higher than when measured in a similar fashion in 1988. Peak cabin altitude was significantly higher for flights longer than 750 mi (7085 +/- 801 ft) compared to shorter flights (5160 +/- 2290 ft/1573 +/- 698 m). Cabin altitude increased linearly with flight distance for flights up to 750 mi in length, but was independent of flight distance for flights exceeding 750 mi. Peak cabin altitude was less than 5000 ft (1524 m) in 70% of flights shorter than 500 mi. Peak cabin altitudes greater than 8000 ft (2438 m) were measured on approximately 10% of the total flights. Peak cabin altitude on commercial aircraft flights has risen over time. Cabin altitude is lower with flights of shorter distance. Physicians should take these factors into account when determining an individual's need for supplemental oxygen during commercial air travel.

Poor flight performance in deep-diving cormorants.

Science.gov (United States)

Watanabe, Yuuki Y; Takahashi, Akinori; Sato, Katsufumi; Viviant, Morgane; Bost, Charles-André

2011-02-01

Aerial flight and breath-hold diving present conflicting morphological and physiological demands, and hence diving seabirds capable of flight are expected to face evolutionary trade-offs regarding locomotory performances. We tested whether Kerguelen shags Phalacrocorax verrucosus, which are remarkable divers, have poor flight capability using newly developed tags that recorded their flight air speed (the first direct measurement for wild birds) with propeller sensors, flight duration, GPS position and depth during foraging trips. Flight air speed (mean 12.7 m s(-1)) was close to the speed that minimizes power requirement, rather than energy expenditure per distance, when existing aerodynamic models were applied. Flights were short (mean 92 s), with a mean summed duration of only 24 min day(-1). Shags sometimes stayed at the sea surface without diving between flights, even on the way back to the colony, and surface durations increased with the preceding flight durations; these observations suggest that shags rested after flights. Our results indicate that their flight performance is physiologically limited, presumably compromised by their great diving capability (max. depth 94 m, duration 306 s) through their morphological adaptations for diving, including large body mass (enabling a large oxygen store), small flight muscles (to allow for large leg muscles for underwater propulsion) and short wings (to decrease air volume in the feathers and hence buoyancy). The compromise between flight and diving, as well as the local bathymetry, shape the three-dimensional foraging range (<26 km horizontally, <94 m vertically) in this bottom-feeding cormorant.

Development and Flight Test of an Augmented Thrust-Only Flight Control System on an MD-11 Transport Airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Maine, Trindel A.; Burken, John J.; Pappas, Drew

1996-01-01

An emergency flight control system using only engine thrust, called Propulsion-Controlled Aircraft (PCA), has been developed and flight tested on an MD-11 airplane. In this thrust-only control system, pilot flight path and track commands and aircraft feedback parameters are used to control the throttles. The PCA system was installed on the MD-11 airplane using software modifications to existing computers. Flight test results show that the PCA system can be used to fly to an airport and safely land a transport airplane with an inoperative flight control system. In up-and-away operation, the PCA system served as an acceptable autopilot capable of extended flight over a range of speeds and altitudes. The PCA approaches, go-arounds, and three landings without the use of any non-nal flight controls have been demonstrated, including instrument landing system-coupled hands-off landings. The PCA operation was used to recover from an upset condition. In addition, PCA was tested at altitude with all three hydraulic systems turned off. This paper reviews the principles of throttles-only flight control; describes the MD-11 airplane and systems; and discusses PCA system development, operation, flight testing, and pilot comments.

Nutritional Biochemistry of Space Flight

Science.gov (United States)

Smith, Scott M.

2000-01-01

Adequate nutrition is critical for maintenance of crew health during and after extended-duration space flight. The impact of weightlessness on human physiology is profound, with effects on many systems related to nutrition, including bone, muscle, hematology, fluid and electrolyte regulation. Additionally, we have much to learn regarding the impact of weightlessness on absorption, mtabolism , and excretion of nutrients, and this will ultimately determine the nutrient requirements for extended-duration space flight. Existing nutritional requirements for extended-duration space flight have been formulated based on limited flight research, and extrapolation from ground-based research. NASA's Nutritional Biochemistry Laboratory is charged with defining the nutritional requirements for space flight. This is accomplished through both operational and research projects. A nutritional status assessment program is included operationally for all International Space Station astronauts. This medical requirement includes biochemical and dietary assessments, and is completed before, during, and after the missions. This program will provide information about crew health and nutritional status, and will also provide assessments of countermeasure efficacy. Ongoing research projects include studies of calcium and bone metabolism, and iron absorption and metabolism. The calcium studies include measurements of endocrine regulation of calcium homeostasis, biochemical marker of bone metabolism, and tracer kinetic studies of calcium movement in the body. These calcium kinetic studies allow for estimation of intestinal absorption, urinary excretion, and perhaps most importantly - deposition and resorption of calcium from bone. The Calcium Kinetics experiment is currently being prepared for flight on the Space Shuttle in 2001, and potentially for subsequent Shuttle and International Space Station missions. The iron study is intended to assess whether iron absorption is down-regulated dUl1ng

In-flight Fault Detection and Isolation in Aircraft Flight Control Systems

Science.gov (United States)

Azam, Mohammad; Pattipati, Krishna; Allanach, Jeffrey; Poll, Scott; Patterson-Hine, Ann

2005-01-01

In this paper we consider the problem of test design for real-time fault detection and isolation (FDI) in the flight control system of fixed-wing aircraft. We focus on the faults that are manifested in the control surface elements (e.g., aileron, elevator, rudder and stabilizer) of an aircraft. For demonstration purposes, we restrict our focus on the faults belonging to nine basic fault classes. The diagnostic tests are performed on the features extracted from fifty monitored system parameters. The proposed tests are able to uniquely isolate each of the faults at almost all severity levels. A neural network-based flight control simulator, FLTZ(Registered TradeMark), is used for the simulation of various faults in fixed-wing aircraft flight control systems for the purpose of FDI.

CARACTERIZACIÓN TECNOLÓGICA DE LA MADERA DE Juniperus flaccida VAR. POBLANA MARTÍNEZ

Directory of Open Access Journals (Sweden)

A. Borja de la Rosa

2010-01-01

Full Text Available El presente estudio se realizó con la finalidad de conocer las características y propiedades tecnológicas de la madera de Juniperus flaccida var. poblana Martínez, para lo cual se utilizó la metodología del Laboratorio de Anatomía y Tecnología de la Madera de la División de Ciencias Forestales de la Universidad Autónoma Chapingo. Las propiedades físicas se determinaron según la norma NOM-EE-167-83 y las mecánicas de acuerdo a las normas ASTM 143-83 en el Campo Experimental San Martinito, del Instituto de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP. Los resultados con relación a las características anatómicas fueron los siguientes: la madera presenta un color castaño claro en el duramen y amarillo pálido en la albura, brillo medio, veteado suave, textura fina, hilo recto, sabor característico y olor aromático. Las traqueidas son largas, de diámetro tangencial mediano y paredes delgadas; presentan una hilera de puntuaciones areoladas seriadas, las puntuaciones de los campos de cruzamiento son tipo cupresoide y el parénquima axial es escaso. Los rayos de tipo uniseriados numerosos, muy bajos y muy angostos; los rayos y las células parenquimatosas axiales presentan aceites. La proporción de elementos fue 92 % de traqueidas, 7.72 de parénquima de rayo y 0.18 % de parénquima axial. La densidad básica fue de 0.50 g·cm-3, las contracciones totales fueron: volumétrica de 8.42 %, tangencial de 4.26 % y radial de 3.02 %; y los hinchamientos totales: volumétrico de 9.17 %, tangencial de 4.45 % y radial de 3.12 %. El punto de saturación de la fibra fue de 33 %; el coeficiente de hinchamiento 0.278 %, y la relación de anisotropía de 1.41. Los valores promedio de las propiedades mecánicas al 12 % de contenido de humedad (CH y en condición verde, se clasificaron de medios a bajos en ambas condiciones de contenido de humedad. Considerando las características anatómicas y los valores de las propiedades f

Digital virtual flight testing and evaluation method for flight characteristics airworthiness compliance of civil aircraft based on HQRM

Directory of Open Access Journals (Sweden)

Fan Liu

2015-02-01

Full Text Available In order to incorporate airworthiness requirements for flight characteristics into the entire development cycle of electronic flight control system (EFCS equipped civil aircraft, digital virtual flight testing and evaluation method based on handling qualities rating method (HQRM is proposed. First, according to HQRM, flight characteristics airworthiness requirements of civil aircraft in EFCS failure states are determined. On this basis, digital virtual flight testing model, comprising flight task digitized model, pilot controlling model, aircraft motion and atmospheric turbulence model, is used to simulate the realistic process of a pilot controlling an airplane to perform assigned flight tasks. According to the simulation results, flight characteristics airworthiness compliance of the airplane can be evaluated relying on the relevant regulations for handling qualities (HQ rating. Finally, this method is applied to a type of passenger airplane in a typical EFCS failure state, and preliminary conclusions concerning airworthiness compliance are derived quickly. The research results of this manuscript can provide important theoretical reference for EFCS design and actual airworthiness compliance verification of civil aircraft.

Supersonic Retropropulsion Flight Test Concepts

Science.gov (United States)

Post, Ethan A.; Dupzyk, Ian C.; Korzun, Ashley M.; Dyakonov, Artem A.; Tanimoto, Rebekah L.; Edquist, Karl T.

2011-01-01

NASA's Exploration Technology Development and Demonstration Program has proposed plans for a series of three sub-scale flight tests at Earth for supersonic retropropulsion, a candidate decelerator technology for future, high-mass Mars missions. The first flight test in this series is intended to be a proof-of-concept test, demonstrating successful initiation and operation of supersonic retropropulsion at conditions that replicate the relevant physics of the aerodynamic-propulsive interactions expected in flight. Five sub-scale flight test article concepts, each designed for launch on sounding rockets, have been developed in consideration of this proof-of-concept flight test. Commercial, off-the-shelf components are utilized as much as possible in each concept. The design merits of the concepts are compared along with their predicted performance for a baseline trajectory. The results of a packaging study and performance-based trade studies indicate that a sounding rocket is a viable launch platform for this proof-of-concept test of supersonic retropropulsion.

14 CFR 91.1061 - Augmented flight crews.

Science.gov (United States)

2010-01-01

...) Minimum After Duty Rest Period for Multi-Time Zone Flights 18 hours 24 hours ...) AIR TRAFFIC AND GENERAL OPERATING RULES GENERAL OPERATING AND FLIGHT RULES Fractional Ownership... crewmember, and no flight crewmember may accept an assignment, for flight time as a member of an augmented...

Getting started with Twitter Flight

CERN Document Server

Hamshere, Tom

2013-01-01

Getting Started with Twitter Flight is written with the intention to educate the readers, helping them learn how to build modular powerful applications with Flight, Twitter's cutting-edge JavaScript framework.This book is for anyone with a foundation in JavaScript who wants to build web applications. Flight is quick and easy to learn, built on technologies you already understand such as the DOM, events, and jQuery.

Flight telerobotic servicer legacy

Science.gov (United States)

Shattuck, Paul L.; Lowrie, James W.

1992-11-01

The Flight Telerobotic Servicer (FTS) was developed to enhance and provide a safe alternative to human presence in space. The first step for this system was a precursor development test flight (DTF-1) on the Space Shuttle. DTF-1 was to be a pathfinder for manned flight safety of robotic systems. The broad objectives of this mission were three-fold: flight validation of telerobotic manipulator (design, control algorithms, man/machine interfaces, safety); demonstration of dexterous manipulator capabilities on specific building block tasks; and correlation of manipulator performance in space with ground predictions. The DTF-1 system is comprised of a payload bay element (7-DOF manipulator with controllers, end-of-arm gripper and camera, telerobot body with head cameras and electronics module, task panel, and MPESS truss) and an aft flight deck element (force-reflecting hand controller, crew restraint, command and display panel and monitors). The approach used to develop the DTF-1 hardware, software and operations involved flight qualification of components from commercial, military, space, and R controller, end-of-arm tooling, force/torque transducer) and the development of the telerobotic system for space applications. The system is capable of teleoperation and autonomous control (advances state of the art); reliable (two-fault tolerance); and safe (man-rated). Benefits from the development flight included space validation of critical telerobotic technologies and resolution of significant safety issues relating to telerobotic operations in the Shuttle bay or in the vicinity of other space assets. This paper discusses the lessons learned and technology evolution that stemmed from developing and integrating a dexterous robot into a manned system, the Space Shuttle. Particular emphasis is placed on the safety and reliability requirements for a man-rated system as these are the critical factors which drive the overall system architecture. Other topics focused on include

Microgravity Flight - Accommodating Non-Human Primates

Science.gov (United States)

Dalton, Bonnie P.; Searby, Nancy; Ostrach, Louis

1994-01-01

Spacelab Life Sciences-3 (SLS-3) was scheduled to be the first United States man-tended microgravity flight containing Rhesus monkeys. The goal of this flight as in the five untended Russian COSMOS Bion flights and an earlier American Biosatellite flight, was to understand the biomedical and biological effects of a microgravity environment using the non-human primate as human surrogate. The SLS-3/Rhesus Project and COSMOS Primate-BIOS flights all utilized the rhesus monkey, Macaca mulatta. The ultimate objective of all flights with an animal surrogate has been to evaluate and understand biological mechanisms at both the system and cellular level, thus enabling rational effective countermeasures for future long duration human activity under microgravity conditions and enabling technical application to correction of common human physiological problems within earth's gravity, e.g., muscle strength and reloading, osteoporosis, immune deficiency diseases. Hardware developed for the SLS-3/Rhesus Project was the result of a joint effort with the French Centre National d'Etudes Spatiales (CNES) and the United States National Aeronautics and Space Administration (NASA) extending over the last decade. The flight hardware design and development required implementation of sufficient automation to insure flight crew and animal bio-isolation and maintenance with minimal impact to crew activities. A variety of hardware of varying functional capabilities was developed to support the scientific objectives of the original 22 combined French and American experiments, along with 5 Russian co-investigations, including musculoskeletal, metabolic, and behavioral studies. Unique elements of the Rhesus Research Facility (RRF) included separation of waste for daily delivery of urine and fecal samples for metabolic studies and a psychomotor test system for behavioral studies along with monitored food measurement. As in untended flights, telemetry measurements would allow monitoring of

Low Density Supersonic Decelerator Flight Dynamics Test-1 Flight Design and Targeting

Science.gov (United States)

Ivanov, Mark

2015-01-01

NASA's Low Density Supersonic Decelerator (LDSD) program was established to identify, develop, and eventually qualify to Test [i.e. Technology] Readiness Level (TRL) - 6 aerodynamic decelerators for eventual use on Mars. Through comprehensive Mars application studies, two distinct Supersonic Inflatable Aerodynamic Decelerator (SIAD) designs were chosen that afforded the optimum balance of benefit, cost, and development risk. In addition, a Supersonic Disk Sail (SSDS) parachute design was chosen that satisfied the same criteria. The final phase of the multi-tiered qualification process involves Earth Supersonic Flight Dynamics Tests (SFDTs) within environmental conditions similar to those that would be experienced during a Mars Entry, Descent, and Landing (EDL) mission. The first of these flight tests (i.e. SFDT-1) was completed on June 28, 2014 with two more tests scheduled for the summer of 2015 and 2016, respectively. The basic flight design for all the SFDT flights is for the SFDT test vehicle to be ferried to a float altitude of 120 kilo-feet by a 34 thousand cubic feet (Mcf) heavy lift helium balloon. Once float altitude is reached, the test vehicle is released from the balloon, spun-up for stability, and accelerated to supersonic speeds using a Star48 solid rocket motor. After burnout of the Star48 motor the vehicle decelerates to pre-flight selected test conditions for the deployment of the SIAD system. After further deceleration with the SIAD deployed, the SSDS parachute is then deployed stressing the performance of the parachute in the wake of the SIAD augmented blunt body. The test vehicle/SIAD/parachute system then descends to splashdown in the Pacific Ocean for eventual recovery. This paper will discuss the development of both the test vehicle and the trajectory sequence including design trade-offs resulting from the interaction of both engineering efforts. In addition, the SFDT-1 nominal trajectory design and associated sensitivities will be discussed

Aging Enhances Indirect Flight Muscle Fiber Performance yet Decreases Flight Ability in Drosophila

Energy Technology Data Exchange (ETDEWEB)

Miller, Mark S.; Lekkas, Panagiotis; Braddock, Joan M.; Farman, Gerrie P.; Ballif, Bryan A.; Irving, Thomas C.; Maughan, David W.; Vigoreaux, Jim O. (IIT); (Vermont)

2008-10-02

We investigated the effects of aging on Drosophila melanogaster indirect flight muscle from the whole organism to the actomyosin cross-bridge. Median-aged (49-day-old) flies were flight impaired, had normal myofilament number and packing, barely longer sarcomeres, and slight mitochondrial deterioration compared with young (3-day-old) flies. Old (56-day-old) flies were unable to beat their wings, had deteriorated ultrastructure with severe mitochondrial damage, and their skinned fibers failed to activate with calcium. Small-amplitude sinusoidal length perturbation analysis showed median-aged indirect flight muscle fibers developed greater than twice the isometric force and power output of young fibers, yet cross-bridge kinetics were similar. Large increases in elastic and viscous moduli amplitude under active, passive, and rigor conditions suggest that median-aged fibers become stiffer longitudinally. Small-angle x-ray diffraction indicates that myosin heads move increasingly toward the thin filament with age, accounting for the increased transverse stiffness via cross-bridge formation. We propose that the observed protein composition changes in the connecting filaments, which anchor the thick filaments to the Z-disk, produce compensatory increases in longitudinal stiffness, isometric tension, power and actomyosin interaction in aging indirect flight muscle. We also speculate that a lack of MgATP due to damaged mitochondria accounts for the decreased flight performance.

AcEST: DK950544 [AcEST

Lifescience Database Archive (English)

Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

AcEST: DK951699 [AcEST

Lifescience Database Archive (English)

Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

Ares I-X Flight Test Philosophy

Science.gov (United States)

Davis, S. R.; Tuma, M. L.; Heitzman, K.

2007-01-01

In response to the Vision for Space Exploration, the National Aeronautics and Space Administration (NASA) has defined a new space exploration architecture to return humans to the Moon and prepare for human exploration of Mars. One of the first new developments will be the Ares I Crew Launch Vehicle (CLV), which will carry the Orion Crew Exploration Vehicle (CEV), into Low Earth Orbit (LEO) to support International Space Station (ISS) missions and, later, support lunar missions. As part of Ares I development, NASA will perform a series of Ares I flight tests. The tests will provide data that will inform the engineering and design process and verify the flight hardware and software. The data gained from the flight tests will be used to certify the new Ares/Orion vehicle for human space flight. The primary objectives of this first flight test (Ares I-X) are the following: Demonstrate control of a dynamically similar integrated Ares CLV/Orion CEV using Ares CLV ascent control algorithms; Perform an in-flight separation/staging event between an Ares I-similar First Stage and a representative Upper Stage; Demonstrate assembly and recovery of a new Ares CLV-like First Stage element at Kennedy Space Center (KSC); Demonstrate First Stage separation sequencing, and quantify First Stage atmospheric entry dynamics and parachute performance; and Characterize the magnitude of the integrated vehicle roll torque throughout the First Stage (powered) flight. This paper will provide an overview of the Ares I-X flight test process and details of the individual flight tests.

Remote radio control of insect flight

Directory of Open Access Journals (Sweden)

Hirotaka Sato

2009-10-01

Full Text Available We demonstrated the remote control of insects in free flight via an implantable radio-equipped miniature neural stimulating system. The pronotum mounted system consisted of neural stimulators, muscular stimulators, a radio transceiver-equipped microcontroller and a microbattery. Flight initiation, cessation and elevation control were accomplished through neural stimulus of the brain which elicited, suppressed or modulated wing oscillation. Turns were triggered through the direct muscular stimulus of either of the basalar muscles. We characterized the response times, success rates, and free-flight trajectories elicited by our neural control systems in remotely-controlled beetles. We believe this type of technology will open the door to in-flight perturbation and recording of insect flight responses.

Remote radio control of insect flight.

Science.gov (United States)

Sato, Hirotaka; Berry, Christopher W; Peeri, Yoav; Baghoomian, Emen; Casey, Brendan E; Lavella, Gabriel; Vandenbrooks, John M; Harrison, Jon F; Maharbiz, Michel M

2009-01-01

We demonstrated the remote control of insects in free flight via an implantable radio-equipped miniature neural stimulating system. The pronotum mounted system consisted of neural stimulators, muscular stimulators, a radio transceiver-equipped microcontroller and a microbattery. Flight initiation, cessation and elevation control were accomplished through neural stimulus of the brain which elicited, suppressed or modulated wing oscillation. Turns were triggered through the direct muscular stimulus of either of the basalar muscles. We characterized the response times, success rates, and free-flight trajectories elicited by our neural control systems in remotely controlled beetles. We believe this type of technology will open the door to in-flight perturbation and recording of insect flight responses.

Flight Test Maneuvers for Efficient Aerodynamic Modeling

Science.gov (United States)

Morelli, Eugene A.

2011-01-01

Novel flight test maneuvers for efficient aerodynamic modeling were developed and demonstrated in flight. Orthogonal optimized multi-sine inputs were applied to aircraft control surfaces to excite aircraft dynamic response in all six degrees of freedom simultaneously while keeping the aircraft close to chosen reference flight conditions. Each maneuver was designed for a specific modeling task that cannot be adequately or efficiently accomplished using conventional flight test maneuvers. All of the new maneuvers were first described and explained, then demonstrated on a subscale jet transport aircraft in flight. Real-time and post-flight modeling results obtained using equation-error parameter estimation in the frequency domain were used to show the effectiveness and efficiency of the new maneuvers, as well as the quality of the aerodynamic models that can be identified from the resultant flight data.

Comparison of Commercial Aircraft Fuel Requirements in Regards to FAR, Flight Profile Simulation, and Flight Operational Techniques

Science.gov (United States)

Heitzman, Nicholas

There are significant fuel consumption consequences for non-optimal flight operations. This study is intended to analyze and highlight areas of interest that affect fuel consumption in typical flight operations. By gathering information from actual flight operators (pilots, dispatch, performance engineers, and air traffic controllers), real performance issues can be addressed and analyzed. A series of interviews were performed with various individuals in the industry and organizations. The wide range of insight directed this study to focus on FAA regulations, airline policy, the ATC system, weather, and flight planning. The goal is to highlight where operational performance differs from design intent in order to better connect optimization with actual flight operations. After further investigation and consensus from the experienced participants, the FAA regulations do not need any serious attention until newer technologies and capabilities are implemented. The ATC system is severely out of date and is one of the largest limiting factors in current flight operations. Although participants are pessimistic about its timely implementation, the FAA's NextGen program for a future National Airspace System should help improve the efficiency of flight operations. This includes situational awareness, weather monitoring, communication, information management, optimized routing, and cleaner flight profiles like Required Navigation Performance (RNP) and Continuous Descent Approach (CDA). Working off the interview results, trade-studies were performed using an in-house flight profile simulation of a Boeing 737-300, integrating NASA legacy codes EDET and NPSS with a custom written mission performance and point-performance "Skymap" calculator. From these trade-studies, it was found that certain flight conditions affect flight operations more than others. With weather, traffic, and unforeseeable risks, flight planning is still limited by its high level of precaution. From this

14 CFR 125.265 - Flight engineer requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...

Development and Flight Testing of a Neural Network Based Flight Control System on the NF-15B Aircraft

Science.gov (United States)

Bomben, Craig R.; Smolka, James W.; Bosworth, John T.; Silliams-Hayes, Peggy S.; Burken, John J.; Larson, Richard R.; Buschbacher, Mark J.; Maliska, Heather A.

2006-01-01

The Intelligent Flight Control System (IFCS) project at the NASA Dryden Flight Research Center, Edwards AFB, CA, has been investigating the use of neural network based adaptive control on a unique NF-15B test aircraft. The IFCS neural network is a software processor that stores measured aircraft response information to dynamically alter flight control gains. In 2006, the neural network was engaged and allowed to learn in real time to dynamically alter the aircraft handling qualities characteristics in the presence of actual aerodynamic failure conditions injected into the aircraft through the flight control system. The use of neural network and similar adaptive technologies in the design of highly fault and damage tolerant flight control systems shows promise in making future aircraft far more survivable than current technology allows. This paper will present the results of the IFCS flight test program conducted at the NASA Dryden Flight Research Center in 2006, with emphasis on challenges encountered and lessons learned.

14 CFR 63.42 - Flight engineer certificate issued on basis of a foreign flight engineer license.

Science.gov (United States)

2010-01-01

... section, may have a flight engineer certificate issued to him for the operation of civil aircraft of U.S... engineer certificate issued under this section may act as a flight engineer of a civil aircraft of U.S... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight engineer certificate issued on basis...

14 CFR 91.1095 - Initial and transition training and checking: Flight instructors (aircraft), flight instructors...

Science.gov (United States)

2010-01-01

... instructor certificate— (i) The fundamental principles of the teaching-learning process; (ii) Teaching... Management § 91.1095 Initial and transition training and checking: Flight instructors (aircraft), flight...

14 CFR 121.387 - Flight engineer.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer. 121.387 Section 121.387..., FLAG, AND SUPPLEMENTAL OPERATIONS Airman and Crewmember Requirements § 121.387 Flight engineer. No... holding a current flight engineer certificate. For each airplane type certificated after January 1, 1964...

Nuptial flights behavior of the African weaver ant, Oecophylla longinoda Latreille (Hymenoptera: Formicidae) and weather factors triggering flights

DEFF Research Database (Denmark)

Nene, Wilson; Rwegasira, Gration; Nielsen, Mogens Gissel

2016-01-01

years, we found that sexuals aggregate on nest surfaces prior to flights. We also found that flights took place during the raining season, and all flights took place in evenings just before sunset. Further to these, days with flights were associated with higher relative humidity and less sun shine...... collection of mated queens to stock ant nurseries that supply ant colonies for IPM-programs....

An overview of integrated flight-propulsion controls flight research on the NASA F-15 research airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Gatlin, Donald H.; Stewart, James F.

1995-01-01

The NASA Dryden Flight Research Center has been conducting integrated flight-propulsion control flight research using the NASA F-15 airplane for the past 12 years. The research began with the digital electronic engine control (DEEC) project, followed by the F100 Engine Model Derivative (EMD). HIDEC (Highly Integrated Digital Electronic Control) became the umbrella name for a series of experiments including: the Advanced Digital Engine Controls System (ADECS), a twin jet acoustics flight experiment, self-repairing flight control system (SRFCS), performance-seeking control (PSC), and propulsion controlled aircraft (PCA). The upcoming F-15 project is ACTIVE (Advanced Control Technology for Integrated Vehicles). This paper provides a brief summary of these activities and provides background for the PCA and PSC papers, and includes a bibliography of all papers and reports from the NASA F-15 project.

Theseus on Take-off for First Flight

Science.gov (United States)

1996-01-01

The Theseus prototype research aircraft takes off for its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to validate satellite-based global environmental change measurements. Dryden

A unified flight control methodology for a compound rotorcraft in fundamental and aerobatic maneuvering flight

Science.gov (United States)

Thorsen, Adam

This study investigates a novel approach to flight control for a compound rotorcraft in a variety of maneuvers ranging from fundamental to aerobatic in nature. Fundamental maneuvers are a class of maneuvers with design significance that are useful for testing and tuning flight control systems along with uncovering control law deficiencies. Aerobatic maneuvers are a class of aggressive and complex maneuvers with more operational significance. The process culminating in a unified approach to flight control includes various control allocation studies for redundant controls in trim and maneuvering flight, an efficient methodology to simulate non-piloted maneuvers with varying degrees of complexity, and the setup of an unconventional control inceptor configuration along with the use of a flight simulator to gather pilot feedback in order to improve the unified control architecture. A flight path generation algorithm was developed to calculate control inceptor commands required for a rotorcraft in aerobatic maneuvers. This generalized algorithm was tailored to generate flight paths through optimization methods in order to satisfy target terminal position coordinates or to minimize the total time of a particular maneuver. Six aerobatic maneuvers were developed drawing inspiration from air combat maneuvers of fighter jet aircraft: Pitch-Back Turn (PBT), Combat Ascent Turn (CAT), Combat Descent Turn (CDT), Weaving Pull-up (WPU), Combat Break Turn (CBT), and Zoom and Boom (ZAB). These aerobatic maneuvers were simulated at moderate to high advance ratios while fundamental maneuvers of the compound including level accelerations/decelerations, climbs, descents, and turns were investigated across the entire flight envelope to evaluate controller performance. The unified control system was developed to allow controls to seamlessly transition between manual and automatic allocations while ensuring that the axis of control for a particular inceptor remained constant with flight

14 CFR 415.115 - Flight safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety. 415.115 Section 415.115... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.115 Flight safety. (a) Flight safety analysis. An applicant's...

Dance training intensity at 11–14 years is associated with femoral torsion in classical ballet dancers

Science.gov (United States)

Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K

2006-01-01

Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r  =  0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782

Retrieving Balloon Data in Flight

Data.gov (United States)

National Aeronautics and Space Administration — NASA's Ultra Long Duration Balloon (ULDB) program will soon make flights lasting up to 100 days. Some flights may generate high data rates and retrieving this data...

14 CFR 417.107 - Flight safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety. 417.107 Section 417.107... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.107 Flight safety. (a) Flight safety... safety system that satisfies subpart D of this part as follows, unless § 417.125 applies. (1) In the...

Mini-Sniffer II in Flight

Science.gov (United States)

1976-01-01

This photograph shows the second Mini-Sniffer undergoing flight testing over Rogers Dry Lake in Edwards, California. This version of the Mini-Sniffer lacked the canard of the original version and had wing tips and tail booms added. The Mini-Sniffer was a remotely controlled, propeller-driven vehicle developed at the NASA Flight Research Center (which became the Dryden Flight Research Center, Edwards, California, in 1976) as a potential platform to sample the upper atmosphere for pollution. The vehicle, flown from 1975 to 1977, was one of the earliest attempts by NASA to develop an aircraft that could sense turbulence and measure natural and human-produced atmospheric pollutants at altitudes above 80,000 feet with a variable-load propeller that was never flight-tested. Three Mini-Sniffer vehicles were built. The number 1 Mini-Sniffer vehicle had swept wings with a span of 18 feet and canards on the nose. It flew 12 flights with the gas-powered engine at low altitudes of around 2,500 feet. The number 1 vehicle was then modified into version number 2 by removing the canards and wing rudders and adding wing tips and tail booms. Twenty flights were made with this version, up to altitudes of 20,000 feet. The number 3 vehicle had a longer fuselage, was lighter in weight, and was powered by the non-air-breathing hydrazine engine designed by NASA's Johnson Space Center in Houston, Texas. This version was designed to fly a 25-pound payload to an altitude of 70,000 feet for one hour or to climb to 90,000 feet and glide back. The number 3 Mini-Sniffer made one flight to 20,000 feet and was not flown again because of a hydrazine leak problem. All three versions used a pusher propeller to free the nose area for an atmospheric-sampling payload. At various times the Mini-Sniffer has been considered for exploration in the carbon dioxide atmosphere of the planet Mars, where the gravity (38 percent of that on Earth) would reduce the horsepower needed for flight.

Young PHD's in Human Space Flight

Science.gov (United States)

Wilson, Eleanor

2002-01-01

The Cooperating Hampton Roads Organizations for Minorities in Engineering (CHROME) in cooperation with the NASA Office of Space Flight, Human Exploration and Development of Space Enterprise sponsored a summer institute, Young PHD#s (Persons Having Dreams) in Human Space Flight. This 3-day institute used the curriculum of a workshop designed for space professionals, 'Human Space Flight-Analysis and Design: An Integrated, Systematic Approach.' The content was tailored to a high school audience. This institute seeks to stimulate the interest of pre-college students in space flight and motivate them to pursue further experiences in this field. Additionally, this institute will serve as a pilot model for a pre- collegiate training program that can be replicated throughout the country. The institute was complemented with a trip to the Goddard Space Flight Center.

Restoring Anadromous Fish Habitat in Big Canyon Creek Watershed, 2004-2005 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn (Nez Perce Soil and Conservation District, Lewiston, ID)

2006-07-01

The ''Restoring Anadromous Fish Habitat in the Big Canyon Creek Watershed'' is a multi-phase project to enhance steelhead trout in the Big Canyon Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District. Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period September 1, 2004 through October 31, 2005 include; 2.7 riparian miles treated, 3.0 wetland acres treated, 5,263.3 upland acres treated, 106.5 riparian acres treated, 76,285 general public reached, 3,000 students reached, 40 teachers reached, 18 maintenance plans completed, temperature data collected at 6 sites, 8 landowner applications received and processed, 14 land inventories completed, 58 habitat improvement project designs completed, 5 newsletters published, 6 habitat plans completed, 34 projects installed, 2 educational workshops, 6 displays, 1 television segment, 2 public service announcements, a noxious weed GIS coverage, and completion of NEPA, ESA, and cultural resources requirements.

Lessons Learned and Flight Results from the F15 Intelligent Flight Control System Project

Science.gov (United States)

Bosworth, John

2006-01-01

A viewgraph presentation on the lessons learned and flight results from the F15 Intelligent Flight Control System (IFCS) project is shown. The topics include: 1) F-15 IFCS Project Goals; 2) Motivation; 3) IFCS Approach; 4) NASA F-15 #837 Aircraft Description; 5) Flight Envelope; 6) Limited Authority System; 7) NN Floating Limiter; 8) Flight Experiment; 9) Adaptation Goals; 10) Handling Qualities Performance Metric; 11) Project Phases; 12) Indirect Adaptive Control Architecture; 13) Indirect Adaptive Experience and Lessons Learned; 14) Gen II Direct Adaptive Control Architecture; 15) Current Status; 16) Effect of Canard Multiplier; 17) Simulated Canard Failure Stab Open Loop; 18) Canard Multiplier Effect Closed Loop Freq. Resp.; 19) Simulated Canard Failure Stab Open Loop with Adaptation; 20) Canard Multiplier Effect Closed Loop with Adaptation; 21) Gen 2 NN Wts from Simulation; 22) Direct Adaptive Experience and Lessons Learned; and 23) Conclusions

Santiago Martínez Delgado, pionero del diseño gráfico colombiano: una reseña de su vida y obra

Directory of Open Access Journals (Sweden)

Diego Giovanni Bermúdez Aguirre

2017-06-01

Full Text Available Hablar del diseño gráfico en Colombia como profesión autónoma es aproximarse a una historia todavía en construcción, dada la juventud de este espacio de conocimiento, el cual dio sus primeros pasos solo hasta principios del siglo XX, debido al desarrollo industrial que vino a definir un nuevo lenguaje de producción, estético y comunicativo que ahora se llama “diseño”. Este texto pretende acercarse a la vida de Santiago Martínez Delgado, uno de los primeros hombres que con su obra definió, en el contexto colombiano, los rumbos de una nueva forma de expresión y comunicación: el diseño gráfico. Se intenta comprender el carácter innovador presente en la vida y obra de este diseñador colombiano, desde la ciencia histórica a partir de la condición de lugar de producción, acercamiento al tiempo histórico como reconstrucción o representación de un presente por medio de un proceso de ficcionalización, el cual edifica y evidencia una ruptura temporal entre el pasado, asumido como espacio de experiencia, y el ahora (presente, constituido a partir de una visión prospectiva de la vida en el futuro, horizonte de expectativa.

Pigeons (C. livia Follow Their Head during Turning Flight: Head Stabilization Underlies the Visual Control of Flight

Directory of Open Access Journals (Sweden)

Ivo G. Ros

2017-12-01

Full Text Available Similar flight control principles operate across insect and vertebrate fliers. These principles indicate that robust solutions have evolved to meet complex behavioral challenges. Following from studies of visual and cervical feedback control of flight in insects, we investigate the role of head stabilization in providing feedback cues for controlling turning flight in pigeons. Based on previous observations that the eyes of pigeons remain at relatively fixed orientations within the head during flight, we test potential sensory control inputs derived from head and body movements during 90° aerial turns. We observe that periods of angular head stabilization alternate with rapid head repositioning movements (head saccades, and confirm that control of head motion is decoupled from aerodynamic and inertial forces acting on the bird's continuously rotating body during turning flapping flight. Visual cues inferred from head saccades correlate with changes in flight trajectory; whereas the magnitude of neck bending predicts angular changes in body position. The control of head motion to stabilize a pigeon's gaze may therefore facilitate extraction of important motion cues, in addition to offering mechanisms for controlling body and wing movements. Strong similarities between the sensory flight control of birds and insects may also inspire novel designs of robust controllers for human-engineered autonomous aerial vehicles.

14 CFR 61.41 - Flight training received from flight instructors not certificated by the FAA.

Science.gov (United States)

2010-01-01

... the FAA. (a) A person may credit flight training toward the requirements of a pilot certificate or... flight instructor described in paragraph (a) of this section is only authorized to give endorsements to...

X-36 in Flight near Edge of Rogers Dry Lake during 5th Flight

Science.gov (United States)

1997-01-01

This photo shows the X-36 Tailless Fighter Agility Research Aircraft passing over the edge of Rogers Dry Lake as the remotely-piloted aircraft flies over Edwards Air Force Base on a June 1997 research flight. The NASA/Boeing X-36 Tailless Fighter Agility Research Aircraft program successfully demonstrated the tailless fighter design using advanced technologies to improve the maneuverability and survivability of possible future fighter aircraft. The program met or exceeded all project goals. For 31 flights during 1997 at the Dryden Flight Research Center, Edwards, California, the project team examined the aircraft's agility at low speed / high angles of attack and at high speed / low angles of attack. The aircraft's speed envelope reached up to 206 knots (234 mph). This aircraft was very stable and maneuverable. It handled very well. The X-36 vehicle was designed to fly without the traditional tail surfaces common on most aircraft. Instead, a canard forward of the wing was used as well as split ailerons and an advanced thrust-vectoring nozzle for directional control. The X-36 was unstable in both pitch and yaw axes, so an advanced, single-channel digital fly-by-wire control system (developed with some commercially available components) was put in place to stabilize the aircraft. Using a video camera mounted in the nose of the aircraft and an onboard microphone, the X-36 was remotely controlled by a pilot in a ground station virtual cockpit. A standard fighter-type head-up display (HUD) and a moving-map representation of the vehicle's position within the range in which it flew provided excellent situational awareness for the pilot. This pilot-in-the-loop approach eliminated the need for expensive and complex autonomous flight control systems and the risks associated with their inability to deal with unknown or unforeseen phenomena in flight. Fully fueled the X-36 prototype weighed approximately 1,250 pounds. It was 19 feet long and three feet high with a wingspan of

Post-Flight Data Analysis Tool

Science.gov (United States)

George, Marina

2018-01-01

A software tool that facilitates the retrieval and analysis of post-flight data. This allows our team and other teams to effectively and efficiently analyze and evaluate post-flight data in order to certify commercial providers.

14 CFR 61.193 - Flight instructor privileges.

Science.gov (United States)

2010-01-01

... than Flight Instructors With a Sport Pilot Rating § 61.193 Flight instructor privileges. A person who...; (e) An aircraft rating; (f) An instrument rating; (g) A flight review, operating privilege, or...

Enclosure enhancement of flight performance

KAUST Repository

Ghommem, Mehdi; Garcia, Daniel; Calo, Victor M.

2014-01-01

We use a potential flow solver to investigate the aerodynamic aspects of flapping flights in enclosed spaces. The enclosure effects are simulated by the method of images. Our study complements previous aerodynamic analyses which considered only the near-ground flight. The present results show that flying in the proximity of an enclosure affects the aerodynamic performance of flapping wings in terms of lift and thrust generation and power consumption. It leads to higher flight efficiency and more than 5% increase of the generation of lift and thrust.

Enclosure enhancement of flight performance

KAUST Repository

Ghommem, Mehdi

2014-08-19

We use a potential flow solver to investigate the aerodynamic aspects of flapping flights in enclosed spaces. The enclosure effects are simulated by the method of images. Our study complements previous aerodynamic analyses which considered only the near-ground flight. The present results show that flying in the proximity of an enclosure affects the aerodynamic performance of flapping wings in terms of lift and thrust generation and power consumption. It leads to higher flight efficiency and more than 5% increase of the generation of lift and thrust.

Data Mining of NASA Boeing 737 Flight Data: Frequency Analysis of In-Flight Recorded Data

Science.gov (United States)

Butterfield, Ansel J.

2001-01-01

Data recorded during flights of the NASA Trailblazer Boeing 737 have been analyzed to ascertain the presence of aircraft structural responses from various excitations such as the engine, aerodynamic effects, wind gusts, and control system operations. The NASA Trailblazer Boeing 737 was chosen as a focus of the study because of a large quantity of its flight data records. The goal of this study was to determine if any aircraft structural characteristics could be identified from flight data collected for measuring non-structural phenomena. A number of such data were examined for spatial and frequency correlation as a means of discovering hidden knowledge of the dynamic behavior of the aircraft. Data recorded from on-board dynamic sensors over a range of flight conditions showed consistently appearing frequencies. Those frequencies were attributed to aircraft structural vibrations.

Development and Flight Evaluation of an Emergency Digital Flight Control System Using Only Engine Thrust on an F-15 Airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Maine, Trindel A.; Fullerton, C. Gordon; Webb, Lannie Dean

1996-01-01

A propulsion-controlled aircraft (PCA) system for emergency flight control of aircraft with no flight controls was developed and flight tested on an F-15 aircraft at the NASA Dryden Flight Research Center. The airplane has been flown in a throttles-only manual mode and with an augmented system called PCA in which pilot thumbwheel commands and aircraft feedback parameters were used to drive the throttles. Results from a 36-flight evaluation showed that the PCA system can be used to safety land an airplane that has suffered a major flight control system failure. The PCA system was used to recover from a severe upset condition, descend, and land. Guest pilots have also evaluated the PCA system. This paper describes the principles of throttles-only flight control; a history of loss-of-control accidents; a description of the F-15 aircraft; the PCA system operation, simulation, and flight testing; and the pilot comments.

Theseus Waits on Lakebed for First Flight

Science.gov (United States)

1996-01-01

The Theseus prototype remotely-piloted aircraft (RPA) waits on the lakebed before its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to validate satellite-based global environmental

Integrating Space Flight Resource Management Skills into Technical Lessons for International Space Station Flight Controller Training

Science.gov (United States)

Baldwin, Evelyn

2008-01-01

The Johnson Space Center s (JSC) International Space Station (ISS) Space Flight Resource Management (SFRM) training program is designed to teach the team skills required to be an effective flight controller. It was adapted from the SFRM training given to Shuttle flight controllers to fit the needs of a "24 hours a day/365 days a year" flight controller. More recently, the length reduction of technical training flows for ISS flight controllers impacted the number of opportunities for fully integrated team scenario based training, where most SFRM training occurred. Thus, the ISS SFRM training program is evolving yet again, using a new approach of teaching and evaluating SFRM alongside of technical materials. Because there are very few models in other industries that have successfully tied team and technical skills together, challenges are arising. Despite this, the Mission Operations Directorate of NASA s JSC is committed to implementing this integrated training approach because of the anticipated benefits.

F-14 in banked flight

Science.gov (United States)

1979-01-01

NASA 991, an F-14 Navy Tomcat designated the F-14 (1X), is seen here in banked flight over the desert on a research flight at NASA's Dryden Flight Research Center, Edwards, California. The F-14 was used at Dryden between 1979 and 1985 in extensive high-angle-of-attack and spin-control-and-recovery tests. The NASA/Navy program, which included 212 total flights, acheived considerable improvement in the F-14 high-angle-of-attack flying qualities, improved departure and spin resistance, and contributed to substantial improvements in reducing 'wing rock,' (i.e., tilting from one side to another), at high angles of attack. The Navy had been experiencing inadvertant spin entries caused by the F-14's aileron rudder interconnect. The NASA/Navy/Grumman team developed and tested 4 different configurations of the aileron rudder interconnect to address the spin problem. These problems prompted the Navy to ask the manufacturer, Grumman, and NASA to investigate the issue. NASA 991 had numerous special additions for high-angle-of-attack and spin-recovery research. These included a battery-powered auxiliary power unit, a flight test nose boom, and a special spin recovery system, consisting of forward mounted, hydraulically actuated canards and an emergency spin chute. NASA's F-14 was first flown by NASA research pilots, but was later flown by Grumman, and by Navy test pilots from Patuxent River Naval Air Station (NAS). The Navy test flights with the spin research vehicle constituted the first program that incorporated air combat maneuvering in its test flights at Dryden. The Navy brought F-14s from Point Mugu and Miramar NAS in San Diego to test the new spin control laws in combat situations. Although the new control laws proved valuable, the Navy did not incorporate them into production F-14s until the F-14D, nearly 15 years later.

Design and analysis of advanced flight planning concepts

Science.gov (United States)

Sorensen, John A.

1987-01-01

The objectives of this continuing effort are to develop and evaluate new algorithms and advanced concepts for flight management and flight planning. This includes the minimization of fuel or direct operating costs, the integration of the airborne flight management and ground-based flight planning processes, and the enhancement of future traffic management systems design. Flight management (FMS) concepts are for on-board profile computation and steering of transport aircraft in the vertical plane between a city pair and along a given horizontal path. Flight planning (FPS) concepts are for the pre-flight ground based computation of the three-dimensional reference trajectory that connects the city pair and specifies the horizontal path, fuel load, and weather profiles for initializing the FMS. As part of these objectives, a new computer program called EFPLAN has been developed and utilized to study advanced flight planning concepts. EFPLAN represents an experimental version of an FPS. It has been developed to generate reference flight plans compatible as input to an FMS and to provide various options for flight planning research. This report describes EFPLAN and the associated research conducted in its development.

Simulation model for the Boeing 720B aircraft-flight control system in continuous flight.

Science.gov (United States)

1971-08-01

A mathematical model of the Boeing 720B aircraft and autopilot has been derived. The model is representative of the 720B aircraft for continuous flight within a flight envelope defined by a Mach number of .4 at 20,000 feet altitude in a cruise config...

Flight Test Results for the F-16XL With a Digital Flight Control System

Science.gov (United States)

Stachowiak, Susan J.; Bosworth, John T.

2004-01-01

In the early 1980s, two F-16 airplanes were modified to extend the fuselage length and incorporate a large area delta wing planform. These two airplanes, designated the F-16XL, were designed by the General Dynamics Corporation (now Lockheed Martin Tactical Aircraft Systems) (Fort Worth, Texas) and were prototypes for a derivative fighter evaluation program conducted by the United States Air Force. Although the concept was never put into production, the F-16XL prototypes provided a unique planform for testing concepts in support of future high-speed supersonic transport aircraft. To extend the capabilities of this testbed vehicle the F-16XL ship 1 aircraft was upgraded with a digital flight control system. The added flexibility of a digital flight control system increases the versatility of this airplane as a testbed for aerodynamic research and investigation of advanced technologies. This report presents the handling qualities flight test results covering the envelope expansion of the F-16XL with the digital flight control system.

Reactions of Air Transport Flight Crews to Displays of Weather During Simulated Flight

Science.gov (United States)

Bliss, James P.; Fallon, Corey; Bustamante, Ernesto; Bailey, William R., III; Anderson, Brittany

2005-01-01

Display of information in the cockpit has long been a challenge for aircraft designers. Given the limited space in which to present information, designers have had to be extremely selective about the types and amount of flight related information to present to pilots. The general goal of cockpit display design and implementation is to ensure that displays present information that is timely, useful, and helpful. This suggests that displays should facilitate the management of perceived workload, and should allow maximal situation awareness. The formatting of current and projected weather displays represents a unique challenge. As technologies have been developed to increase the variety and capabilities of weather information available to flight crews, factors such as conflicting weather representations and increased decision importance have increased the likelihood for errors. However, if formatted optimally, it is possible that next generation weather displays could allow for clearer indications of weather trends such as developing or decaying weather patterns. Important issues to address include the integration of weather information sources, flight crew trust of displayed weather information, and the teamed reactivity of flight crews to displays of weather. Past studies of weather display reactivity and formatting have not adequately addressed these issues; in part because experimental stimuli have not approximated the complexity of modern weather displays, and in part because they have not used realistic experimental tasks or participants. The goal of the research reported here was to investigate the influence of onboard and NEXRAD agreement, range to the simulated potential weather event, and the pilot flying on flight crew deviation decisions, perceived workload, and perceived situation awareness. Fifteen pilot-copilot teams were required to fly a simulated route while reacting to weather events presented in two graphical formats on a separate visual display

Fotogenia literaria en Carreteras secundarias, de Ignacio Martínez de Pisón: un viaje de ida y vuelta

Directory of Open Access Journals (Sweden)

García-Abad García, M. Teresa

2005-06-01

Full Text Available The cinema, his synthetic character, and the dialogue that it establishes from the origin with other arts as literature, has not stopped offering a wide space of synergies for the adaptation practice and for the study of confluence areas between image and word. New generations of writers and directors propiciate across their work an opening that, beside integrating the expressive resources of the literature and the screen, consider the text as a productive and plural activity, capable of being spread in a stereophony that postpones its meaning in every process of reading, making it coincide with a practice of writing and creation. Ignacio Martinez de Pisón's literature contains sugerent keys to advance in the dialogue between literature and cinema in current Spanish narrative.El cine, su carácter sintético, y el diálogo que desde el origen establece con otras artes como la literatura, no han dejado de ofrecer un espacio amplio de sinergias para la práctica adaptativa y para la reflexión acerca de los ámbitos de confluencia entre la imagen y la palabra. Las generaciones de escritores y de directores más jóvenes propician a través de su obra una apertura que, además de integrar los recursos expresivos de la literatura y la pantalla, considera al texto como una actividad productiva y plural capaz de diseminarse en una estereofonía que aplaza su significado en cada proceso de lectura haciéndolo coincidir con una práctica de escritura y de creación. La literatura de Martínez de Pisón contiene claves sugerentes para desentrañar este diálogo entre literatura y cine en la narrativa española actual.

Enclosure enhancement of flight performance

Directory of Open Access Journals (Sweden)

Mehdi Ghommem

2014-01-01

Full Text Available We use a potential flow solver to investigate the aerodynamic aspects of flapping flights in enclosed spaces. The enclosure effects are simulated by the method of images. Our study complements previous aerodynamic analyses which considered only the near-ground flight. The present results show that flying in the proximity of an enclosure affects the aerodynamic performance of flapping wings in terms of lift and thrust generation and power consumption. It leads to higher flight efficiency and more than 5% increase of the generation of lift and thrust.

Preliminary Flight Results of a Fly-by-throttle Emergency Flight Control System on an F-15 Airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Maine, Trindel A.; Fullerton, C. Gordon; Wells, Edward A.

1993-01-01

A multi-engine aircraft, with some or all of the flight control system inoperative, may use engine thrust for control. NASA Dryden has conducted a study of the capability and techniques for this emergency flight control method for the F-15 airplane. With an augmented control system, engine thrust, along with appropriate feedback parameters, is used to control flightpath and bank angle. Extensive simulation studies were followed by flight tests. The principles of throttles only control, the F-15 airplane, the augmented system, and the flight results including actual landings with throttles-only control are discussed.

X-36 during First Flight

Science.gov (United States)

1997-01-01

The remotely-piloted X-36 Tailless Fighter Agility Research Aircraft climbs out from Rogers Dry Lake at the Dryden Flight Research Center on its first flight in May 1997. The aircraft flew for five minutes and reached an altitude of approximately 4,900 feet. The NASA/Boeing X-36 Tailless Fighter Agility Research Aircraft program successfully demonstrated the tailless fighter design using advanced technologies to improve the maneuverability and survivability of possible future fighter aircraft. The program met or exceeded all project goals. For 31 flights during 1997 at the Dryden Flight Research Center, Edwards, California, the project team examined the aircraft's agility at low speed / high angles of attack and at high speed / low angles of attack. The aircraft's speed envelope reached up to 206 knots (234 mph). This aircraft was very stable and maneuverable. It handled very well. The X-36 vehicle was designed to fly without the traditional tail surfaces common on most aircraft. Instead, a canard forward of the wing was used as well as split ailerons and an advanced thrust-vectoring nozzle for directional control. The X-36 was unstable in both pitch and yaw axes, so an advanced, single-channel digital fly-by-wire control system (developed with some commercially available components) was put in place to stabilize the aircraft. Using a video camera mounted in the nose of the aircraft and an onboard microphone, the X-36 was remotely controlled by a pilot in a ground station virtual cockpit. A standard fighter-type head-up display (HUD) and a moving-map representation of the vehicle's position within the range in which it flew provided excellent situational awareness for the pilot. This pilot-in-the-loop approach eliminated the need for expensive and complex autonomous flight control systems and the risks associated with their inability to deal with unknown or unforeseen phenomena in flight. Fully fueled the X-36 prototype weighed approximately 1,250 pounds. It was 19

Pegasus hypersonic flight research

Science.gov (United States)

Curry, Robert E.; Meyer, Robert R., Jr.; Budd, Gerald D.

1992-01-01

Hypersonic aeronautics research using the Pegasus air-launched space booster is described. Two areas are discussed in the paper: previously obtained results from Pegasus flights 1 and 2, and plans for future programs. Proposed future research includes boundary-layer transition studies on the airplane-like first stage and also use of the complete Pegasus launch system to boost a research vehicle to hypersonic speeds. Pegasus flight 1 and 2 measurements were used to evaluate the results of several analytical aerodynamic design tools applied during the development of the vehicle as well as to develop hypersonic flight-test techniques. These data indicated that the aerodynamic design approach for Pegasus was adequate and showed that acceptable margins were available. Additionally, the correlations provide insight into the capabilities of these analytical tools for more complex vehicles in which design margins may be more stringent. Near-term plans to conduct hypersonic boundary-layer transition studies are discussed. These plans involve the use of a smooth metallic glove at about the mid-span of the wing. Longer-term opportunities are proposed which identify advantages of the Pegasus launch system to boost large-scale research vehicles to the real-gas hypersonic flight regime.

Writing executable assertions to test flight software

Science.gov (United States)

Mahmood, A.; Andrews, D. M.; Mccluskey, E. J.

1984-01-01

An executable assertion is a logical statement about the variables or a block of code. If there is no error during execution, the assertion statement results in a true value. Executable assertions can be used for dynamic testing of software. They can be employed for validation during the design phase, and exception and error detection during the operation phase. The present investigation is concerned with the problem of writing executable assertions, taking into account the use of assertions for testing flight software. They can be employed for validation during the design phase, and for exception handling and error detection during the operation phase The digital flight control system and the flight control software are discussed. The considered system provides autopilot and flight director modes of operation for automatic and manual control of the aircraft during all phases of flight. Attention is given to techniques for writing and using assertions to test flight software, an experimental setup to test flight software, and language features to support efficient use of assertions.

The Route Analysis Based On Flight Plan

Science.gov (United States)

Feriyanto, Nur; Saleh, Chairul; Fauzi, Achmad; Rachman Dzakiyullah, Nur; Riza Iwaputra, Kahfi

2016-02-01

Economic development effects use of air transportation since the business process in every aspect was increased. Many people these days was prefer using airplane because it can save time and money. This situation also effects flight routes, many airlines offer new routes to deal with competition. Managing flight routes is one of the problems that must be faced in order to find the efficient and effective routes. This paper investigates the best routes based on flight performance by determining the amount of block fuel for the Jakarta-Denpasar flight route. Moreover, in this work compares a two kinds of aircraft and tracks by calculating flight distance, flight time and block fuel. The result shows Jakarta-Denpasar in the Track II has effective and efficient block fuel that can be performed by Airbus 320-200 aircraft. This study can contribute to practice in making an effective decision, especially helping executive management of company due to selecting appropriate aircraft and the track in the flight plan based on the block fuel consumption for business operation.

Flight envelope protection system for unmanned aerial vehicles

KAUST Repository

Claudel, Christian G.

2016-04-28

Systems and methods to protect the flight envelope in both manual flight and flight by a commercial autopilot are provided. A system can comprise: an inertial measurement unit (IMU); a computing device in data communication with the IMU; an application executable by the computing device comprising: logic that estimates an angle of attack; a slip angle; and a speed of an unmanned aerial vehicle (UAV) based at least in part on data received from the UAV. A method can comprise estimating, via a computing device, flight data of a UAV based at least in part on data received from an IMU; comparing the estimated flight data with measured flight data; and triggering an error indication in response to a determination that the measured flight data exceeds a predefined deviation of the estimated flight data. The estimated speed can comprise an estimated airspeed, vertical speed and/or ground velocity.

Helicopter Flight Procedures for Community Noise Reduction

Science.gov (United States)

Greenwood, Eric

2017-01-01

A computationally efficient, semiempirical noise model suitable for maneuvering flight noise prediction is used to evaluate the community noise impact of practical variations on several helicopter flight procedures typical of normal operations. Turns, "quick-stops," approaches, climbs, and combinations of these maneuvers are assessed. Relatively small variations in flight procedures are shown to cause significant changes to Sound Exposure Levels over a wide area. Guidelines are developed for helicopter pilots intended to provide effective strategies for reducing the negative effects of helicopter noise on the community. Finally, direct optimization of flight trajectories is conducted to identify low noise optimal flight procedures and quantify the magnitude of community noise reductions that can be obtained through tailored helicopter flight procedures. Physically realizable optimal turns and approaches are identified that achieve global noise reductions of as much as 10 dBA Sound Exposure Level.

Optical Fiber Assemblies for Space Flight from the NASA Goddard Space Flight Center, Photonics Group

Science.gov (United States)

Ott, Melanie N.; Thoma, William Joe; LaRocca, Frank; Chuska, Richard; Switzer, Robert; Day, Lance

2009-01-01

The Photonics Group at NASA Goddard Space Flight Center in the Electrical Engineering Division of the Advanced Engineering and Technologies Directorate has been involved in the design, development, characterization, qualification, manufacturing, integration and anomaly analysis of optical fiber subsystems for over a decade. The group supports a variety of instrumentation across NASA and outside entities that build flight systems. Among the projects currently supported are: The Lunar Reconnaissance Orbiter, the Mars Science Laboratory, the James Webb Space Telescope, the Express Logistics Carrier for the International Space Station and the NASA Electronic Parts. and Packaging Program. A collection of the most pertinent information gathered during project support over the past year in regards to space flight performance of optical fiber components is presented here. The objective is to provide guidance for future space flight designs of instrumentation and communication systems.

Stroke in Commercial Flights.

Science.gov (United States)

Álvarez-Velasco, Rodrigo; Masjuan, Jaime; DeFelipe, Alicia; Corral, Iñigo; Estévez-Fraga, Carlos; Crespo, Leticia; Alonso-Cánovas, Araceli

2016-04-01

Stroke on board aircraft has been reported in retrospective case series, mainly focusing on economy class stroke syndrome. Data on the actual incidence, pathogenesis, and prognosis of stroke in commercial flights are lacking. A prospective registry was designed to include all consecutive patients referred from an international airport (40 million passengers a year) to our hospital with a diagnosis of ischemic stroke or transient ischemic attack and onset of symptoms during a flight or immediately after landing. Forty-four patients (32 ischemic strokes and 12 transient ischemic attacks) were included over a 76-month period (January 2008 to April 2014). The estimated incidence of stroke was 1 stroke in 35 000 flights. Pathogeneses of stroke or transient ischemic attack were atherothrombotic in 16 (36%), economy class stroke syndrome in 8 (18%), cardioembolic in 7 (16%), arterial dissection in 4 (9%), lacunar stroke in 4 (9%), and undetermined in 5 (12%) patients. Carotid stenosis >70% was found in 12 (27%) of the patients. Overall prognosis was good, and thrombolysis was applied in 44% of the cases. The most common reason for not treating patients who had experienced stroke onset midflight was the delay in reaching the hospital. Only 1 patient with symptom onset during the flight prompted a flight diversion. We found a low incidence of stroke in the setting of air travel. Economy class stroke syndrome and arterial dissection were well represented in our sample. However, the main pathogenesis was atherothrombosis with a high proportion of patients with high carotid stenosis. © 2016 American Heart Association, Inc.

Solar-powered Gossamer Penguin in flight

Science.gov (United States)

1979-01-01

Gossamer Penguin in flight above Rogers Dry Lakebed at Edwards, California, showing the solar panel perpendicular to the wing and facing the sun. Background The first flight of a solar-powered aircraft took place on November 4, 1974, when the remotely controlled Sunrise II, designed by Robert J. Boucher of AstroFlight, Inc., flew following a launch from a catapult. Following this event, AeroVironment, Inc. (founded in 1971 by the ultra-light airplane innovator--Dr. Paul MacCready) took on a more ambitious project to design a human-piloted, solar-powered aircraft. The firm initially took the human-powered Gossamer Albatross II and scaled it down to three-quarters of its previous size for solar-powered flight with a human pilot controlling it. This was more easily done because in early 1980 the Gossamer Albatross had participated in a flight research program at NASA Dryden in a program conducted jointly by the Langley and Dryden research centers. Some of the flights were conducted using a small electric motor for power. Gossamer Penguin The scaled-down aircraft was designated the Gossamer Penguin. It had a 71-foot wingspan compared with the 96-foot span of the Gossamer Albatross. Weighing only 68 pounds without a pilot, it had a low power requirement and thus was an excellent test bed for solar power. AstroFlight, Inc., of Venice, Calif., provided the power plant for the Gossamer Penguin, an Astro-40 electric motor. Robert Boucher, designer of the Sunrise II, served as a key consultant for both this aircraft and the Solar Challenger. The power source for the initial flights of the Gossamer Penguin consisted of 28 nickel-cadmium batteries, replaced for the solar-powered flights by a panel of 3,920 solar cells capable of producing 541 Watts of power. The battery-powered flights took place at Shafter Airport near Bakersfield, Calif. Dr. Paul MacCready's son Marshall, who was 13 years old and weighed roughly 80 pounds, served as the initial pilot for these flights to

Robust Decentralized Formation Flight Control

Directory of Open Access Journals (Sweden)

Zhao Weihua

2011-01-01

Full Text Available Motivated by the idea of multiplexed model predictive control (MMPC, this paper introduces a new framework for unmanned aerial vehicles (UAVs formation flight and coordination. Formulated using MMPC approach, the whole centralized formation flight system is considered as a linear periodic system with control inputs of each UAV subsystem as its periodic inputs. Divided into decentralized subsystems, the whole formation flight system is guaranteed stable if proper terminal cost and terminal constraints are added to each decentralized MPC formulation of the UAV subsystem. The decentralized robust MPC formulation for each UAV subsystem with bounded input disturbances and model uncertainties is also presented. Furthermore, an obstacle avoidance control scheme for any shape and size of obstacles, including the nonapriorily known ones, is integrated under the unified MPC framework. The results from simulations demonstrate that the proposed framework can successfully achieve robust collision-free formation flights.

Eclipse - tow flight closeup and release

Science.gov (United States)

1998-01-01

This clip, running 15 seconds in length, shows the QF-106 'Delta Dart' gear down, with the tow rope secured to the attachment point above the aircraft nose. First there is a view looking back from the C-141A, then looking forward from the nose of the QF-106, and finally a shot of the aircraft being released from the tow rope. NASA Dryden Flight Research Center, Edwards, California, supported a Kelly Space and Technology, Inc. (KST)/U.S. Air Force project known as Eclipse, which demonstrated a reusable tow launch vehicle concept. The purpose of the project was to demonstrate a reusable tow launch vehicle concept that had been conceived and patented by KST. Kelly Space obtained a contract with the USAF Research Laboratory for the tow launch demonstration project under the Small Business Innovation Research (SBIR) program. The USAF SBIR contract included the modifications to turn the QF-106 into the Experimental Demonstrator #1 (EXD-01), and the C141A aircraft to incorporate the tow provisions to link the two aircraft, as well as conducting flight tests. The demonstration consisted of ground and flight tests. These tests included a Combined Systems Test of both airplanes joined by a tow rope, a towed taxi test, and six towed flights. The primary goal of the project was demonstrating the tow phase of the Eclipse concept using a scaled-down tow aircraft (C-141A) and a representative aerodynamically-shaped aircraft (QF-106A) as a launch vehicle. This was successfully accomplished. On December 20, 1997, NASA research pilot Mark Stucky flew a QF-106 on the first towed flight behind an Air Force C-141 in the joint Eclipse project with KST to demonstrate a reusable tow launch vehicle concept developed by KST. Kelly Space and Technology hoped to use the data from the tow tests to validate a tow-to-launch procedure for reusable space launch vehicles. Stucky flew six successful tow tests between December 1997 and February 6, 1998. On February 6, 1998, the sixth and final towed

Development and Flight Test of an Emergency Flight Control System Using Only Engine Thrust on an MD-11 Transport Airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Burken, John J.; Maine, Trindel A.; Fullerton, C. Gordon

1997-01-01

An emergency flight control system that uses only engine thrust, called the propulsion-controlled aircraft (PCA) system, was developed and flight tested on an MD-11 airplane. The PCA system is a thrust-only control system, which augments pilot flightpath and track commands with aircraft feedback parameters to control engine thrust. The PCA system was implemented on the MD-11 airplane using only software modifications to existing computers. Results of a 25-hr flight test show that the PCA system can be used to fly to an airport and safely land a transport airplane with an inoperative flight control system. In up-and-away operation, the PCA system served as an acceptable autopilot capable of extended flight over a range of speeds, altitudes, and configurations. PCA approaches, go-arounds, and three landings without the use of any normal flight controls were demonstrated, including ILS-coupled hands-off landings. PCA operation was used to recover from an upset condition. The PCA system was also tested at altitude with all three hydraulic systems turned off. This paper reviews the principles of throttles-only flight control, a history of accidents or incidents in which some or all flight controls were lost, the MD-11 airplane and its systems, PCA system development, operation, flight testing, and pilot comments.

CFD to Flight: Some Recent Success Stories of X-Plane Design to Flight Test at the NASA Dryden Flight Research Center

Science.gov (United States)

Cosentino, Gary B.

2007-01-01

Several examples from the past decade of success stories involving the design and flight test of three true X-planes will be described: in particular, X-plane design techniques that relied heavily upon computational fluid dynamics (CFD). Three specific examples chosen from the author s personal experience are presented: the X-36 Tailless Fighter Agility Research Aircraft, the X-45A Unmanned Combat Air Vehicle, and, most recently, the X-48B Blended Wing Body Demonstrator Aircraft. An overview will be presented of the uses of CFD analysis, comparisons and contrasts with wind tunnel testing, and information derived from the CFD analysis that directly related to successful flight test. Some lessons learned on the proper application, and misapplication, of CFD are illustrated. Finally, some highlights of the flight-test results of the three example X-planes will be presented. This overview paper will discuss some of the author s experience with taking an aircraft shape from early concept and three-dimensional modeling through CFD analysis, wind tunnel testing, further refined CFD analysis, and, finally, flight. An overview of the key roles in which CFD plays well during this process, and some other roles in which it does not, are discussed. How wind tunnel testing complements, calibrates, and verifies CFD analysis is also covered. Lessons learned on where CFD results can be misleading are also given. Strengths and weaknesses of the various types of flow solvers, including panel methods, Euler, and Navier-Stokes techniques, are discussed. The paper concludes with the three specific examples, including some flight test video footage of the X-36, the X-45A, and the X-48B.

Space Flight Applications of Optical Fiber; 30 Years of Space Flight Success

Science.gov (United States)

Ott, Melanie N.

2010-01-01

For over thirty years NASA has had success with space flight missions that utilize optical fiber component technology. One of the early environmental characterization experiments that included optical fiber was launched as the Long Duration Exposure Facility in 1978. Since then, multiple missions have launched with optical fiber components that functioned as expected, without failure throughout the mission life. The use of optical fiber in NASA space flight communications links and exploration and science instrumentation is reviewed.

14 CFR 121.543 - Flight crewmembers at controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 121.543... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Flight Operations § 121.543 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each required flight crewmember on...

Deep-Space Ka-Band Flight Experience

Science.gov (United States)

Morabito, D. D.

2017-11-01

Lower frequency bands have become more congested in allocated bandwidth as there is increased competition between flight projects and other entities. Going to higher frequency bands offers significantly more bandwidth, allowing for the use of much higher data rates. However, Ka-band is more susceptible to weather effects than lower frequency bands currently used for most standard downlink telemetry operations. Future or prospective flight projects considering deep-space Ka-band (32-GHz) telemetry data links have expressed an interest in understanding past flight experience with received Ka-band downlink performance. Especially important to these flight projects is gaining a better understanding of weather effects from the experience of current or past missions that operated Ka-band radio systems. We will discuss the historical flight experience of several Ka-band missions starting from Mars Observer in 1993 up to present-day deep-space missions such as Kepler. The study of historical Ka-band flight experience allows one to recommend margin policy for future missions. Of particular interest, we will review previously reported-on flight experience with the Cassini spacecraft Ka-band radio system that has been used for radio science investigations as well as engineering studies from 2004 to 2015, when Cassini was in orbit around the planet Saturn. In this article, we will focus primarily on the Kepler spacecraft Ka-band link, which has been used for operational telemetry downlink from an Earth trailing orbit where the spacecraft resides. We analyzed the received Ka-band signal level data in order to characterize link performance over a wide range of weather conditions and as a function of elevation angle. Based on this analysis of Kepler and Cassini flight data, we found that a 4-dB margin with respect to adverse conditions ensures that we achieve at least a 95 percent data return.

A review of potential neurotoxic mechanisms among three chlorinated organic solvents

International Nuclear Information System (INIS)

Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.

2011-01-01

The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.

Fluctuations in a Levy flight gas

International Nuclear Information System (INIS)

Fogedby, H.C.; Jensen, H.J.

1991-01-01

We consider the density fluctuations of an ideal Brownian gas of particles performing Levy flights characterized by the index f. We find that the fluctuations scale as ΔN(t)∝t H , where the Hurst exponent H locks onto the universal value 1/4 for Levy flights with a finite root mean square range (f>2). For Levy flights with a finite mean range but infinite root mean square range (1< f<2) the Hurst exponent H=1/2f. For infinite range Levy flights (f<1) the Hurst exponent locks onto the value 1/2. The corresponding power spectrum scales with an exponent 1+2H, independent of dimension. (orig.)

Telling Tales of War to Teens: Ignacio Martínez de Pisón's Una guerra africana and Morocco as "Open Wound" in the Spanish National Imaginary

Directory of Open Access Journals (Sweden)

Silvia Bermúdez

2006-01-01

Full Text Available Exactly ten years after its traumatic defeat in the Spanish-American War of 1898, Spain appeared to find some compensation for the loss of its last colonies by undertaking the invasion of Morocco in 1908. The enterprise proved difficult when the forces of Abd-el-Krim defeated the Spanish army in the summer of 1921. This terrible loss was metaphorized as an "open wound" and entered the collective imagination by becoming a theme in novels such as José Díaz Fernández's El blocao (1928, Ramón Sender's Imán (1930, and Arturo Barea's series La forja de un rebelde (1941-1944. Known as the "Disaster of Annual," the defeat appeared to be almost forgotten until a series of narratives in the late twentieth and early twenty-first centuries obsessively returned to this particular moment of Spanish history. I focus on how one such narrative, Martínez de Pisón's Una guerra africana (2000, revisits this war as adolescent literature ("novelas juveniles" and within the literary genre of the "novels of the War in Africa," and by so doing, contributes to the articulation of a Spanish collective identity with the historical memory of the feared Moroccan Other.

Capital flight and political risk

NARCIS (Netherlands)

Lensink, R; Hermes, N; Murinde, [No Value

This paper provides the first serious attempt to examine the relationship between political risk and capital flight for a large set of developing countries. The outcomes of the analysis show that in most cases political risk variables do have a statistically robust relationship to capital flight

STS-70 Post Flight Presentation

Science.gov (United States)

Peterson, Glen (Editor)

1995-01-01

In this post-flight overview, the flight crew of the STS-70 mission, Tom Henricks (Cmdr.), Kevin Kregel (Pilot), Major Nancy Currie (MS), Dr. Mary Ellen Weber (MS), and Dr. Don Thomas (MS), discuss their mission and accompanying experiments. Pre-flight, launch, and orbital footage is followed by the in-orbit deployment of the Tracking and Data Relay Satellite (TDRS) and a discussion of the following spaceborne experiments: a microgravity bioreactor experiment to grow 3D body-like tissue; pregnant rat muscular changes in microgravity; embryonic development in microgravity; Shuttle Amateur Radio Experiment (SAREX); terrain surface imagery using the HERCULES camera; and a range of other physiological tests, including an eye and vision test. Views of Earth include: tropical storm Chantal; the Nile River and Red Sea; lightning over Brazil. A three planet view (Earth, Mars, and Venus) was taken right before sunrise. The end footage shows shuttle pre-landing checkout, entry, and landing, along with a slide presentation of the flight.

14 CFR 31.23 - Flight load factor.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight load factor. 31.23 Section 31.23... STANDARDS: MANNED FREE BALLOONS Strength Requirements § 31.23 Flight load factor. In determining limit load, the limit flight load factor must be at least 1.4. ...

14 CFR 91.529 - Flight engineer requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight engineer requirements. 91.529...-Powered Multiengine Airplanes and Fractional Ownership Program Aircraft § 91.529 Flight engineer... flight engineer certificate: (1) An airplane for which a type certificate was issued before January 2...

Voluntad de estilo en el muy joven José Martínez Ruiz: un aprendiz de crítico satírico (1893-1894

Directory of Open Access Journals (Sweden)

Miguel Ángel Martín-Hervás Jiménez

2017-02-01

Full Text Available Este artículo se enmarca dentro la etapa de producción juvenil de José Martínez Ruiz, Azorín (1873-1967 y en él se analizan con un doble objetivo las tres primeras obras de su carrera literaria: La crítica literaria en España (1893, Moratín (1893 y Buscapiés (1894. El primer y principal objetivo consiste en utilizar como fundamento metodológico la teoría de la voluntad de estilo desarrollada por Juan Marichal en su libro Teoría e historia del ensayismo hispánico (1984 para analizar el tipo de personalidad literaria que aspiró a construirse el autor en sus tres primeras obras. En segundo lugar, se comprobará si es cierto o no que bebió en ellas de las fuentes de la ideología anarquista para forjar su imagen pública de escritor. Se concluirá que el futuro Azorín se encontraba en el periodo de 1893-1894 en una fase de aprendizaje y de búsqueda de maestros en la que quiso proyectar de sí mismo la imagen de Crítico Discordante o Crítico Satírico. Asimismo, se aclarará que hasta el momento todavía no había encontrado en el anarquismo el sustrato ideológico-estético que impregnará obras posteriores.

2nd Generation QUATARA Flight Computer Project

Science.gov (United States)

Falker, Jay; Keys, Andrew; Fraticelli, Jose Molina; Capo-Iugo, Pedro; Peeples, Steven

2015-01-01

Single core flight computer boards have been designed, developed, and tested (DD&T) to be flown in small satellites for the last few years. In this project, a prototype flight computer will be designed as a distributed multi-core system containing four microprocessors running code in parallel. This flight computer will be capable of performing multiple computationally intensive tasks such as processing digital and/or analog data, controlling actuator systems, managing cameras, operating robotic manipulators and transmitting/receiving from/to a ground station. In addition, this flight computer will be designed to be fault tolerant by creating both a robust physical hardware connection and by using a software voting scheme to determine the processor's performance. This voting scheme will leverage on the work done for the Space Launch System (SLS) flight software. The prototype flight computer will be constructed with Commercial Off-The-Shelf (COTS) components which are estimated to survive for two years in a low-Earth orbit.

Flight Test of an L(sub 1) Adaptive Controller on the NASA AirSTAR Flight Test Vehicle

Science.gov (United States)

Gregory, Irene M.; Xargay, Enric; Cao, Chengyu; Hovakimyan, Naira

2010-01-01

This paper presents results of a flight test of the L-1 adaptive control architecture designed to directly compensate for significant uncertain cross-coupling in nonlinear systems. The flight test was conducted on the subscale turbine powered Generic Transport Model that is an integral part of the Airborne Subscale Transport Aircraft Research system at the NASA Langley Research Center. The results presented are for piloted tasks performed during the flight test.

In-Flight Validation of a Pilot Rating Scale for Evaluating Failure Transients in Electronic Flight Control Systems

Science.gov (United States)

Kalinowski, Kevin F.; Tucker, George E.; Moralez, Ernesto, III

2006-01-01

Engineering development and qualification of a Research Flight Control System (RFCS) for the Rotorcraft Aircrew Systems Concepts Airborne Laboratory (RASCAL) JUH-60A has motivated the development of a pilot rating scale for evaluating failure transients in fly-by-wire flight control systems. The RASCAL RFCS includes a highly-reliable, dual-channel Servo Control Unit (SCU) to command and monitor the performance of the fly-by-wire actuators and protect against the effects of erroneous commands from the flexible, but single-thread Flight Control Computer. During the design phase of the RFCS, two piloted simulations were conducted on the Ames Research Center Vertical Motion Simulator (VMS) to help define the required performance characteristics of the safety monitoring algorithms in the SCU. Simulated failures, including hard-over and slow-over commands, were injected into the command path, and the aircraft response and safety monitor performance were evaluated. A subjective Failure/Recovery Rating (F/RR) scale was developed as a means of quantifying the effects of the injected failures on the aircraft state and the degree of pilot effort required to safely recover the aircraft. A brief evaluation of the rating scale was also conducted on the Army/NASA CH-47B variable stability helicopter to confirm that the rating scale was likely to be equally applicable to in-flight evaluations. Following the initial research flight qualification of the RFCS in 2002, a flight test effort was begun to validate the performance of the safety monitors and to validate their design for the safe conduct of research flight testing. Simulated failures were injected into the SCU, and the F/RR scale was applied to assess the results. The results validate the performance of the monitors, and indicate that the Failure/Recovery Rating scale is a very useful tool for evaluating failure transients in fly-by-wire flight control systems.

Psychology of Flight Attendant’s Profession

OpenAIRE

Tatyana V. Filipieva

2012-01-01

The profession of a flight attendant appeared in aviation in the 1920s. Professional community of flight attendants is constantly growing with the growth of complexity of aviation technology, professional standards of passenger service and safety. The psychological scientific research was carried out by a psychologist who worked as a flight attendant. The study revealed the psychological content, demands, peculiarities in cabin crews' labor. A job description was accomplished. Temporal and sp...

Range Flight Safety Requirements

Science.gov (United States)

Loftin, Charles E.; Hudson, Sandra M.

2018-01-01

The purpose of this NASA Technical Standard is to provide the technical requirements for the NPR 8715.5, Range Flight Safety Program, in regards to protection of the public, the NASA workforce, and property as it pertains to risk analysis, Flight Safety Systems (FSS), and range flight operations. This standard is approved for use by NASA Headquarters and NASA Centers, including Component Facilities and Technical and Service Support Centers, and may be cited in contract, program, and other Agency documents as a technical requirement. This standard may also apply to the Jet Propulsion Laboratory or to other contractors, grant recipients, or parties to agreements to the extent specified or referenced in their contracts, grants, or agreements, when these organizations conduct or participate in missions that involve range flight operations as defined by NPR 8715.5.1.2.2 In this standard, all mandatory actions (i.e., requirements) are denoted by statements containing the term “shall.”1.3 TailoringTailoring of this standard for application to a specific program or project shall be formally documented as part of program or project requirements and approved by the responsible Technical Authority in accordance with NPR 8715.3, NASA General Safety Program Requirements.

Flight calls and orientation

DEFF Research Database (Denmark)

Larsen, Ole Næsbye; Andersen, Bent Bach; Kropp, Wibke

2008-01-01

flight calls was simulated by sequential computer controlled activation of five loudspeakers placed in a linear array perpendicular to the bird's migration course. The bird responded to this stimulation by changing its migratory course in the direction of that of the ‘flying conspecifics' but after about......  In a pilot experiment a European Robin, Erithacus rubecula, expressing migratory restlessness with a stable orientation, was video filmed in the dark with an infrared camera and its directional migratory activity was recorded. The flight overhead of migrating conspecifics uttering nocturnal...... 30 minutes it drifted back to its original migration course. The results suggest that songbirds migrating alone at night can use the flight calls from conspecifics as additional cues for orientation and that they may compare this information with other cues to decide what course to keep....

14 CFR 121.141 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

Optimized Lift for Autonomous Formation Flight

Data.gov (United States)

National Aeronautics and Space Administration — Experimental in-flight evaluations have demonstrated that the concept of formation flight can reduce fuel consumption of trailing aircraft by 10 percent. Armstrong...

Insect flight on fluid interfaces: a chaotic interfacial oscillator

Science.gov (United States)

Mukundarajan, Haripriya; Prakash, Manu

2013-11-01

Flight is critical to the dominance of insect species on our planet, with about 98 percent of insect species having wings. How complex flight control systems developed in insects is unknown, and arboreal or aquatic origins have been hypothesized. We examine the biomechanics of aquatic origins of flight. We recently reported discovery of a novel mode of ``2D flight'' in Galerucella beetles, which skim along an air-water interface using flapping wing flight. This unique flight mode is characterized by a balance between capillary forces from the interface and biomechanical forces exerted by the flapping wings. Complex interactions on the fluid interface form capillary wave trains behind the insect, and produce vertical oscillations at the surface due to non-linear forces arising from deformation of the fluid meniscus. We present both experimental observations of 2D flight kinematics and a dynamic model explaining the observed phenomena. Careful examination of this interaction predicts the chaotic nature of interfacial flight and takeoff from the interface into airborne flight. The role of wingbeat frequency, stroke plane angle and body angle in determining transition between interfacial and fully airborne flight is highlighted, shedding light on the aquatic theory of flight evolution.

Adaptive structures flight experiments

Science.gov (United States)

Martin, Maurice

The topics are presented in viewgraph form and include the following: adaptive structures flight experiments; enhanced resolution using active vibration suppression; Advanced Controls Technology Experiment (ACTEX); ACTEX program status; ACTEX-2; ACTEX-2 program status; modular control patch; STRV-1b Cryocooler Vibration Suppression Experiment; STRV-1b program status; Precision Optical Bench Experiment (PROBE); Clementine Spacecraft Configuration; TECHSAT all-composite spacecraft; Inexpensive Structures and Materials Flight Experiment (INFLEX); and INFLEX program status.

Flight time and flight age in the sweet potato weevil, Cylas formicarius (Fabricius)(Coleoptera: Brentidae)

International Nuclear Information System (INIS)

Shimizu, T.; Moriya, S.

1996-01-01

We examined daily flight patterns and the correlation between adult age and flight in Cylas formicarius in the laboratory at 25 ± 1 ℃ under a 14L10D photoregime by a simple method of counting the number of adults flying out of a cup. The flight activity of males peaked just after the onset of darkness and gradually decreased toward the onset of light. Only a small proportion of them flew during the photophase. More than 90% of male adults flow at least once within 2 weeks after exodus from the sweet potato tuber. The proportion of males flying per day increased to a maximum 1 week after the exodus, and about 10% of them flow even 30 days after the exodus. On the other hand, flight activity of females was low and the proportion of females flying at least once was about 25%. Females flow from 7 to 24 days after the exodus

Flight Activity and Crew Tracking System -

Data.gov (United States)

Department of Transportation — The Flight Activity and Crew Tracking System (FACTS) is a Web-based application that provides an overall management and tracking tool of FAA Airmen performing Flight...

Perseus A in Flight with Moon

Science.gov (United States)

1994-01-01

The Perseus A, a remotely-piloted, high-altitude research aircraft, is seen here framed against the moon and sky during a research mission at the Dryden Flight Research Center, Edwards, California in August 1994. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft

14 CFR 121.453 - Flight engineer qualifications.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer qualifications. 121.453... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Crewmember Qualifications § 121.453 Flight engineer qualifications. (a) No certificate holder may use any person nor may any person serve as a flight engineer on an...

14 CFR 29.673 - Primary flight controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Primary flight controls. 29.673 Section 29... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Control Systems § 29.673 Primary flight controls. Primary flight controls are those used by the pilot for immediate control of pitch, roll...

14 CFR 27.673 - Primary flight control.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Primary flight control. 27.673 Section 27... AIRWORTHINESS STANDARDS: NORMAL CATEGORY ROTORCRAFT Design and Construction Control Systems § 27.673 Primary flight control. Primary flight controls are those used by the pilot for immediate control of pitch, roll...

Differences in the Aerobic Capacity of Flight Muscles between Butterfly Populations and Species with Dissimilar Flight Abilities

Science.gov (United States)

Rauhamäki, Virve; Wolfram, Joy; Jokitalo, Eija; Hanski, Ilkka; Dahlhoff, Elizabeth P.

2014-01-01

Habitat loss and climate change are rapidly converting natural habitats and thereby increasing the significance of dispersal capacity for vulnerable species. Flight is necessary for dispersal in many insects, and differences in dispersal capacity may reflect dissimilarities in flight muscle aerobic capacity. In a large metapopulation of the Glanville fritillary butterfly in the Åland Islands in Finland, adults disperse frequently between small local populations. Individuals found in newly established populations have higher flight metabolic rates and field-measured dispersal distances than butterflies in old populations. To assess possible differences in flight muscle aerobic capacity among Glanville fritillary populations, enzyme activities and tissue concentrations of the mitochondrial protein Cytochrome-c Oxidase (CytOx) were measured and compared with four other species of Nymphalid butterflies. Flight muscle structure and mitochondrial density were also examined in the Glanville fritillary and a long-distance migrant, the red admiral. Glanville fritillaries from new populations had significantly higher aerobic capacities than individuals from old populations. Comparing the different species, strong-flying butterfly species had higher flight muscle CytOx content and enzymatic activity than short-distance fliers, and mitochondria were larger and more numerous in the flight muscle of the red admiral than the Glanville fritillary. These results suggest that superior dispersal capacity of butterflies in new populations of the Glanville fritillary is due in part to greater aerobic capacity, though this species has a low aerobic capacity in general when compared with known strong fliers. Low aerobic capacity may limit dispersal ability of the Glanville fritillary. PMID:24416122

Daedalus - Last Dryden flight

Science.gov (United States)

1988-01-01

The Daedalus 88, with Glenn Tremml piloting, is seen here on its last flight for the NASA Dryden Flight Research Center, Edwards, California. The Light Eagle and Daedalus human powered aircraft were testbeds for flight research conducted at Dryden between January 1987 and March 1988. These unique aircraft were designed and constructed by a group of students, professors, and alumni of the Massachusetts Institute of Technology within the context of the Daedalus project. The construction of the Light Eagle and Daedalus aircraft was funded primarily by the Anheuser Busch and United Technologies Corporations, respectively, with additional support from the Smithsonian Air and Space Museum, MIT, and a number of other sponsors. To celebrate the Greek myth of Daedalus, the man who constructed wings of wax and feathers to escape King Minos, the Daedalus project began with the goal of designing, building and testing a human-powered aircraft that could fly the mythical distance, 115 km. To achieve this goal, three aircraft were constructed. The Light Eagle was the prototype aircraft, weighing 92 pounds. On January 22, 1987, it set a closed course distance record of 59 km, which still stands. Also in January of 1987, the Light Eagle was powered by Lois McCallin to set the straight distance, the distance around a closed circuit, and the duration world records for the female division in human powered vehicles. Following this success, two more aircraft were built, the Daedalus 87 and Daedalus 88. Each aircraft weighed approximately 69 pounds. The Daedalus 88 aircraft was the ship that flew the 199 km from the Iraklion Air Force Base on Crete in the Mediterranean Sea, to the island of Santorini in 3 hours, 54 minutes. In the process, the aircraft set new records in distance and endurance for a human powered aircraft. The specific areas of flight research conducted at Dryden included characterizing the rigid body and flexible dynamics of the Light Eagle, investigating sensors for an

Francisco A. Ortega Martínez y Yobenj Aucardo Chicangana-Bayona, eds. Conceptos fundamentales de la cultura política de la Independencia.

Directory of Open Access Journals (Sweden)

Margarita Garrido

2016-07-01

Full Text Available El libro editado por Francisco Ortega Martínez y Yobenj Aucardo Chicangana-Bayona es, en buena parte, producto de una investigación colectiva sobre los lenguajes políticos del período de la Independencia neogranadina, iniciada ya hace más de siete años con un grupo de estudiantes de maestría de la Universidad Nacional que, al ampliar sus fronteras, ha involucrado a otros investigadores nacionales y extranjeros, con quienes discute su propuesta metodológica y de principios con respecto a la historia conceptual. Lo interesante es que el libro no es la respuesta a un llamado a enviar artículos que más o menos se acomoden a unos temas y problemas, sino el resultado de lecturas conjuntas, debates y reflexiones que le permitió compartir a los autores lo que en su momento entendían por historia conceptual y por cultura política. Así, decidieron formular preguntas que no solo dieran cuenta de la semántica histórica sino que además, como lo plantean en la introducción, indagan por las experiencias que alimentaron los sentidos dados a un concepto y las expectativas que despertaron entre quienes lo usaron. Los conceptos a trabajar fueron escogidos, entendiendo que tenían esa calidad precisamente por haber estado en el centro de los debates por el sentido y el significado de los acontecimientos; porque fue con esos conceptos que los contemporáneos reflexionaron y elaboraron las experiencias vividas.

Flight test of the X-29A at high angle of attack: Flight dynamics and controls

Science.gov (United States)

Bauer, Jeffrey E.; Clarke, Robert; Burken, John J.

1995-01-01

The NASA Dryden Flight Research Center has flight tested two X-29A aircraft at low and high angles of attack. The high-angle-of-attack tests evaluate the feasibility of integrated X-29A technologies. More specific objectives focus on evaluating the high-angle-of-attack flying qualities, defining multiaxis controllability limits, and determining the maximum pitch-pointing capability. A pilot-selectable gain system allows examination of tradeoffs in airplane stability and maneuverability. Basic fighter maneuvers provide qualitative evaluation. Bank angle captures permit qualitative data analysis. This paper discusses the design goals and approach for high-angle-of-attack control laws and provides results from the envelope expansion and handling qualities testing at intermediate angles of attack. Comparisons of the flight test results to the predictions are made where appropriate. The pitch rate command structure of the longitudinal control system is shown to be a valid design for high-angle-of-attack control laws. Flight test results show that wing rock amplitude was overpredicted and aileron and rudder effectiveness were underpredicted. Flight tests show the X-29A airplane to be a good aircraft up to 40 deg angle of attack.

Flight Operations . [Zero Knowledge to Mission Complete

Science.gov (United States)

Forest, Greg; Apyan, Alex; Hillin, Andrew

2016-01-01

Outline the process that takes new hires with zero knowledge all the way to the point of completing missions in Flight Operations. Audience members should be able to outline the attributes of a flight controller and instructor, outline the training flow for flight controllers and instructors, and identify how the flight controller and instructor attributes are necessary to ensure operational excellence in mission prep and execution. Identify how the simulation environment is used to develop crisis management, communication, teamwork, and leadership skills for SGT employees beyond what can be provided by classroom training.

The dynamics of parabolic flight: Flight characteristics and passenger percepts

Science.gov (United States)

Karmali, Faisal; Shelhamer, Mark

2008-09-01

Flying a parabolic trajectory in an aircraft is one of the few ways to create freefall on Earth, which is important for astronaut training and scientific research. Here we review the physics underlying parabolic flight, explain the resulting flight dynamics, and describe several counterintuitive findings, which we corroborate using experimental data. Typically, the aircraft flies parabolic arcs that produce approximately 25 s of freefall (0 g) followed by 40 s of enhanced force (1.8 g), repeated 30-60 times. Although passengers perceive gravity to be zero, in actuality acceleration, and not gravity, has changed, and thus we caution against the terms "microgravity" and "zero gravity." Despite the aircraft trajectory including large (45°) pitch-up and pitch-down attitudes, the occupants experience a net force perpendicular to the floor of the aircraft. This is because the aircraft generates appropriate lift and thrust to produce the desired vertical and longitudinal accelerations, respectively, although we measured moderate (0.2 g) aft-ward accelerations during certain parts of these trajectories. Aircraft pitch rotation (average 3°/s) is barely detectable by the vestibular system, but could influence some physics experiments. Investigators should consider such details in the planning, analysis, and interpretation of parabolic-flight experiments.

14 CFR 125.75 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 125.75 Section 125... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Airplane flight manual. (a) Each certificate holder shall keep a current approved Airplane Flight Manual or...

Bisphosphonate ISS Flight Experiment

Science.gov (United States)

LeBlanc, Adrian; Matsumoto, Toshio; Jones, Jeffrey; Shapiro, Jay; Lang, Thomas; Shackleford, Linda; Smith, Scott M.; Evans, Harlan; Spector, Elizabeth; Ploutz-Snyder, Robert;

Shuttle operations era planning for flight operations

Science.gov (United States)

Holt, J. D.; Beckman, D. A.

1984-01-01

The Space Transportation System (STS) provides routine access to space for a wide range of customers in which cargos vary from single payloads on dedicated flights to multiple payloads that share Shuttle resources. This paper describes the flight operations planning process from payload introduction through flight assignment to execution of the payload objectives and the changes that have been introduced to improve that process. Particular attention is given to the factors that influence the amount of preflight preparation necessary to satisfy customer requirements. The partnership between the STS operations team and the customer is described in terms of their functions and responsibilities in the development of a flight plan. A description of the Mission Control Center (MCC) and payload support capabilities completes the overview of Shuttle flight operations.

Evaluation of Small Unmanned Aircraft Flight Trajectory Accuracy

Directory of Open Access Journals (Sweden)

Ramūnas Kikutis

2014-12-01

Full Text Available Today small unmanned aircraft are being more widely adapted for practical tasks. These tasks require high reliability and flight path accuracy. For such aircraft we have to deal with the chalenge how to compensate external factors and how to ensure the accuracy of the flight trajectory according to new regulations and standards. In this paper, new regulations for the flights of small unmanned aircraft in Lithuanian air space are discussed. Main factors, which affect errors of the autonomous flight path tracking, are discussed too. The emphasis is on the wind factor and the flight path of Dubbin’s trajectories. Research was performed with mathematical-dynamic model of UAV and it was compared with theoretical calculations. All calculations and experiments were accomplished for the circular part of Dubbin’s paths when the airplane was trimmed for circular trajectory flight in calm conditions. Further, for such flight the wind influence was analysed.

Core Flight System Satellite Starter Kit

Data.gov (United States)

National Aeronautics and Space Administration — The Core Flight System Satellite Starter Kit (cFS Kit) will allow a small satellite or CubeSat developer to rapidly develop, deploy, test, and operate flight...

REHABILITACIÓN DE SUELOS SALINO-SÓDICOS: ESTUDIO DE CASO EN EL DISTRITO DE RIEGO 086, JIMÉNEZ, TAMAULIPAS, MÉXICO

Directory of Open Access Journals (Sweden)

Juana Irma Manzano Banda

2014-07-01

Full Text Available Se evaluó el efecto de la aplicación de estiércol bovino, yeso, ácido sulfúrico y lavado de suelos sobre la concentración de sales solubles y proporción de sodio en dos suelos salino-sódicos, provenientes del Distrito de Riego 086 de Jiménez, Tamaulipas, México. Se utilizaron macetas con 6 kg de suelo bajo condiciones de invernadero para ensayar dos niveles de salinidad-sodicidad (suelo Carretas con nivel moderado y suelo Macahuistle con nivel alto, dos mejoradores inorgánicos (yeso y ácido sulfúrico y un mejorador orgánico (estiércol. Se utilizó un diseño experimental completamente al azar con arreglo factorial 2 × 2 × 3. Las variables de respuesta fueron conductividad eléctrica (CE, porciento de sodio intercambiable (PSI y pH. La salinidad inicial en el suelo Carretas, con CE = 7.75 dS m-1 y Macahuistle con CE = 22.2 dS m-1, disminuyó a menos de 4 dS m-1. El PSI inicial del suelo Carretas fue 18.4 y el del suelo Macahuistle 34, valores que se abatieron a niveles menores de 8. El pH inicial de 7.8 en el suelo Carretas y 8 en el suelo Macahuistle, disminuyeron a un valor de 7.4 con la aplicación de estiércol y ácido sulfúrico. El lavado redujo la salinidad y sodicidad de ambos suelos hasta niveles satisfactorios para cultivos convencionales, con y sin de la aplicación de estiércol bovino, yeso y ácido sulfúrico.

14 CFR 21.37 - Flight test pilot.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight test pilot. 21.37 Section 21.37... PROCEDURES FOR PRODUCTS AND PARTS Type Certificates § 21.37 Flight test pilot. Each applicant for a normal... holding an appropriate pilot certificate to make the flight tests required by this part. [Doc. No. 5085...

Preliminary flight test results of a fly-by-throttle emergency flight control system on an F-15 airplane

Science.gov (United States)

Burcham, Frank W., Jr.; Maine, Trindel A.; Fullerton, C. G.; Wells, Edward A.

1993-01-01

A multi-engine aircraft, with some or all of the flight control system inoperative, may use engine thrust for control. NASA Dryden has conducted a study of the capability and techniques for this emergency flight control method for the F-15 airplane. With an augmented control system, engine thrust, along with appropriate feedback parameters, is used to control flightpath and bank angle. Extensive simulation studies have been followed by flight tests. This paper discusses the principles of throttles-only control, the F-15 airplane, the augmented system, and the flight results including landing approaches with throttles-only control to within 10 ft of the ground.

Remotely Piloted Vehicles for Experimental Flight Control Testing

Science.gov (United States)

Motter, Mark A.; High, James W.

2009-01-01

A successful flight test and training campaign of the NASA Flying Controls Testbed was conducted at Naval Outlying Field, Webster Field, MD during 2008. Both the prop and jet-powered versions of the subscale, remotely piloted testbeds were used to test representative experimental flight controllers. These testbeds were developed by the Subsonic Fixed Wing Project s emphasis on new flight test techniques. The Subsonic Fixed Wing Project is under the Fundamental Aeronautics Program of NASA's Aeronautics Research Mission Directorate (ARMD). The purpose of these testbeds is to quickly and inexpensively evaluate advanced concepts and experimental flight controls, with applications to adaptive control, system identification, novel control effectors, correlation of subscale flight tests with wind tunnel results, and autonomous operations. Flight tests and operator training were conducted during four separate series of tests during April, May, June and August 2008. Experimental controllers were engaged and disengaged during fully autonomous flight in the designated test area. Flaps and landing gear were deployed by commands from the ground control station as unanticipated disturbances. The flight tests were performed NASA personnel with support from the Maritime Unmanned Development and Operations (MUDO) team of the Naval Air Warfare Center, Aircraft Division

Biochemical and hematologic changes after short-term space flight

Science.gov (United States)

Leach, C. S.

1992-01-01

Clinical laboratory data from blood samples obtained from astronauts before and after 28 flights (average duration = 6 days) of the Space Shuttle were analyzed by the paired t-test and the Wilcoxon signed-rank test and compared with data from the Skylab flights (duration approximately 28, 59, and 84 days). Angiotensin I and aldosterone were elevated immediately after short-term space flights, but the response of angiotensin I was delayed after Skylab flights. Serum calcium was not elevated after Shuttle flights, but magnesium and uric acid decreased after both Shuttle and Skylab. Creatine phosphokinase in serum was reduced after Shuttle but not Skylab flights, probably because exercises to prevent deconditioning were not performed on the Shuttle. Total cholesterol was unchanged after Shuttle flights, but low density lipoprotein cholesterol increased and high density lipoprotein cholesterol decreased. The concentration of red blood cells was elevated after Shuttle flights and reduced after Skylab flights. Reticulocyte count was decreased after both short- and long-term flights, indicating that a reduction in red blood cell mass is probably more closely related to suppression of red cell production than to an increase in destruction of erythrocytes. Serum ferritin and number of platelets were also elevated after Shuttle flights. In determining the reasons for postflight differences between the shorter and longer flights, it is important to consider not only duration but also countermeasures, differences between spacecraft, and procedures for landing and egress.

Cytogenic Investigations in Flight Personnel

International Nuclear Information System (INIS)

Wolf, G.; Obe, G.; Bergau, L.

1999-01-01

During long-distance flights at high altitudes flight personnel are exposed to cosmic radiation. In order to determine whether there are biological effects of such low dose radiation exposure in aircrew, chromosomal aberrations were investigated in 59 female cabin attendants and a matched control group of 31 members of station personnel. The mean number of dicentric chromosomes amounts to 1.3 (95% CI 1.0-1.6) per 1,000 cells in cabin attendants and 1.4 (95% CI 1.0-1.9) per 1,000 cells in controls. In an additional control group of 56 female clerks from Berlin the mean frequency of dicentric chromosomes was 1.3 (95% CI 1.0-1.6). Neither in dicentric frequency and distribution nor in other aberrations was a significant difference between the groups of flight and station personnel found. The high frequency of multi-aberrant cells was remarkable in flight personnel as well as in station personnel. The reason for this phenomenon is unknown and needs further investigation. (author)

14 CFR 23.673 - Primary flight controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Primary flight controls. 23.673 Section 23... Control Systems § 23.673 Primary flight controls. Primary flight controls are those used by the pilot for the immediate control of pitch, roll, and yaw. [Doc. No. 4080, 29 FR 17955, Dec. 18, 1964, as amended...

Positive Exchange of Flight Controls Program

Science.gov (United States)

1995-03-10

This advisory circular provides guidance for all pilots, especially student pilots, flight instructors, and pilot examiners, on the recommended procedure to use for the positive exchange of flight controls between pilots when operating an aircraft.

Biomechanics of optimal flight in ski-jumping.

Science.gov (United States)

Remizov, L P

1984-01-01

The flight in a vertical plane of a ski-jumper after take-off was studied with the purpose of maximising flight distance. To solve the problem of optimal flight (how a jumper must change his angle of attack to obtain the longest jump) the basic theorem of the optimal control theory--Pontriagin's maximum principle--was applied. The calculations were based on data from wind tunnel experiments. It was shown that the maximum flight distance is achieved when the angle of attack is gradually increased according to a convex function the form of which depends on the individual aerodynamic parameters.

NASA Langley's AirSTAR Testbed: A Subscale Flight Test Capability for Flight Dynamics and Control System Experiments

Science.gov (United States)

Jordan, Thomas L.; Bailey, Roger M.

2008-01-01

As part of the Airborne Subscale Transport Aircraft Research (AirSTAR) project, NASA Langley Research Center (LaRC) has developed a subscaled flying testbed in order to conduct research experiments in support of the goals of NASA s Aviation Safety Program. This research capability consists of three distinct components. The first of these is the research aircraft, of which there are several in the AirSTAR stable. These aircraft range from a dynamically-scaled, twin turbine vehicle to a propeller driven, off-the-shelf airframe. Each of these airframes carves out its own niche in the research test program. All of the airplanes have sophisticated on-board data acquisition and actuation systems, recording, telemetering, processing, and/or receiving data from research control systems. The second piece of the testbed is the ground facilities, which encompass the hardware and software infrastructure necessary to provide comprehensive support services for conducting flight research using the subscale aircraft, including: subsystem development, integrated testing, remote piloting of the subscale aircraft, telemetry processing, experimental flight control law implementation and evaluation, flight simulation, data recording/archiving, and communications. The ground facilities are comprised of two major components: (1) The Base Research Station (BRS), a LaRC laboratory facility for system development, testing and data analysis, and (2) The Mobile Operations Station (MOS), a self-contained, motorized vehicle serving as a mobile research command/operations center, functionally equivalent to the BRS, capable of deployment to remote sites for supporting flight tests. The third piece of the testbed is the test facility itself. Research flights carried out by the AirSTAR team are conducted at NASA Wallops Flight Facility (WFF) on the Eastern Shore of Virginia. The UAV Island runway is a 50 x 1500 paved runway that lies within restricted airspace at Wallops Flight Facility. The

JACEE long duration balloon flights

International Nuclear Information System (INIS)

Burnett, T.; Iwai, J.; Lord, J.J.; Strausz, S.; Wilkes, R.J.; Dake, S.; Oda, H.; Miyamura, O.; Fuki, M.; Jones, W.V.; Gregory, J.; Hayashi, T.; Takahashi, U.; Tominaga, Y.; Wefel, J.P.; Fountain, W.; Derrickson, J.; Parnell, T.A.; Roberts, E.; Tabuki, T.; Watts, J.W.

1989-01-01

JACEE balloon-borne emulsion chamber detectors are used to observe the spectra and interactions of cosmic ray protons and nuclei in the energy range 1-100A TeV. Experience with long duration mid-latitude balloon flights and characteristics of the detector system that make it ideal for planned Antarctic balloon flights are discussed. 5 refs., 2 figs

ALOFT Flight Test Report

Science.gov (United States)

1977-10-01

wmmmmmmmmmmmm i ifmu.immM\\]i\\ ßinimm^mmmmviwmmiwui »vimtm twfjmmmmmmi c-f—rmSmn NWC TP 5954 ALOFT Flight Test Report by James D. Ross anrJ I.. M...responsible i"- u conducting the ALOFT Flight Test Program and made contributions to this report: J. Basden , R. ".estbrook, L. Thompson, J. Willians...REPORT DOCUMENTATION PAGE READ INSTRUCTIONS BEFORE COMPLETING FORM 7. AUTMORC«; <oss James D./Xo L. M.y&ohnson IZATION NAME AND ADDRESS Naval

Flight Test of L1 Adaptive Control Law: Offset Landings and Large Flight Envelope Modeling Work

Science.gov (United States)

Gregory, Irene M.; Xargay, Enric; Cao, Chengyu; Hovakimyan, Naira

2011-01-01

This paper presents new results of a flight test of the L1 adaptive control architecture designed to directly compensate for significant uncertain cross-coupling in nonlinear systems. The flight test was conducted on the subscale turbine powered Generic Transport Model that is an integral part of the Airborne Subscale Transport Aircraft Research system at the NASA Langley Research Center. The results presented include control law evaluation for piloted offset landing tasks as well as results in support of nonlinear aerodynamic modeling and real-time dynamic modeling of the departure-prone edges of the flight envelope.

Microgravity Flight: Accommodating Non-Human Primates

Science.gov (United States)

Dalton, Bonnie P.; Searby, Nancy; Ostrach, Louis

1995-01-01

Spacelab Life Sciences-3 (SLS-3) was scheduled to be the first United States man-tended microgravity flight containing Rhesus monkeys. The goal of this flight as in the five untended Russian COSMOS Bion flights and an earlier American Biosatellite flight, was to understand the biomedical and biological effects of a microgravity environment using the non-human primate as human surrogate. The SLS-3/Rhesus Project and COSMOS Primate-BIOS flights all utilized the rhesus monkey, Macaca mulatta. The ultimate objective of all flights with an animal surrogate has been to evaluate and understand biological mechanisms at both the system and cellular level, thus enabling rational effective countermeasures for future long duration human activity under microgravity conditions and enabling technical application to correction of common human physiological problems within earth's gravity, e.g., muscle strength and reloading, osteoporosis, immune deficiency diseases. Hardware developed for the SLS-3/Rhesus Project was the result of a joint effort with the French Centre National d'Etudes Spatiales (CNES) and the United States National Aeronautics and Space Administration (NASA) extending over the last decade. The flight hardware design and development required implementation of sufficient automation to insure flight crew and animal bio-isolation and maintenance with minimal impact to crew activities. A variety of hardware of varying functional capabilities was developed to support the scientific objectives of the original 22 combined French and American experiments, along with 5 Russian co-investigations, including musculoskeletal, metabolic, and behavioral studies. Unique elements of the Rhesus Research Facility (RRF) included separation of waste for daily delivery of urine and fecal samples for metabolic studies and a psychomotor test system for behavioral studies along with monitored food measurement. As in untended flights, telemetry measurements would allow monitoring of

Effect of video-game experience and position of flight stick controller on simulated-flight performance.

Science.gov (United States)

Cho, Bo-Keun; Aghazadeh, Fereydoun; Al-Qaisi, Saif

2012-01-01

The purpose of this study was to determine the effects of video-game experience and flight-stick position on flying performance. The study divided participants into 2 groups; center- and side-stick groups, which were further divided into high and low level of video-game experience subgroups. The experiment consisted of 7 sessions of simulated flying, and in the last session, the flight stick controller was switched to the other position. Flight performance was measured in terms of the deviation of heading, altitude, and airspeed from their respective requirements. Participants with high experience in video games performed significantly better (p increase (0.78 %). However, after switching from a center- to a side-stick controller, performance scores decreased (4.8%).

Commercial air travel and in-flight pulmonary hypertension.

Science.gov (United States)

Smith, Thomas G; Chang, Rae W; Robbins, Peter A; Dorrington, Keith L

2013-01-01

It has recently been shown that commercial air travel triggers hypoxic pulmonary vasoconstriction and modestly increases pulmonary artery pressure in healthy passengers. There is large interindividual variation in hypoxic pulmonary vasoreactivity, and some passengers may be at risk of developing flight-induced pulmonary hypertension, with potentially dangerous consequences. This study sought to determine whether it is possible for a susceptible passenger to develop pulmonary hypertension in response to a routine commercial flight. Using in-flight echocardiography, a passenger was studied during a 6-h commercial flight from London to Dubai. The passenger was generally well and frequently traveled by air, but had been diagnosed with Chuvash polycythemia, a genetic condition that is associated with increased hypoxic pulmonary vasoreactivity. Hematocrit had been normalized with regular venesection. During the flight, arterial oxygen saturation fell to a minimum of 96% and systolic pulmonary artery pressure (sPAP) rapidly increased into the pulmonary hypertensive range. The in-flight increase in sPAP was 50%, reaching a peak of 45 mmHg. This study has established that an asymptomatic but susceptible passenger can rapidly develop in-flight pulmonary hypertension even during a medium-haul flight. Prospective passengers at risk from such responses, including those who have cardiopulmonary disease or increased hypoxic pulmonary vasoreactivity, could benefit from preflight evaluation with a hypoxia altitude simulation test combined with simultaneous echocardiography (HAST-echo). The use of in-flight supplementary oxygen should be considered for susceptible individuals, including all patients diagnosed with Chuvash polycythemia.

Flight testing of a luminescent surface pressure sensor

Science.gov (United States)

Mclachlan, B. G.; Bell, J. H.; Espina, J.; Gallery, J.; Gouterman, M.; Demandante, C. G. N.; Bjarke, L.

1992-01-01

NASA ARC has conducted flight tests of a new type of aerodynamic pressure sensor based on a luminescent surface coating. Flights were conducted at the NASA ARC-Dryden Flight Research Facility. The luminescent pressure sensor is based on a surface coating which, when illuminated with ultraviolet light, emits visible light with an intensity dependent on the local air pressure on the surface. This technique makes it possible to obtain pressure data over the entire surface of an aircraft, as opposed to conventional instrumentation, which can only make measurements at pre-selected points. The objective of the flight tests was to evaluate the effectiveness and practicality of a luminescent pressure sensor in the actual flight environment. A luminescent pressure sensor was installed on a fin, the Flight Test Fixture (FTF), that is attached to the underside of an F-104 aircraft. The response of one particular surface coating was evaluated at low supersonic Mach numbers (M = 1.0-1.6) in order to provide an initial estimate of the sensor's capabilities. This memo describes the test approach, the techniques used, and the pressure sensor's behavior under flight conditions. A direct comparison between data provided by the luminescent pressure sensor and that produced by conventional pressure instrumentation shows that the luminescent sensor can provide quantitative data under flight conditions. However, the test results also show that the sensor has a number of limitations which must be addressed if this technique is to prove useful in the flight environment.

Flight envelope protection system for unmanned aerial vehicles

KAUST Repository

Claudel, Christian G.; Shaqura, Mohammad

2016-01-01

Systems and methods to protect the flight envelope in both manual flight and flight by a commercial autopilot are provided. A system can comprise: an inertial measurement unit (IMU); a computing device in data communication with the IMU

Assessing public exposure in commercial flights in Brazil

Energy Technology Data Exchange (ETDEWEB)

Alves, Vanusa A.; Rochedo, Elaine R.R.; Prado, Nadya M.P.D. [Instituto Militar de Engenharia, Pc. Gen. Tiburcio, 80, Praia Vermelha, Rio de Janeiro, 22290-270 RJ (Brazil); Wasserman, Maria Angelica V. [Instituto de Engenharia Nuclear, Cidade Universitaria, Ilha do Fundao, 21941-906, Rio de Janeiro RJ (Brazil)

2014-07-01

The exposure to cosmic radiation in aircraft travel is higher than at ground level and varies with the year, the latitude, the altitude of flight and the flight time. The aim of this work was to estimate the contribution of cosmic radiation exposure on commercial flights to the Brazilian population. A database, including about 4000 domestic flights was implemented in Excel spreadsheet. The computer program CARI-6, developed by the U.S. Federal Aviation Administration, was used to calculate doses received in each route. Individual effective doses for commercial flights within Brazil ranged from 0.3 to 8.8 μSv, with a total collective annual dose of 312 man Sv. This value is low, about 5 % of the collective dose estimated for domestic flights in US and about 20 % of the collective doses from all flights in UK. This work shall serve as a baseline for future comparisons of exposures due to the growth of civil aviation in the country and open discussions on the concept of risk and its public acceptance, which are relevant aspects for defining radiological protection guidelines. (authors)

Rules for Flight Paths and Time of Flight for Flows in Porous Media with Heterogeneous Permeability and Porosity

Directory of Open Access Journals (Sweden)

Lihua Zuo

2017-01-01

Full Text Available Porous media like hydrocarbon reservoirs may be composed of a wide variety of rocks with different porosity and permeability. Our study shows in algorithms and in synthetic numerical simulations that the flow pattern of any particular porous medium, assuming constant fluid properties and standardized boundary and initial conditions, is not affected by any spatial porosity changes but will vary only according to spatial permeability changes. In contrast, the time of flight along the streamline will be affected by both the permeability and porosity, albeit in opposite directions. A theoretical framework is presented with evidence from flow visualizations. A series of strategically chosen streamline simulations, including systematic spatial variations of porosity and permeability, visualizes the respective effects on the flight path and time of flight. Two practical rules are formulated. Rule  1 states that an increase in permeability decreases the time of flight, whereas an increase in porosity increases the time of flight. Rule  2 states that the permeability uniquely controls the flight path of fluid flow in porous media; local porosity variations do not affect the streamline path. The two rules are essential for understanding fluid transport mechanisms, and their rigorous validation therefore is merited.

La Seguridad Integral: España 2020

OpenAIRE

Pardo Buendía, Mercedes

2009-01-01

Dirección y co-redacción principal: Óscar Jaime Jiménez, Antonio M. Díaz Fernández. Expertos que han participado en la elaboración: Rogelio Alonso Pascual, Félix Arteaga Martín, Pedro Arrojo Agudo, Rut Bermejo Casado, Julio Bordas Martínez, Lorenzo Castro Moral, Andrés García Gómez, Raúl C. Mainar-Jaime, Rafael Martínez Martínez, Miguel Ángel Muñoz Rodríguez, Mercedes Pardo Buendía, René Pita Pita, Gonzalo Sáenz de Miera, Fernando Soteras Escartín, Diego Torrente Robles, F...

Integrated Neural Flight and Propulsion Control System

Science.gov (United States)

Kaneshige, John; Gundy-Burlet, Karen; Norvig, Peter (Technical Monitor)

2001-01-01

This paper describes an integrated neural flight and propulsion control system. which uses a neural network based approach for applying alternate sources of control power in the presence of damage or failures. Under normal operating conditions, the system utilizes conventional flight control surfaces. Neural networks are used to provide consistent handling qualities across flight conditions and for different aircraft configurations. Under damage or failure conditions, the system may utilize unconventional flight control surface allocations, along with integrated propulsion control, when additional control power is necessary for achieving desired flight control performance. In this case, neural networks are used to adapt to changes in aircraft dynamics and control allocation schemes. Of significant importance here is the fact that this system can operate without emergency or backup flight control mode operations. An additional advantage is that this system can utilize, but does not require, fault detection and isolation information or explicit parameter identification. Piloted simulation studies were performed on a commercial transport aircraft simulator. Subjects included both NASA test pilots and commercial airline crews. Results demonstrate the potential for improving handing qualities and significantly increasing survivability rates under various simulated failure conditions.

Envelope Protection for In-Flight Ice Contamination

Science.gov (United States)

Gingras, David R.; Barnhart, Billy P.; Ranaudo, Richard J.; Ratvasky, Thomas P.; Morelli, Eugene A.

2010-01-01

Fatal loss-of-control (LOC) accidents have been directly related to in-flight airframe icing. The prototype system presented in this paper directly addresses the need for real-time onboard envelope protection in icing conditions. The combinations of a-priori information and realtime aerodynamic estimations are shown to provide sufficient input for determining safe limits of the flight envelope during in-flight icing encounters. The Icing Contamination Envelope Protection (ICEPro) system has been designed and implemented to identify degradations in airplane performance and flying qualities resulting from ice contamination and provide safe flight-envelope cues to the pilot. Components of ICEPro are described and results from preliminary tests are presented.

Time Manager Software for a Flight Processor

Science.gov (United States)

Zoerne, Roger

2012-01-01

Data analysis is a process of inspecting, cleaning, transforming, and modeling data to highlight useful information and suggest conclusions. Accurate timestamps and a timeline of vehicle events are needed to analyze flight data. By moving the timekeeping to the flight processor, there is no longer a need for a redundant time source. If each flight processor is initially synchronized to GPS, they can freewheel and maintain a fairly accurate time throughout the flight with no additional GPS time messages received. How ever, additional GPS time messages will ensure an even greater accuracy. When a timestamp is required, a gettime function is called that immediately reads the time-base register.

Numerical simulation of hypersonic flight experiment vehicle

OpenAIRE

Yamamoto, Yukimitsu; Yoshioka, Minako; 山本　行光; 吉岡　美菜子

1994-01-01

Hypersonic aerodynamic characteristics of Hypersonic FLight EXperiment (HYFLEX vehicle were investigated by numerical simulations using Navier-Stokes CFD (Computational Fluid Dynamics) code of NAL. Numerical results were compared with experimental data obtained at Hypersonic Wind Tunnel at NAL. In order to investigate real flight aerodynamic characteristics. numerical calculations corresponding to the flight conditions suffering from maximum aero thermodynamic heating were also made and the d...

Development flight tests of JetStar LFC leading-edge flight test experiment

Science.gov (United States)

Fisher, David F.; Fischer, Michael C.

1987-01-01

The overall objective of the flight tests on the JetStar aircraft was to demonstrate the effectiveness and reliability of laminar flow control under representative flight conditions. One specific objective was to obtain laminar flow on the JetStar leading-edge test articles for the design and off-design conditions. Another specific objective was to obtain operational experience on a Laminar Flow Control (LFC) leading-edge system in a simulated airline service. This included operational experience with cleaning requirements, the effect of clogging, possible foreign object damage, erosion, and the effects of ice particle and cloud encounters. Results are summarized.

The Cryogenic Test Bed experiments: Cryogenic heat pipe flight experiment CRYOHP (STS-53). Cryogenic two phase flight experiment CRYOTP (STS-62). Cryogenic flexible diode flight experiment CRYOFD

Science.gov (United States)

Thienel, Lee; Stouffer, Chuck

1995-09-01

This paper presents an overview of the Cryogenic Test Bed (CTB) experiments including experiment results, integration techniques used, and lessons learned during integration, test and flight phases of the Cryogenic Heat Pipe Flight Experiment (STS-53) and the Cryogenic Two Phase Flight Experiment (OAST-2, STS-62). We will also discuss the Cryogenic Flexible Diode Heat Pipe (CRYOFD) experiment which will fly in the 1996/97 time frame and the fourth flight of the CTB which will fly in the 1997/98 time frame. The two missions tested two oxygen axially grooved heat pipes, a nitrogen fibrous wick heat pipe and a 2-methylpentane phase change material thermal storage unit. Techniques were found for solving problems with vibration from the cryo-collers transmitted through the compressors and the cold heads, and mounting the heat pipe without introducing parasitic heat leaks. A thermally conductive interface material was selected that would meet the requirements and perform over the temperature range of 55 to 300 K. Problems are discussed with the bi-metallic thermostats used for heater circuit protection and the S-Glass suspension straps originally used to secure the BETSU PCM in the CRYOTP mission. Flight results will be compared to 1-g test results and differences will be discussed.

The operational flight and multi-crew scheduling problem

Directory of Open Access Journals (Sweden)

Stojković Mirela

2005-01-01

Full Text Available This paper introduces a new kind of operational multi-crew scheduling problem which consists in simultaneously modifying, as necessary, the existing flight departure times and planned individual work days (duties for the set of crew members, while respecting predefined aircraft itineraries. The splitting of a planned crew is allowed during a day of operations, where it is more important to cover a flight than to keep planned crew members together. The objective is to cover a maximum number of flights from a day of operations while minimizing changes in both the flight schedule and the next-day planned duties for the considered crew members. A new type of the same flight departure time constraints is introduced. They ensure that a flight which belongs to several personalized duties, where the number of duties is equal to the number of crew members assigned to the flight, will have the same departure time in each of these duties. Two variants of the problem are considered. The first variant allows covering of flights by less than the planned number of crew members, while the second one requires covering of flights by a complete crew. The problem is mathematically formulated as an integer nonlinear multi-commodity network flow model with time windows and supplementary constraints. The optimal solution approach is based on Dantzig-Wolfe decomposition/column generation embedded into a branch-and-bound scheme. The resulting computational times on commercial-size problems are very good. Our new simultaneous approach produces solutions whose quality is far better than that of the traditional sequential approach where the flight schedule has been changed first and then input as a fixed data to the crew scheduling problem.

On the typography of flight-deck documentation

Science.gov (United States)

Degani, Asaf

1992-01-01

Many types of paper documentation are employed on the flight-deck. They range from a simple checklist card to a bulky Aircraft Flight Manual (AFM). Some of these documentations have typographical and graphical deficiencies; yet, many cockpit tasks such as conducting checklists, way-point entry, limitations and performance calculations, and many more, require the use of these documents. Moreover, during emergency and abnormal situations, the flight crews' effectiveness in combating the situation is highly dependent on such documentation; accessing and reading procedures has a significant impact on flight safety. Although flight-deck documentation are an important (and sometimes critical) form of display in the modern cockpit, there is a dearth of information on how to effectively design these displays. The object of this report is to provide a summary of the available literature regarding the design and typographical aspects of printed matter. The report attempts 'to bridge' the gap between basic research about typography, and the kind of information needed by designers of flight-deck documentation. The report focuses on typographical factors such as type-faces, character height, use of lower- and upper-case characters, line length, and spacing. Some graphical aspects such as layout, color coding, fonts, and character contrast are also discussed. In addition, several aspects of cockpit reading conditions such as glare, angular alignment, and paper quality are addressed. Finally, a list of recommendations for the graphical design of flight-deck documentation is provided.

75 FR 7345 - Filtered Flight Data

Science.gov (United States)

2010-02-19

... digital flight data recorder regulations affecting certain air carriers and operators. This final rule prohibits the filtering of some original flight recorder sensor signals unless a certificate holder can show... A. Verna, Avionics Systems Branch, Aircraft Certification Service, AIR-130, Federal Aviation...

Orion Exploration Flight Test-1 Post-Flight Navigation Performance Assessment Relative to the Best Estimated Trajectory

Science.gov (United States)

Gay, Robert S.; Holt, Greg N.; Zanetti, Renato

2016-01-01

This paper details the post-flight navigation performance assessment of the Orion Exploration Flight Test-1 (EFT-1). Results of each flight phase are presented: Ground Align, Ascent, Orbit, and Entry Descent and Landing. This study examines the on-board Kalman Filter uncertainty along with state deviations relative to the Best Estimated Trajectory (BET). Overall the results show that the Orion Navigation System performed as well or better than expected. Specifically, the Global Positioning System (GPS) measurement availability was significantly better than anticipated at high altitudes. In addition, attitude estimation via processing GPS measurements along with Inertial Measurement Unit (IMU) data performed very well and maintained good attitude throughout the mission.

Liability and Insurance for Suborbital Flights

Science.gov (United States)

Masson-Zwaan, T.

2012-01-01

This paper analyzes and compares liability and liability insurance in the fields of aviation and spaceflight in order to propose solutions for a liability regime and insurance options for suborbital flights. Suborbital flights can be said to take place in the grey zone between air and space, between air law and space law, as well as between aviation insurance and space insurance. In terms of liability, the paper discusses air law and space law provisions in the fields of second and third party liability for damage to passengers and 'innocent bystanders' respectively, touching upon international treaties, national law and EU law, and on insurance to cover those risks. Although the insurance market is currently not ready to provide tailor-made products for operators of suborbital flights, it is expected to adapt rapidly once such flights will become reality. A hybrid approach will provide the best solution in the medium term.

Optimal flight altitude and flight routes with respect to environmental and economical aspects

Energy Technology Data Exchange (ETDEWEB)

Nodorp, D.; Sausen, R.; Land, C. [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Oberpfaffenhofen (Germany). Inst. fuer Physik der Atmosphaere; Deidewig, F. [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Koeln (Germany). Inst. fuer Antriebstechnik

1997-12-31

A flight routing method is presented. In addition to conventional minimization of travel time and/or fuel consumption it also takes into account the environmental impact of the aircraft emissions on the climate system. In the process the ECHAM general circulation model is used to trace the pollutants after release, estimate their potential to cause damage and to weight this environmental relative to the economical aspect. Some case studies are presented for an Airbus A340 in the North Atlantic flight corridor. (author) 6 refs.

Optimal flight altitude and flight routes with respect to environmental and economical aspects

Energy Technology Data Exchange (ETDEWEB)

Nodorp, D; Sausen, R; Land, C [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Oberpfaffenhofen (Germany). Inst. fuer Physik der Atmosphaere; Deidewig, F [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Koeln (Germany). Inst. fuer Antriebstechnik

1998-12-31

A flight routing method is presented. In addition to conventional minimization of travel time and/or fuel consumption it also takes into account the environmental impact of the aircraft emissions on the climate system. In the process the ECHAM general circulation model is used to trace the pollutants after release, estimate their potential to cause damage and to weight this environmental relative to the economical aspect. Some case studies are presented for an Airbus A340 in the North Atlantic flight corridor. (author) 6 refs.

Morphing Flight Control Surface for Advanced Flight Performance, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — In this SBIR project, a new Morphing Flight Control Surface (MFCS) will be developed. The distinction of the research effort is that the SenAnTech team will employ...

Emigration of Natural and Hatchery Chinook Salmon and Steelhead Smolts from the Imnaha River, Oregon, Progress Report 2000-2002.

Energy Technology Data Exchange (ETDEWEB)

Cleary, Peter; Kucera, Paul; Blenden, Michael

2003-12-01

This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303

Operations Research Flight Ground Service Education/Outreach

Science.gov (United States)

Smith, Scott M.

2011-01-01

This viewgraph presentation describes a nutritional biochemistry assessment of astronauts in preflight, in-flight, and post-flight operations. In-flight collections of blood and urine samples from astronauts to test the effects of Vitamin K, Pro K, Vitamin D, Omega-3 Fatty Acids, Iron, and Sodium in spaceflight is shown. A demonstration of a 1-carbon metabolism pathway that determines the existence of enzymes and polymorphisms is also presented.

Flight Test Approach to Adaptive Control Research

Science.gov (United States)

Pavlock, Kate Maureen; Less, James L.; Larson, David Nils

2011-01-01

The National Aeronautics and Space Administration s Dryden Flight Research Center completed flight testing of adaptive controls research on a full-scale F-18 testbed. The validation of adaptive controls has the potential to enhance safety in the presence of adverse conditions such as structural damage or control surface failures. This paper describes the research interface architecture, risk mitigations, flight test approach and lessons learned of adaptive controls research.

Comprehensive analysis of transport aircraft flight performance

Science.gov (United States)

Filippone, Antonio

2008-04-01

This paper reviews the state-of-the art in comprehensive performance codes for fixed-wing aircraft. The importance of system analysis in flight performance is discussed. The paper highlights the role of aerodynamics, propulsion, flight mechanics, aeroacoustics, flight operation, numerical optimisation, stochastic methods and numerical analysis. The latter discipline is used to investigate the sensitivities of the sub-systems to uncertainties in critical state parameters or functional parameters. The paper discusses critically the data used for performance analysis, and the areas where progress is required. Comprehensive analysis codes can be used for mission fuel planning, envelope exploration, competition analysis, a wide variety of environmental studies, marketing analysis, aircraft certification and conceptual aircraft design. A comprehensive program that uses the multi-disciplinary approach for transport aircraft is presented. The model includes a geometry deck, a separate engine input deck with the main parameters, a database of engine performance from an independent simulation, and an operational deck. The comprehensive code has modules for deriving the geometry from bitmap files, an aerodynamics model for all flight conditions, a flight mechanics model for flight envelopes and mission analysis, an aircraft noise model and engine emissions. The model is validated at different levels. Validation of the aerodynamic model is done against the scale models DLR-F4 and F6. A general model analysis and flight envelope exploration are shown for the Boeing B-777-300 with GE-90 turbofan engines with intermediate passenger capacity (394 passengers in 2 classes). Validation of the flight model is done by sensitivity analysis on the wetted area (or profile drag), on the specific air range, the brake-release gross weight and the aircraft noise. A variety of results is shown, including specific air range charts, take-off weight-altitude charts, payload-range performance

Electrical Stimulation of Coleopteran Muscle for Initiating Flight.

Directory of Open Access Journals (Sweden)

Hao Yu Choo

Full Text Available Some researchers have long been interested in reconstructing natural insects into steerable robots or vehicles. However, until recently, these so-called cyborg insects, biobots, or living machines existed only in science fiction. Owing to recent advances in nano/micro manufacturing, data processing, and anatomical and physiological biology, we can now stimulate living insects to induce user-desired motor actions and behaviors. To improve the practicality and applicability of airborne cyborg insects, a reliable and controllable flight initiation protocol is required. This study demonstrates an electrical stimulation protocol that initiates flight in a beetle (Mecynorrhina torquata, Coleoptera. A reliable stimulation protocol was determined by analyzing a pair of dorsal longitudinal muscles (DLMs, flight muscles that oscillate the wings. DLM stimulation has achieved with a high success rate (> 90%, rapid response time (< 1.0 s, and small variation (< 0.33 s; indicating little habituation. Notably, the stimulation of DLMs caused no crucial damage to the free flight ability. In contrast, stimulation of optic lobes, which was earlier demonstrated as a successful flight initiation protocol, destabilized the beetle in flight. Thus, DLM stimulation is a promising secure protocol for inducing flight in cyborg insects or biobots.

Flight capital and its reversal for development financing

OpenAIRE

Hermes, Niels; Lensink, Robert; Murinde, Victor

2002-01-01

In this paper, we review the theoretical and empirical literature on capital flight. First, we discuss the measurement of capital flight. Next, we provide information on the magnitude as well as the ‘burden’ of capital flight for a selected set of developing countries in four regions of the world (South Asia, East Asia, Sub-Saharan Africa and Latin America). Moreover, we review the literature on the determinants of capital flight and provide an overview of empirical studies that have analysed...

Crew Factors in Flight Operations X: Alertness Management in Flight Operations

Science.gov (United States)

Rosekind, Mark R.; Gander, Philippa H.; Connell, Linda J.; Co, Elizabeth L.

2001-01-01

In response to a 1980 congressional request, NASA Ames Research Center initiated a Fatigue/Jet Lag Program to examine fatigue, sleep loss, and circadian disruption in aviation. Research has examined fatigue in a variety of flight environments using a range of measures (from self-report to performance to physiological). In 1991, the program evolved into the Fatigue Countermeasures Program, emphasizing the development and evaluation of strategies to maintain alertness and performance in operational settings. Over the years, the Federal Aviation Administration (FAA) has become a collaborative partner in support of fatigue research and other Program activities. From the inception of the Program, a principal goal was to return the information learned from research and other Program activities to the operational community. The objectives of this Education and Training Module are to explain what has been learned about the physiological mechanisms that underlie fatigue, demonstrate the application of this information in flight operations, and offer some specific fatigue countermeasure recommendations. It is intended for all segments of the aeronautics industry, including pilots, flight attendants, managers, schedulers, safety and policy personnel, maintenance crews, and others involved in an operational environment that challenges human physiological capabilities because of fatigue, sleep loss, and circadian disruption.

The hybrid bio-inspired aerial vehicle: Concept and SIMSCAPE flight simulation.

Science.gov (United States)

Tao Zhang; Su, Steven; Nguyen, Hung T

2016-08-01

This paper introduces a Silver Gull-inspired hybrid aerial vehicle, the Super Sydney Silver Gull (SSSG), which is able to vary its structure, under different manoeuvre requirements, to implement three flight modes: the flapping wing flight, the fixed wing flight, and the quadcopter flight (the rotary wing flight of Unmanned Air Vehicle). Specifically, through proper mechanism design and flight mode transition, the SSSG can imitate the Silver Gull's flight gesture during flapping flight, save power consuming by switching to the fixed wing flight mode during long-range cruising, and hover at targeted area when transferring to quadcopter flight mode. Based on the aerodynamic models, the Simscape, a product of MathWorks, is used to simulate and analyse the performance of the SSSG's flight modes. The entity simulation results indicate that the created SSSG's 3D model is feasible and ready to be manufactured for further flight tests.

Pernilla Craig Flight Around Lac Leman

CERN Multimedia

Goldfarb, Steven

2013-01-01

Aviator and future physicist Pernilla Craig visits CERN and is hosted by the Geneva Flight Club. Web pioneer Robert Cailliau helps in the preparations, flight instructor Aline Cosmetatos takes the co-pilot seat, and ATLAS outreach coordinator Steven Goldfarb serves cocktails from the back seat.

14 CFR 61.98 - Flight proficiency.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight proficiency. 61.98 Section 61.98 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN...) Navigation; (viii) Slow flight and stalls; (ix) Emergency operations; and (x) Postflight procedures. (2) For...

14 CFR 61.107 - Flight proficiency.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight proficiency. 61.107 Section 61.107 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN... reference maneuvers; (vii) Navigation; (viii) Slow flight and stalls; (ix) Basic instrument maneuvers; (x...

Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez.

Directory of Open Access Journals (Sweden)

Francisco José Rodríguez Marín

2013-01-01

Full Text Available Revistas UMA Encabezado de página Usuaria/o Contraseña No cerrar sesión Notificaciones Vista Suscribirse Idioma Contenidos Examinar Por número Por autor/a Por título Otras revistas Información Para lectores/as Para autores/as Para bibliotecarios/as Open Journal Systems Inicio Acerca de Actual Archivos Avisos Inicio > Núm. 34 (2013 > Rodríguez Marín Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez. Francisco José Rodríguez Marín Resumen Ver Resumen El interés de Rosario Camacho por la multiplicidad de mensajes y la cultura simbólica de carácter funerario fue, inicialmente, una consecuencia natural de sus investigaciones sobre la arquitectura barroca. En uno de sus libros más reconocidos, Málaga barroca. Arquitectura religiosa de los siglos XVII y XVIII (1981 analizó el panteón de los condes de Buenavista en la iglesia del monasterio de la Victoria y su impresionante conjunto de relieves y esculturas en torno a la muerte, recogiendo algunas de las interpretaciones que hasta entonces se habían realizado, como las de Juan Temboury o Santiago Sebastián. El carácter excepcional del conjunto arquitectónico de la iglesia, el monasterio, y especialmente, de la rica y original superposición de espacios verticales integrado por el mencionado panteón, la sacristía y el camarín de la Virgen, justifican la atención pormenorizada que se le prestó en una de las carpetas que, incluyendo planimetría y dedicadas al Barroco, fueron publicadas por el Colegio de Arquitectos de Málaga. La titulada El Santuario de la Victoria de Málaga (1986 tuvo por autores a Rosario Camacho y al arquitecto José María Romero.

Psychology of Flight Attendant’s Profession

Directory of Open Access Journals (Sweden)

Tatyana V. Filipieva

2012-01-01

Full Text Available The profession of a flight attendant appeared in aviation in the 1920s. Professionalcommunity of flight attendants is constantly growing with the growth ofcomplexity of aviation technology, professional standards of passenger serviceand safety. The psychological scientific research was carried out by a psychologistwho worked as a flight attendant. The study revealed the psychological content,demands, peculiarities in cabin crews’ labor. A job description was accomplished.Temporal and spatial characteristics, the main contradictions, unfavorable psychogenicand stress factors in labor were examined and described. Psychological profilesof a cabin attendant and of an air passenger were drawn up.

A Trajectory Generation Approach for Payload Directed Flight

Science.gov (United States)

Ippolito, Corey A.; Yeh, Yoo-Hsiu

2009-01-01

Presently, flight systems designed to perform payload-centric maneuvers require preconstructed procedures and special hand-tuned guidance modes. To enable intelligent maneuvering via strong coupling between the goals of payload-directed flight and the autopilot functions, there exists a need to rethink traditional autopilot design and function. Research into payload directed flight examines sensor and payload-centric autopilot modes, architectures, and algorithms that provide layers of intelligent guidance, navigation and control for flight vehicles to achieve mission goals related to the payload sensors, taking into account various constraints such as the performance limitations of the aircraft, target tracking and estimation, obstacle avoidance, and constraint satisfaction. Payload directed flight requires a methodology for accurate trajectory planning that lets the system anticipate expected return from a suite of onboard sensors. This paper presents an extension to the existing techniques used in the literature to quickly and accurately plan flight trajectories that predict and optimize the expected return of onboard payload sensors.

The Effects of Advanced 'Glass Cockpit' Displayed Flight Instrumentation on In-flight Pilot Decision Making

Science.gov (United States)

Steigerwald, John

The Cognitive Continuum Theory (CCT) was first proposed 25 years ago to explain the relationship between intuition and analytical decision making processes. In order for aircraft pilots to make these analytical and intuitive decisions, they obtain information from various instruments within the cockpit of the aircraft. Advanced instrumentation is used to provide a broad array of information about the aircraft condition and flight situation to aid the flight crew in making effective decisions. The problem addressed is that advanced instrumentation has not improved the pilot decision making in modern aircraft. Because making a decision is dependent upon the information available, this experimental quantitative study sought to determine how well pilots organize and interpret information obtained from various cockpit instrumentation displays when under time pressure. The population for this study was the students, flight instructors, and aviation faculty at the Middle Georgia State College School of Aviation campus in Eastman, Georgia. The sample was comprised of two groups of 90 individuals (45 in each group) in various stages of pilot licensure from student pilot to airline transport pilot (ATP). The ages ranged from 18 to 55 years old. There was a statistically significant relationship at the p safety of flight.

Mouse infection models for space flight immunology

Science.gov (United States)

Chapes, Stephen Keith; Ganta, Roman Reddy; Chapers, S. K. (Principal Investigator)

2005-01-01

Several immunological processes can be affected by space flight. However, there is little evidence to suggest that flight-induced immunological deficits lead to illness. Therefore, one of our goals has been to define models to examine host resistance during space flight. Our working hypothesis is that space flight crews will come from a heterogeneous population; the immune response gene make-up will be quite varied. It is unknown how much the immune response gene variation contributes to the potential threat from infectious organisms, allergic responses or other long term health problems (e.g. cancer). This article details recent efforts of the Kansas State University gravitational immunology group to assess how population heterogeneity impacts host health, either in laboratory experimental situations and/or using the skeletal unloading model of space-flight stress. This paper details our use of several mouse strains with several different genotypes. In particular, mice with varying MHCII allotypes and mice on the C57BL background with different genetic defects have been particularly useful tools with which to study infections by Staphylococcus aureus, Salmonella typhimurium, Pasteurella pneumotropica and Ehrlichia chaffeensis. We propose that some of these experimental challenge models will be useful to assess the effects of space flight on host resistance to infection.

Fused Reality for Enhanced Flight Test Capabilities

Science.gov (United States)

Bachelder, Ed; Klyde, David

2011-01-01

The feasibility of using Fused Reality-based simulation technology to enhance flight test capabilities has been investigated. In terms of relevancy to piloted evaluation, there remains no substitute for actual flight tests, even when considering the fidelity and effectiveness of modern ground-based simulators. In addition to real-world cueing (vestibular, visual, aural, environmental, etc.), flight tests provide subtle but key intangibles that cannot be duplicated in a ground-based simulator. There is, however, a cost to be paid for the benefits of flight in terms of budget, mission complexity, and safety, including the need for ground and control-room personnel, additional aircraft, etc. A Fused Reality(tm) (FR) Flight system was developed that allows a virtual environment to be integrated with the test aircraft so that tasks such as aerial refueling, formation flying, or approach and landing can be accomplished without additional aircraft resources or the risk of operating in close proximity to the ground or other aircraft. Furthermore, the dynamic motions of the simulated objects can be directly correlated with the responses of the test aircraft. The FR Flight system will allow real-time observation of, and manual interaction with, the cockpit environment that serves as a frame for the virtual out-the-window scene.

Flight Qualification of the NASA's Super Pressure Balloon

Science.gov (United States)

Cathey, Henry; Said, Magdi; Fairbrother, Debora

Designs of new balloons to support space science require a number of actual flights under various flight conditions to qualify them to as standard balloon flight offerings to the science community. Development of the new Super Pressure Balloon for the National Aeronautics and Space Administration’s Balloon Program Office has entailed employing new design, analysis, and production techniques to advance the state of the art. Some of these advances have been evolutionary steps and some have been revolutionary steps requiring a maturing understanding of the materials, designs, and manufacturing approaches. The NASA Super Pressure Balloon development end goal is to produce a flight vehicle that is qualified to carry a ton of science instrumentation, at an altitude greater than 33 km while maintaining a near constant pressure altitude for extended periods of up to 100 days, and at any latitude on the globe. The NASA’s Balloon Program Office has pursued this development in a carefully executed incremental approach by gradually increasing payload carrying capability and increasing balloon volume to reach these end goal. A very successful test flight of a ~200,700 m3 balloon was launch in late 2008 from Antarctica. This balloon flew for over 54 days at a constant altitude and circled the Antarctic continent almost three times. A larger balloon was flown from Antarctica in early 2011. This ~422,400 m3 flew at a constant altitude for 22 days making one circuit around Antarctica. Although the performance was nominal, the flight was terminated via command to recover high valued assets from the payload. The balloon designed to reach the program goals is a ~532,200 m3 pumpkin shaped Super Pressure Balloon. A test flight of this balloon was launched from the Swedish Space Corporation’s Esrange Balloon Launch Facilities near Kiruna, Sweden on 14 August, 2012. This flight was another success for this development program. Valuable information was gained from this short test

48 CFR 1852.228-71 - Aircraft flight risks.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Aircraft flight risks. 1852... 1852.228-71 Aircraft flight risks. (a) As prescribed in 1828.311-2, insert the following clause: Aircraft Flight Risks (DEC 1988) (a) Notwithstanding any other provision of this contract (particularly...

14 CFR 125.363 - Flight release over water.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight release over water. 125.363 Section 125.363 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Flight release over water. (a) No person may release an airplane for a flight that involves extended...

In-Flight Hypoxemia in a Tracheostomy-Dependent Infant

Directory of Open Access Journals (Sweden)

Jason Quevreaux

2017-01-01

Full Text Available Millions of passengers board commercial flights every year. Healthcare providers are often called upon to treat other passengers during in-flight emergencies. The case presented involves an anesthesia resident treating a tracheostomy-dependent infant who developed hypoxemia on a domestic flight. The patient had an underlying congenital muscular disorder and was mechanically ventilated while at altitude. Although pressurized, cabin barometric pressure while at altitude is less than at sea level. Due to this environment patients with underlying pulmonary or cardiac pathology might not be able to tolerate commercial flight. The Federal Aviation Administration (FAA has mandated a specific set of medical supplies be present on all domestic flights in addition to legislature protecting “Good Samaritan” providers.

Enroute flight-path planning - Cooperative performance of flight crews and knowledge-based systems

Science.gov (United States)

Smith, Philip J.; Mccoy, Elaine; Layton, Chuck; Galdes, Deb

1989-01-01

Interface design issues associated with the introduction of knowledge-based systems into the cockpit are discussed. Such issues include not only questions about display and control design, they also include deeper system design issues such as questions about the alternative roles and responsibilities of the flight crew and the computer system. In addition, the feasibility of using enroute flight path planning as a context for exploring such research questions is considered. In particular, the development of a prototyping shell that allows rapid design and study of alternative interfaces and system designs is discussed.

High Flight. Aerospace Activities, K-12.

Science.gov (United States)

Oklahoma State Dept. of Education, Oklahoma City.

Following discussions of Oklahoma aerospace history and the history of flight, interdisciplinary aerospace activities are presented. Each activity includes title, concept fostered, purpose, list of materials needed, and procedure(s). Topics include planets, the solar system, rockets, airplanes, air travel, space exploration, principles of flight,…

Alternativas y acciones en el tema de residuos sólidos planteadas por las municipalidades de Jiménez y Oreamuno y su relación con el desarrollo y la sostenibilidad (Artículo informativo Alternatives and actions regarding solid residues, presented by Jimenez and Oreamuno municipalities and their relation to development and sustainability (Informative

Directory of Open Access Journals (Sweden)

Rooel Campos-Rodríguez

2013-06-01

Full Text Available Los procesos productivos no son totalmente eficientes, lo cual contribuye a la generación de residuos.  En Costa Rica, son las municipalidades las responsables del manejo integral de los residuos sólidos. Es por eso que la problemática de esta investigación se centra en el manejo de tales desechos, que se ha convertido en uno de los principales problemas ambientales que enfrentan los municipios del país.  Es necesario hacerle frente desde la perspectiva del desarrollo sostenible, para lo cual se requiere una nueva visión y sensibilización de los gobiernos locales y de los habitantes ante esta problemática.  Un ejemplo de cómo encarar la problemática ambiental es la labor que están desarrollando los municipios de Jiménez y Oreamuno. Estas dos instituciones han trabajado en aspectos de educación ambiental, desarrollo y sostenibilidad y han logrado resultados favorables en el tratamiento y disposición adecuada de los residuos sólidos.  El municipio de Oreamuno cuenta con un plan de manejo integral de residuos sólidos, tanto orgánicos como inorgánicos. También tiene un centro de acopio y se está trabajando en la implementación de biorreactores que permitirán la producción de bioabonos, captación de gas metano, remoción de metales en los lixiviados, así como la recuperación, comercialización y transformación de los residuos reciclables y reutilizables. Por su parte, el municipio de Jiménez realiza un manejo adecuado de los residuos; los desechos inorgánicos reciclables son aprovechados por medio del centro de acopio del cantón y los residuos orgánicos son transformados en abono orgánico, el cual se utiliza en las fincas de la localidad. El objetivo de este artículo es analizar estos planteamientos, así como su relación con el desarrollo y la sostenibilidad.Currently, the production processes are not efficient, which contributes to the generation of waste. In Costa Rica the municipalities are responsible for

Control-oriented reduced order modeling of dipteran flapping flight

Science.gov (United States)

Faruque, Imraan

Flying insects achieve flight stabilization and control in a manner that requires only small, specialized neural structures to perform the essential components of sensing and feedback, achieving unparalleled levels of robust aerobatic flight on limited computational resources. An engineering mechanism to replicate these control strategies could provide a dramatic increase in the mobility of small scale aerial robotics, but a formal investigation has not yet yielded tools that both quantitatively and intuitively explain flapping wing flight as an "input-output" relationship. This work uses experimental and simulated measurements of insect flight to create reduced order flight dynamics models. The framework presented here creates models that are relevant for the study of control properties. The work begins with automated measurement of insect wing motions in free flight, which are then used to calculate flight forces via an empirically-derived aerodynamics model. When paired with rigid body dynamics and experimentally measured state feedback, both the bare airframe and closed loop systems may be analyzed using frequency domain system identification. Flight dynamics models describing maneuvering about hover and cruise conditions are presented for example fruit flies (Drosophila melanogaster) and blowflies (Calliphorids). The results show that biologically measured feedback paths are appropriate for flight stabilization and sexual dimorphism is only a minor factor in flight dynamics. A method of ranking kinematic control inputs to maximize maneuverability is also presented, showing that the volume of reachable configurations in state space can be dramatically increased due to appropriate choice of kinematic inputs.

Flight performance of Galileo and Ulysses RTGs

International Nuclear Information System (INIS)

Hemler, R.J.; Kelly, C.E.

1993-01-01

Flight performance data of the GPHS-RTGs (General Purpose Heat Source---Radioisotope Thermoelectric Generators) on the Galileo and Ulysses spacecraft are reported. Comparison of the flight data with analytical predictions is preformed. Differences between actual flight telemetry data and analytical predictions are addressed including the degree of uncertainty associated with the telemetry data. End of mission power level predictions are included for both missions with an overall assessment of RTG mission performances

Core Flight Software

Data.gov (United States)

National Aeronautics and Space Administration — The AES Core Flight Software (CFS) project purpose is to analyze applicability, and evolve and extend the reusability of the CFS system originally developed by...

El Vignola del Colegio de Arquitectos de Valencia y sus retablos de traza sevillana: Juan Martínez Montañés

Directory of Open Access Journals (Sweden)

Navarrete Prieto, Benito

2005-09-01

Full Text Available Three drawings of altarpieces executed by the Sevillian sculptor Juan Martinez Montañés, preserved in the copy of Vignola's architectural treatise in the Colegio de Arquitectos de Valencia are analyzed here. The first drawing is a preliminary study for the altarpiece of the Immaculate Conception in the Parrochial Church of El Pedroso (Seville. The second drawing, also a preliminary idea, is for the lost altarpiece of the Dominican monastery of Portacelli in Seville, from which only the figure of St Dominic of Guzman flagellating himself has survived (Museo de Bellas Artes de Sevilla. The third is the model for the type of altarpiece-tabernacle used by Montañés in the Convent of Santa Clara (Seville. The author also points out the origin of certain elements of Montañés's designs in the prints of Vignola's treatise.

Presentamos un análisis de tres de los dibujos de retablos que se conservan en el ejemplar del Vignola del Colegio de Arquitectos de Valencia y que pertenecen al escultor sevillano Juan Martínez Montañés. El primero de ellos es preparatorio para el retablo de la Inmaculada de la iglesia parroquial del Pedroso (Sevilla, conservado in situ actualmente. El segundo es para el perdido Retablo de los dominicos de Portacoeli de Sevilla, del que se conserva el Santo Domingo de Guzman azotándose en el Museo de Bellas Artes de Sevilla, y el tercero es modelo para la tipología del Montañés del Retablo-Tabernáculo en la iglesia del convento de Santa Clara de Sevilla, estudiándose además el origen de algunos elementos de Montañés en los propios grabados del libro de Vignola.

Space Flight-Associated Neuro-ocular Syndrome.

Science.gov (United States)

Lee, Andrew G; Mader, Thomas H; Gibson, C Robert; Tarver, William

2017-09-01

New and unique physiologic and pathologic systemic and neuro-ocular responses have been documented in astronauts during and after long-duration space flight. Although the precise cause remains unknown, space flight-associated neuro-ocular syndrome (SANS) has been adopted as an appropriate descriptive term. The Space Medicine Operations Division of the US National Aeronautics and Space Administration (NASA) has documented the variable occurrence of SANS in astronauts returning from long-duration space flight on the International Space Station. These clinical findings have included unilateral and bilateral optic disc edema, globe flattening, choroidal and retinal folds, hyperopic refractive error shifts, and nerve fiber layer infarcts. The clinical findings of SANS have been correlated with structural changes on intraorbital and intracranial magnetic resonance imaging and in-flight and terrestrial ultrasonographic studies and ocular optical coherence tomography. Further study of SANS is ongoing for consideration of future manned missions to space, including a return trip to the moon or Mars.

F-15 IFCS Intelligent Flight Control System

Science.gov (United States)

Bosworth, John T.

2008-01-01

This viewgraph presentation gives a detailed description of the F-15 aircraft, flight tests, aircraft performance and overall advanced neural network based flight control technologies for aerospace systems designs.

The Flight of Birds and Other Animals

Directory of Open Access Journals (Sweden)

Colin J. Pennycuick

2015-09-01

Full Text Available Methods of observing birds in flight now include training them to fly under known conditions in wind tunnels, and fitting free-flying birds with data loggers, that are either retrieved or read remotely via satellite links. The performance that comes to light depends on the known limitations of the materials from which they are made, and the conditions in which the birds live. Bird glide polars can be obtained by training birds to glide in a tilting wind tunnel. Translating these curves to power required from the flight muscles in level flight requires drag coefficients to be measured, which unfortunately does not work with bird bodies, because the flow is always fully detached. The drag of bodies in level flight can be determined by observing wingbeat frequency, and shows CD values around 0.08 in small birds, down to 0.06 in small waders specialised for efficient migration. Lift coefficients are up to 1.6 in gliding, or 1.8 for short, temporary glides. In-flight measurements can be used to calculate power curves for birds in level flight, and this has been applied to migrating geese in detail. These typically achieve lift:drag ratios around 15, including allowances for stops, as against 19 for continuous powered flight. The same calculations, applied to Pacific Black-tailed Godwits which start with fat fractions up to 0.55 at departure, show that such birds not only cross the Pacific to New Zealand, but have enough fuel in hand to reach the South Pole if that were necessary. This performance depends on the “dual fuel” arrangements of these migrants, whereby they use fat as their main fuel, and supplement this by extra fuel from burning the engine (flight muscles, as less power is needed later in the flight. The accuracy of these power curves has never been checked, although provision for stopping the bird, and making these checks at regular intervals during a simulated flight was built into the original design of the Lund wind tunnel. The

DAST in Flight Showing Diverging Wingtip Oscillations

Science.gov (United States)

1980-01-01

Two BQM-34 Firebee II drones were modified with supercritical airfoils, called the Aeroelastic Research Wing (ARW), for the Drones for Aerodynamic and Structural Testing (DAST) program, which ran from 1977 to 1983. In this view of DAST-1 (Serial # 72-1557), taken on June 12, 1980, severe wingtip flutter is visible. Moments later, the right wing failed catastrophically and the vehicle crashed near Cuddeback Dry Lake. Before the drone was lost, it had made two captive and two free flights. Its first free flight, on October 2, 1979, was cut short by an uplink receiver failure. The drone was caught in midair by an HH-3 helicopter. The second free flight, on March 12, 1980, was successful, ending in a midair recovery. The third free flight, made on June 12, was to expand the flutter envelope. All of these missions launched from the NASA B-52. From 1977 to 1983, the Dryden Flight Research Center, Edwards, California, (under two different names) conducted the DAST Program as a high-risk flight experiment using a ground-controlled, pilotless aircraft. Described by NASA engineers as a 'wind tunnel in the sky,' the DAST was a specially modified Teledyne-Ryan BQM-34E/F Firebee II supersonic target drone that was flown to validate theoretical predictions under actual flight conditions in a joint project with the Langley Research Center, Hampton, Virginia. The DAST Program merged advances in electronic remote control systems with advances in airplane design. Drones (remotely controlled, missile-like vehicles initially developed to serve as gunnery targets) had been deployed successfully during the Vietnamese conflict as reconnaissance aircraft. After the war, the energy crisis of the 1970s led NASA to seek new ways to cut fuel use and improve airplane efficiency. The DAST Program's drones provided an economical, fuel-conscious method for conducting in-flight experiments from a remote ground site. DAST explored the technology required to build wing structures with less than

DAST Being Calibrated for Flight in Hangar

Science.gov (United States)

1982-01-01

DAST-2, a modified BQM-34 Firebee II drone, undergoes calibration in a hangar at the NASA Dryden Flight Research Center. After the crash of the first DAST vehicle, project personnel fitted a second Firebee II (serial # 72-1558) with the rebuilt ARW-1 (ARW-1R) wing. The DAST-2 made a captive flight aboard the B-52 on October 29, 1982, followed by a free flight on November 3, 1982. During January and February of 1983, three launch attempts from the B-52 had to be aborted due to various problems. Following this, the project changed the launch aircraft to a DC-130A. Two captive flights occurred in May 1983. The first launch attempt from the DC-130 took place on June 1, 1983. The mothership released the DAST-2, but the recovery system immediately fired without being commanded. The parachute then disconnected from the vehicle, and the DAST-2 crashed into a farm field near Harper Dry Lake. Wags called this the 'Alfalfa Field Impact Test.' These are the image contact sheets for each image resolution of the NASA Dryden Drones for Aerodynamic and Structural Testing (DAST) Photo Gallery. From 1977 to 1983, the Dryden Flight Research Center, Edwards, California, (under two different names) conducted the DAST Program as a high-risk flight experiment using a ground-controlled, pilotless aircraft. Described by NASA engineers as a 'wind tunnel in the sky,' the DAST was a specially modified Teledyne-Ryan BQM-34E/F Firebee II supersonic target drone that was flown to validate theoretical predictions under actual flight conditions in a joint project with the Langley Research Center, Hampton, Virginia. The DAST Program merged advances in electronic remote control systems with advances in airplane design. Drones (remotely controlled, missile-like vehicles initially developed to serve as gunnery targets) had been deployed successfully during the Vietnamese conflict as reconnaissance aircraft. After the war, the energy crisis of the 1970s led NASA to seek new ways to cut fuel use and

Radioastron flight operations

Science.gov (United States)

Altunin, V. I.; Sukhanov, K. G.; Altunin, K. R.

1993-01-01

Radioastron is a space-based very-long-baseline interferometry (VLBI) mission to be operational in the mid-90's. The spacecraft and space radio telescope (SRT) will be designed, manufactured, and launched by the Russians. The United States is constructing a DSN subnet to be used in conjunction with a Russian subnet for Radioastron SRT science data acquisition, phase link, and spacecraft and science payload health monitoring. Command and control will be performed from a Russian tracking facility. In addition to the flight element, the network of ground radio telescopes which will be performing co-observations with the space telescope are essential to the mission. Observatories in 39 locations around the world are expected to participate in the mission. Some aspects of the mission that have helped shaped the flight operations concept are: separate radio channels will be provided for spacecraft operations and for phase link and science data acquisition; 80-90 percent of the spacecraft operational time will be spent in an autonomous mode; and, mission scheduling must take into account not only spacecraft and science payload constraints, but tracking station and ground observatory availability as well. This paper will describe the flight operations system design for translating the Radioastron science program into spacecraft executed events. Planning for in-orbit checkout and contingency response will also be discussed.

SP-100 from ground demonstration to flight validation

International Nuclear Information System (INIS)

Buden, D.

1989-01-01

The SP-100 program is in the midst of developing and demonstrating the technology of a liquid-metal-cooled fast reactor using thermoelectric thermal-to-electric conversion devices for space power applications in the range of tens to hundreds of kilowatts. The current ground engineering system (GES) design and development phase will demonstrate the readiness of the technology building blocks and the system to proceed to flight system validation. This phase includes the demonstration of a 2.4-MW(thermal) reactor in the nuclear assembly test (NAT) and aerospace subsystem in the integrated assembly test (IAT). The next phase in the SP-100 development, now being planned, is to be a flight demonstration of the readiness of the technology to be incorporated into future military and civilian missions. This planning will answer questions concerning the logical progression of the GES to the flight validation experiment. Important issues in planning the orderly transition include answering the need to plan for a second reactor ground test, the method to be used to test the SP-100 for acceptance for flight, the need for the IAT prior to the flight-test configuration design, the efficient use of facilities for GES and the flight experiment, and whether the NAT should be modified based on flight experiment planning

Flight Control Laws for NASA's Hyper-X Research Vehicle

Science.gov (United States)

Davidson, J.; Lallman, F.; McMinn, J. D.; Martin, J.; Pahle, J.; Stephenson, M.; Selmon, J.; Bose, D.

1999-01-01

The goal of the Hyper-X program is to demonstrate and validate technology for design and performance predictions of hypersonic aircraft with an airframe-integrated supersonic-combustion ramjet propulsion system. Accomplishing this goal requires flight demonstration of a hydrogen-fueled scramjet powered hypersonic aircraft. A key enabling technology for this flight demonstration is flight controls. Closed-loop flight control is required to enable a successful stage separation, to achieve and maintain the design condition during the engine test, and to provide a controlled descent. Before the contract award, NASA developed preliminary flight control laws for the Hyper-X to evaluate the feasibility of the proposed scramjet test sequence and descent trajectory. After the contract award, a Boeing/NASA partnership worked to develop the current control laws. This paper presents a description of the Hyper-X Research Vehicle control law architectures with performance and robustness analyses. Assessments of simulated flight trajectories and stability margin analyses demonstrate that these control laws meet the flight test requirements.

14 CFR 125.311 - Flight crewmembers at controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 125.311... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Operations § 125.311 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each...

The Propulsive-Only Flight Control Problem

Science.gov (United States)

Blezad, Daniel J.

1996-01-01

Attitude control of aircraft using only the throttles is investigated. The long time constants of both the engines and of the aircraft dynamics, together with the coupling between longitudinal and lateral aircraft modes make piloted flight with failed control surfaces hazardous, especially when attempting to land. This research documents the results of in-flight operation using simulated failed flight controls and ground simulations of piloted propulsive-only control to touchdown. Augmentation control laws to assist the pilot are described using both optimal control and classical feedback methods. Piloted simulation using augmentation shows that simple and effective augmented control can be achieved in a wide variety of failed configurations.

Acute symptomatic hyponatremia in a flight attendant.

Science.gov (United States)

Madero, Magdalena; Monares, Enrique; Domínguez, Aurelio Méndez; Ayus, Juan Carlos

2015-08-01

Acute symptomatic hyponatremia after thiazide diuretic initiation is a medical emergency. Here we describe the case of a flight attendant who developed acute hyponatremia during a flight and the potential risk factors for developing this condition. A 57-year-old flight attendant with history of essential hypertension was recently started on a thiazide diuretic. As she did routinely when working, she increased her water intake during a flight from London to Mexico City. She complained of nausea and headache during the flight. Upon arrival, she developed severe disorientation and presented to the hospital emergency room (ER) with a Glasgow scale of 12, hypoxia, and a generalized tonic clonic seizure. Her laboratory results on arrival were consistent with severe hyponatremia (serum Na 116 mEql/L) and severe cerebral edema by CT scan. She was treated with hypertonic saline, with complete resolution of the neurologic symptoms. We describe high water intake and hypoxia related to decreased partial pressure of oxygen in the cabin as the two main risk factors for thiazide-induced acute hyponatremia in this case.

Spatially correlated heterogeneous aspirations to enhance network reciprocity

Science.gov (United States)

Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki

2012-02-01

Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.

Outcomes of medical emergencies on commercial airline flights.

Science.gov (United States)

Peterson, Drew C; Martin-Gill, Christian; Guyette, Francis X; Tobias, Adam Z; McCarthy, Catherine E; Harrington, Scott T; Delbridge, Theodore R; Yealy, Donald M

2013-05-30

Worldwide, 2.75 billion passengers fly on commercial airlines annually. When in-flight medical emergencies occur, access to care is limited. We describe in-flight medical emergencies and the outcomes of these events. We reviewed records of in-flight medical emergency calls from five domestic and international airlines to a physician-directed medical communications center from January 1, 2008, through October 31, 2010. We characterized the most common medical problems and the type of on-board assistance rendered. We determined the incidence of and factors associated with unscheduled aircraft diversion, transport to a hospital, and hospital admission, and we determined the incidence of death. There were 11,920 in-flight medical emergencies resulting in calls to the center (1 medical emergency per 604 flights). The most common problems were syncope or presyncope (37.4% of cases), respiratory symptoms (12.1%), and nausea or vomiting (9.5%). Physician passengers provided medical assistance in 48.1% of in-flight medical emergencies, and aircraft diversion occurred in 7.3%. Of 10,914 patients for whom postflight follow-up data were available, 25.8% were transported to a hospital by emergency-medical-service personnel, 8.6% were admitted, and 0.3% died. The most common triggers for admission were possible stroke (odds ratio, 3.36; 95% confidence interval [CI], 1.88 to 6.03), respiratory symptoms (odds ratio, 2.13; 95% CI, 1.48 to 3.06), and cardiac symptoms (odds ratio, 1.95; 95% CI, 1.37 to 2.77). Most in-flight medical emergencies were related to syncope, respiratory symptoms, or gastrointestinal symptoms, and a physician was frequently the responding medical volunteer. Few in-flight medical emergencies resulted in diversion of aircraft or death; one fourth of passengers who had an in-flight medical emergency underwent additional evaluation in a hospital. (Funded by the National Institutes of Health.).

Revisiting mouse peritoneal macrophages: heterogeneity, development and function

Directory of Open Access Journals (Sweden)

Alexandra Dos Anjos Cassado

2015-05-01

Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex

Assessing public and crew exposure in commercial flights in Brazil

International Nuclear Information System (INIS)

Rochedo, E.R.R.; Alves, V.A.; Silva, D.N.G.

2015-01-01

The exposure to cosmic radiation in aircraft travel is significantly higher than at ground level and varies with the route due to the effect of latitude, the altitude of flight, the flight time, and the year according to the solar cycle effects in galactic cosmic ray flux. The computer program CARI-6, developed by the U.S. Federal Aviation Administration, calculates the effective dose of galactic cosmic radiation received by an individual in an aircraft flying the shortest route between two airports of the world. The program takes into account changes in altitude and geographic location during the course of a flight. The aim of this project is to estimate the contribution of cosmic radiation exposure on commercial flights to the Brazilian population. A database, including about 4,000 domestic flights in Brazil, was implemented in Excel spreadsheets based on data flights information for November 2011. Main fields included on the database are the origin and destination of flights, time of departure and arrival, plane type, number of passengers, flight times (take-off, landing and cruse altitude times) and number of flights per year. This information was used to estimate individual and collective doses for crew and passengers. Doses for domestic flights in Brazil range from 1.8 to 8.8 μSv. Considering the occupational limit of 850 h of flight per year for crew members and numbers of flights for each route, average occupational dose would be about 0.76 mSv/y. Collective doses, for the total number of flights per year and airplane types were estimated to be 214 and 11 manSv/y for passengers and crew members, respectively. (authors)

A Unique Software System For Simulation-to-Flight Research

Science.gov (United States)

Chung, Victoria I.; Hutchinson, Brian K.

2001-01-01

"Simulation-to-Flight" is a research development concept to reduce costs and increase testing efficiency of future major aeronautical research efforts at NASA. The simulation-to-flight concept is achieved by using common software and hardware, procedures, and processes for both piloted-simulation and flight testing. This concept was applied to the design and development of two full-size transport simulators, a research system installed on a NASA B-757 airplane, and two supporting laboratories. This paper describes the software system that supports the simulation-to-flight facilities. Examples of various simulation-to-flight experimental applications were also provided.

Aircraft digital flight control technical review

Science.gov (United States)

Davenport, Otha B.; Leggett, David B.

1993-01-01

The Aircraft Digital Flight Control Technical Review was initiated by two pilot induced oscillation (PIO) incidents in the spring and summer of 1992. Maj. Gen. Franklin (PEO) wondered why the Air Force development process for digital flight control systems was not preventing PIO problems. Consequently, a technical review team was formed to examine the development process and determine why PIO problems continued to occur. The team was also to identify the 'best practices' used in the various programs. The charter of the team was to focus on the PIO problem, assess the current development process, and document the 'best practices.' The team reviewed all major USAF aircraft programs with digital flight controls, specifically, the F-15E, F-16C/D, F-22, F-111, C-17, and B-2. The team interviewed contractor, System Program Office (SPO), and Combined Test Force (CTF) personnel on these programs. The team also went to NAS Patuxent River to interview USN personnel about the F/A-18 program. The team also reviewed experimental USAF and NASA systems with digital flight control systems: X-29, X-31, F-15 STOL and Maneuver Technology Demonstrator (SMTD), and the Variable In-Flight Stability Test Aircraft (VISTA). The team also discussed the problem with other experts in the field including Ralph Smith and personnel from Calspan. The major conclusions and recommendations from the review are presented.

Manual Manipulation of Engine Throttles for Emergency Flight Control

Science.gov (United States)

Burcham, Frank W., Jr.; Fullerton, C. Gordon; Maine, Trindel A.

2004-01-01

If normal aircraft flight controls are lost, emergency flight control may be attempted using only engines thrust. Collective thrust is used to control flightpath, and differential thrust is used to control bank angle. Flight test and simulation results on many airplanes have shown that pilot manipulation of throttles is usually adequate to maintain up-and-away flight, but is most often not capable of providing safe landings. There are techniques that will improve control and increase the chances of a survivable landing. This paper reviews the principles of throttles-only control (TOC), a history of accidents or incidents in which some or all flight controls were lost, manual TOC results for a wide range of airplanes from simulation and flight, and suggested techniques for flying with throttles only and making a survivable landing.

Aportaciones a la flora Granatense, III

OpenAIRE

Martínez Parras, J.Mª.; Molero Mesa, J.

1983-01-01

Se comentan algunas especies nuevas o críticas para la provincia de Granada. Se establecen las nuevas combinaciones siguientes: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa y Cerastium alpinum subsp. nevadense (Pau) Martínez Parras & Molero Mesa. In this paper, some plants from Granada province are studied. The following new combinations are stablished: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa and Cerastium alpinum subsp. ...

Multimodal Displays for Target Localization in a Flight Test

National Research Council Canada - National Science Library

Tannen, Robert

2001-01-01

... Synthesized Immersion Research Environment (SIRE) facility. Twelve pilots with a mean of 2652 flight hours performed a simulated flight task in which they were instructed to maintain a prescribed flight path, air speed, and altitude...

Flight assessment of a large supersonic drone aircraft for research use

Science.gov (United States)

Eckstrom, C. V.; Peele, E. L.

1974-01-01

An assessment is made of the capabilities of the BQM-34E supersonic drone aircraft as a test bed research vehicle. This assessment is made based on a flight conducted for the purpose of obtaining flight test measurements of wing loads at various maneuver flight conditions. Flight plan preparation, flight simulation, and conduct of the flight test are discussed along with a presentation of the test data obtained and an evaluation of how closely the flight test followed the test plan.

Investigating Flight with a Toy Helicopter

Science.gov (United States)

Liebl, Michael

2010-01-01

Flight fascinates people of all ages. Recent advances in battery technology have extended the capabilities of model airplanes and toy helicopters. For those who have never outgrown a childhood enthusiasm for the wonders of flight, it is possible to buy inexpensive, remotely controlled planes and helicopters. A toy helicopter offers an opportunity…

Flight Results of the NF-15B Intelligent Flight Control System (IFCS) Aircraft with Adaptation to a Longitudinally Destabilized Plant

Science.gov (United States)

Bosworth, John T.

2008-01-01

Adaptive flight control systems have the potential to be resilient to extreme changes in airplane behavior. Extreme changes could be a result of a system failure or of damage to the airplane. The goal for the adaptive system is to provide an increase in survivability in the event that these extreme changes occur. A direct adaptive neural-network-based flight control system was developed for the National Aeronautics and Space Administration NF-15B Intelligent Flight Control System airplane. The adaptive element was incorporated into a dynamic inversion controller with explicit reference model-following. As a test the system was subjected to an abrupt change in plant stability simulating a destabilizing failure. Flight evaluations were performed with and without neural network adaptation. The results of these flight tests are presented. Comparison with simulation predictions and analysis of the performance of the adaptation system are discussed. The performance of the adaptation system is assessed in terms of its ability to stabilize the vehicle and reestablish good onboard reference model-following. Flight evaluation with the simulated destabilizing failure and adaptation engaged showed improvement in the vehicle stability margins. The convergent properties of this initial system warrant additional improvement since continued maneuvering caused continued adaptation change. Compared to the non-adaptive system the adaptive system provided better closed-loop behavior with improved matching of the onboard reference model. A detailed discussion of the flight results is presented.

Multi-Exciter Vibroacoustic Simulation of Hypersonic Flight Vibration

International Nuclear Information System (INIS)

GREGORY, DANNY LYNN; CAP, JEROME S.; TOGAMI, THOMAS C.; NUSSER, MICHAEL A.; HOLLINGSHEAD, JAMES RONALD

1999-01-01

Many aerospace structures must survive severe high frequency, hypersonic, random vibration during their flights. The random vibrations are generated by the turbulent boundary layer developed along the exterior of the structures during flight. These environments have not been simulated very well in the past using a fixed-based, single exciter input with an upper frequency range of 2 kHz. This study investigates the possibility of using acoustic ardor independently controlled multiple exciters to more accurately simulate hypersonic flight vibration. The test configuration, equipment, and methodology are described. Comparisons with actual flight measurements and previous single exciter simulations are also presented

The ASAC Flight Segment and Network Cost Models

Science.gov (United States)

Kaplan, Bruce J.; Lee, David A.; Retina, Nusrat; Wingrove, Earl R., III; Malone, Brett; Hall, Stephen G.; Houser, Scott A.

1997-01-01

To assist NASA in identifying research art, with the greatest potential for improving the air transportation system, two models were developed as part of its Aviation System Analysis Capability (ASAC). The ASAC Flight Segment Cost Model (FSCM) is used to predict aircraft trajectories, resource consumption, and variable operating costs for one or more flight segments. The Network Cost Model can either summarize the costs for a network of flight segments processed by the FSCM or can be used to independently estimate the variable operating costs of flying a fleet of equipment given the number of departures and average flight stage lengths.

Flight Test Results from the NF-15B Intelligent Flight Control System (IFCS) Project with Adaptation to a Simulated Stabilator Failure

Science.gov (United States)

Bosworth, John T.; Williams-Hayes, Peggy S.

2010-01-01

Adaptive flight control systems have the potential to be more resilient to extreme changes in airplane behavior. Extreme changes could be a result of a system failure or of damage to the airplane. A direct adaptive neural-network-based flight control system was developed for the National Aeronautics and Space Administration NF-15B Intelligent Flight Control System airplane and subjected to an inflight simulation of a failed (frozen) (unmovable) stabilator. Formation flight handling qualities evaluations were performed with and without neural network adaptation. The results of these flight tests are presented. Comparison with simulation predictions and analysis of the performance of the adaptation system are discussed. The performance of the adaptation system is assessed in terms of its ability to decouple the roll and pitch response and reestablish good onboard model tracking. Flight evaluation with the simulated stabilator failure and adaptation engaged showed that there was generally improvement in the pitch response; however, a tendency for roll pilot-induced oscillation was experienced. A detailed discussion of the cause of the mixed results is presented.

X-36 Taking off During First Flight

Science.gov (United States)

1997-01-01

The X-36 remotely piloted aircraft lifts off on its first flight, May 17, 1997, at NASA's Dryden Flight Research Center, Edwards, California. The aircraft flew for five minutes and reached an altitude of approximately 4,900 feet. The NASA/Boeing X-36 Tailless Fighter Agility Research Aircraft program successfully demonstrated the tailless fighter design using advanced technologies to improve the maneuverability and survivability of possible future fighter aircraft. The program met or exceeded all project goals. For 31 flights during 1997 at the Dryden Flight Research Center, Edwards, California, the project team examined the aircraft's agility at low speed / high angles of attack and at high speed / low angles of attack. The aircraft's speed envelope reached up to 206 knots (234 mph). This aircraft was very stable and maneuverable. It handled very well. The X-36 vehicle was designed to fly without the traditional tail surfaces common on most aircraft. Instead, a canard forward of the wing was used as well as split ailerons and an advanced thrust-vectoring nozzle for directional control. The X-36 was unstable in both pitch and yaw axes, so an advanced, single-channel digital fly-by-wire control system (developed with some commercially available components) was put in place to stabilize the aircraft. Using a video camera mounted in the nose of the aircraft and an onboard microphone, the X-36 was remotely controlled by a pilot in a ground station virtual cockpit. A standard fighter-type head-up display (HUD) and a moving-map representation of the vehicle's position within the range in which it flew provided excellent situational awareness for the pilot. This pilot-in-the-loop approach eliminated the need for expensive and complex autonomous flight control systems and the risks associated with their inability to deal with unknown or unforeseen phenomena in flight. Fully fueled the X-36 prototype weighed approximately 1,250 pounds. It was 19 feet long and three feet

GRIP FLIGHT TRACKS AND ANIMATIONS V1

Data.gov (United States)

National Aeronautics and Space Administration — The GRIP Flight Tracks and Animations dataset includes both KML files and animation files. The KML files use Google Earth to show the flight tracks on a map. The...

In-flight cabin smoke control.

Science.gov (United States)

Eklund, T I

1996-12-31

Fatal accidents originating from in-flight cabin fires comprise only about 1% of all fatal accidents in the civil jet transport fleet. Nevertheless, the impossibility of escape during flight accentuates the hazards resulting from low visibility and toxic gases. Control of combustion products in an aircraft cabin is affected by several characteristics that make the aircraft cabin environment unique. The aircraft fuselage is pressurized in flight and has an air distribution system which provides ventilation jets from the ceiling level air inlets running along the cabin length. A fixed quantity of ventilation air is metered into the cabin and air discharge is handled primarily by pressure controlling outflow valves in the rear lower part of the fuselage. Earlier airplane flight tests on cabin smoke control used generators producing minimally buoyant smoke products that moved with and served as a telltales for overall cabin ventilation flows. Analytical studies were done with localized smoke production to predict the percent of cabin length that would remain smoke-free during continuous generation. Development of a buoyant smoke generator allowed simulation of a fire plume with controllable simulated temperature and heat release rates. Tests on a Boeing 757, modified to allow smoke venting out through the top of the cabin, showed that the buoyant smoke front moved at 0.46m/s (1.5ft/sec) with and 0.27m/sec (0.9ft/sec) against, the axial ventilation airflow. Flight tests in a modified Boeing 727 showed that a ceiling level counterflow of about 0.55m/sec (1.8ft/sec) was required to arrest the forward movement of buoyant smoke. A design goal of 0.61m/s (2ft/sec) axial cabin flow would require a flow rate of 99m3/min (3500ft3/min) in a furnished Boeing 757. The current maximum fresh air cabin ventilation flow is 78m3/min (2756 ft3/min). Experimental results indicate that buoyancy effects cause smoke movement behaviour that is not predicted by traditional design analyses and

Small-scale fixed wing airplane software verification flight test

Science.gov (United States)

Miller, Natasha R.

The increased demand for micro Unmanned Air Vehicles (UAV) driven by military requirements, commercial use, and academia is creating a need for the ability to quickly and accurately conduct low Reynolds Number aircraft design. There exist several open source software programs that are free or inexpensive that can be used for large scale aircraft design, but few software programs target the realm of low Reynolds Number flight. XFLR5 is an open source, free to download, software program that attempts to take into consideration viscous effects that occur at low Reynolds Number in airfoil design, 3D wing design, and 3D airplane design. An off the shelf, remote control airplane was used as a test bed to model in XFLR5 and then compared to flight test collected data. Flight test focused on the stability modes of the 3D plane, specifically the phugoid mode. Design and execution of the flight tests were accomplished for the RC airplane using methodology from full scale military airplane test procedures. Results from flight test were not conclusive in determining the accuracy of the XFLR5 software program. There were several sources of uncertainty that did not allow for a full analysis of the flight test results. An off the shelf drone autopilot was used as a data collection device for flight testing. The precision and accuracy of the autopilot is unknown. Potential future work should investigate flight test methods for small scale UAV flight.

Dosimetric system for prolonged manned flights

International Nuclear Information System (INIS)

Akatov, Yu.A.; Kovalev, E.E.; Sakovich, V.A.; Deme, Sh.; Fekher, I.; Nguen, V.D.

1991-01-01

Comments for the All-Union state standard 25645.202-83 named Radiation safety of a spacecraft crew during space flight. Requirements for personnel dosimetric control, are given. Devices for the dosimetric control used in manned space flights nowadays are reviewed. The performance principle and structure of the FEDOR dosimetric complex under development are discussed

14 CFR 61.56 - Flight review.

Science.gov (United States)

2010-01-01

... altitude, in lieu of the 1 hour of flight training required in paragraph (a) of this section. (c) Except as... flight training and 1 hour of ground training. The review must include: (1) A review of the current... of ground training specified in paragraph (a) of this section. (g) A student pilot need not...

Cosmonaut Dezhurov Talks With Flight Controllers

Science.gov (United States)

2001-01-01

Aboard the International Space Station (ISS), Cosmonaut and Expedition Three flight engineer Vladimir N. Dezhurov, representing Rosaviakosmos, talks with flight controllers from the Zvezda Service Module. Russian-built Zvezda is linked to the Functional Cargo Block (FGB), or Zarya, the first component of the ISS. Zarya was launched on a Russian Proton rocket prior to the launch of Unity. The third component of the ISS, Zvezda (Russian word for star), the primary Russian contribution to the ISS, was launched by a three-stage Proton rocket on July 12, 2000. Zvezda serves as the cornerstone for early human habitation of the Station, providing living quarters, a life support system, electrical power distribution, a data processing system, flight control system, and propulsion system. It also provides a communications system that includes remote command capabilities from ground flight controllers. The 42,000-pound module measures 43 feet in length and has a wing span of 98 feet. Similar in layout to the core module of Russia's Mir space station, it contains 3 pressurized compartments and 13 windows that allow ultimate viewing of Earth and space.